Reproductionresearch
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
PRODUCT SPECIFICATION Prest Antigen GJB5
PrEST Antigen GJB5 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen GJB5 Product Number APrEST78107 Gene Description gap junction protein, beta 5, 31.1kDa Alternative Gene CX31.1 Names Corresponding Anti-GJB5 (HPA038146) Antibodies Description Recombinant protein fragment of Human GJB5 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLL PDRPRDHVKK Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 24 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price. -
A Rare Missense Mutation in GJB3 (Cx31g45e) Is Associated with a Unique Cellular Phenotype Resulting in Necrotic Cell Death Easton, J
University of Dundee A rare missense mutation in GJB3 (Cx31G45E) is associated with a unique cellular phenotype resulting in necrotic cell death Easton, J. A.; Alboulshi, A. K.; Kamps, M. A. F.; Brouns, G. H.; Broers, M. R.; Coull, B. J.; Oji, V.; van Geel, M.; van Steensel, M. A. M.; Martin, P. E. Published in: Experimental Dermatology DOI: 10.1111/exd.13542 Publication date: 2018 Document Version Peer reviewed version Link to publication in Discovery Research Portal Citation for published version (APA): Easton, J. A., Alboulshi, A. K., Kamps, M. A. F., Brouns, G. H., Broers, M. R., Coull, B. J., ... Martin, P. E. (2018). A rare missense mutation in GJB3 (Cx31G45E) is associated with a unique cellular phenotype resulting in necrotic cell death. Experimental Dermatology. https://doi.org/10.1111/exd.13542 General rights Copyright and moral rights for the publications made accessible in Discovery Research Portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from Discovery Research Portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain. • You may freely distribute the URL identifying the publication in the public portal. Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. -
Nrf2 Modulates Host Defense During Streptococcus Pneumoniae Pneumonia in Mice
Nrf2 Modulates Host Defense during Streptococcus pneumoniae Pneumonia in Mice This information is current as John C. Gomez, Hong Dang, Jessica R. Martin and Claire of September 28, 2021. M. Doerschuk J Immunol published online 26 August 2016 http://www.jimmunol.org/content/early/2016/08/26/jimmun ol.1600043 Downloaded from Supplementary http://www.jimmunol.org/content/suppl/2016/08/26/jimmunol.160004 Material 3.DCSupplemental http://www.jimmunol.org/ Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication by guest on September 28, 2021 *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published August 26, 2016, doi:10.4049/jimmunol.1600043 The Journal of Immunology Nrf2 Modulates Host Defense during Streptococcus pneumoniae Pneumonia in Mice John C. Gomez,*,† Hong Dang,†,‡ Jessica R. Martin,*,† and Claire M. Doerschuk*,†,x Nrf2 regulates the transcriptional response to oxidative stress. These studies tested the role of Nrf2 during Streptococcus pneumoniae pneumonia and identified Nrf2-dependent genes and pathways in lung tissue and in recruited neutrophils. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Transcriptomic Analysis of Native Versus Cultured Human and Mouse Dorsal Root Ganglia Focused on Pharmacological Targets Short
bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Transcriptomic analysis of native versus cultured human and mouse dorsal root ganglia focused on pharmacological targets Short title: Comparative transcriptomics of acutely dissected versus cultured DRGs Andi Wangzhou1, Lisa A. McIlvried2, Candler Paige1, Paulino Barragan-Iglesias1, Carolyn A. Guzman1, Gregory Dussor1, Pradipta R. Ray1,#, Robert W. Gereau IV2, # and Theodore J. Price1, # 1The University of Texas at Dallas, School of Behavioral and Brain Sciences and Center for Advanced Pain Studies, 800 W Campbell Rd. Richardson, TX, 75080, USA 2Washington University Pain Center and Department of Anesthesiology, Washington University School of Medicine # corresponding authors [email protected], [email protected] and [email protected] Funding: NIH grants T32DA007261 (LM); NS065926 and NS102161 (TJP); NS106953 and NS042595 (RWG). The authors declare no conflicts of interest Author Contributions Conceived of the Project: PRR, RWG IV and TJP Performed Experiments: AW, LAM, CP, PB-I Supervised Experiments: GD, RWG IV, TJP Analyzed Data: AW, LAM, CP, CAG, PRR Supervised Bioinformatics Analysis: PRR Drew Figures: AW, PRR Wrote and Edited Manuscript: AW, LAM, CP, GD, PRR, RWG IV, TJP All authors approved the final version of the manuscript. 1 bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. -
Appendix 2. Significantly Differentially Regulated Genes in Term Compared with Second Trimester Amniotic Fluid Supernatant
Appendix 2. Significantly Differentially Regulated Genes in Term Compared With Second Trimester Amniotic Fluid Supernatant Fold Change in term vs second trimester Amniotic Affymetrix Duplicate Fluid Probe ID probes Symbol Entrez Gene Name 1019.9 217059_at D MUC7 mucin 7, secreted 424.5 211735_x_at D SFTPC surfactant protein C 416.2 206835_at STATH statherin 363.4 214387_x_at D SFTPC surfactant protein C 295.5 205982_x_at D SFTPC surfactant protein C 288.7 1553454_at RPTN repetin solute carrier family 34 (sodium 251.3 204124_at SLC34A2 phosphate), member 2 238.9 206786_at HTN3 histatin 3 161.5 220191_at GKN1 gastrokine 1 152.7 223678_s_at D SFTPA2 surfactant protein A2 130.9 207430_s_at D MSMB microseminoprotein, beta- 99.0 214199_at SFTPD surfactant protein D major histocompatibility complex, class II, 96.5 210982_s_at D HLA-DRA DR alpha 96.5 221133_s_at D CLDN18 claudin 18 94.4 238222_at GKN2 gastrokine 2 93.7 1557961_s_at D LOC100127983 uncharacterized LOC100127983 93.1 229584_at LRRK2 leucine-rich repeat kinase 2 HOXD cluster antisense RNA 1 (non- 88.6 242042_s_at D HOXD-AS1 protein coding) 86.0 205569_at LAMP3 lysosomal-associated membrane protein 3 85.4 232698_at BPIFB2 BPI fold containing family B, member 2 84.4 205979_at SCGB2A1 secretoglobin, family 2A, member 1 84.3 230469_at RTKN2 rhotekin 2 82.2 204130_at HSD11B2 hydroxysteroid (11-beta) dehydrogenase 2 81.9 222242_s_at KLK5 kallikrein-related peptidase 5 77.0 237281_at AKAP14 A kinase (PRKA) anchor protein 14 76.7 1553602_at MUCL1 mucin-like 1 76.3 216359_at D MUC7 mucin 7, -
Ion Channels
UC Davis UC Davis Previously Published Works Title THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Ion channels. Permalink https://escholarship.org/uc/item/1442g5hg Journal British journal of pharmacology, 176 Suppl 1(S1) ISSN 0007-1188 Authors Alexander, Stephen PH Mathie, Alistair Peters, John A et al. Publication Date 2019-12-01 DOI 10.1111/bph.14749 License https://creativecommons.org/licenses/by/4.0/ 4.0 Peer reviewed eScholarship.org Powered by the California Digital Library University of California S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2019/20: Ion channels. British Journal of Pharmacology (2019) 176, S142–S228 THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Ion channels Stephen PH Alexander1 , Alistair Mathie2 ,JohnAPeters3 , Emma L Veale2 , Jörg Striessnig4 , Eamonn Kelly5, Jane F Armstrong6 , Elena Faccenda6 ,SimonDHarding6 ,AdamJPawson6 , Joanna L Sharman6 , Christopher Southan6 , Jamie A Davies6 and CGTP Collaborators 1School of Life Sciences, University of Nottingham Medical School, Nottingham, NG7 2UH, UK 2Medway School of Pharmacy, The Universities of Greenwich and Kent at Medway, Anson Building, Central Avenue, Chatham Maritime, Chatham, Kent, ME4 4TB, UK 3Neuroscience Division, Medical Education Institute, Ninewells Hospital and Medical School, University of Dundee, Dundee, DD1 9SY, UK 4Pharmacology and Toxicology, Institute of Pharmacy, University of Innsbruck, A-6020 Innsbruck, Austria 5School of Physiology, Pharmacology and Neuroscience, University of Bristol, Bristol, BS8 1TD, UK 6Centre for Discovery Brain Science, University of Edinburgh, Edinburgh, EH8 9XD, UK Abstract The Concise Guide to PHARMACOLOGY 2019/20 is the fourth in this series of biennial publications. The Concise Guide provides concise overviews of the key properties of nearly 1800 human drug targets with an emphasis on selective pharmacology (where available), plus links to the open access knowledgebase source of drug targets and their ligands (www.guidetopharmacology.org), which provides more detailed views of target and ligand properties. -
Altered Physiological Functions and Ion Currents in Atrial Fibroblasts From
Physiological Reports ISSN 2051-817X ORIGINAL RESEARCH Altered physiological functions and ion currents in atrial fibroblasts from patients with chronic atrial fibrillation Claire Poulet1, Stephan Kunzel€ 1, Edgar Buttner€ 1, Diana Lindner2, Dirk Westermann2 & Ursula Ravens1 1 Department of Pharmacology and Toxicology, Medical Faculty Carl-Gustav-Carus, TU Dresden, Dresden, Germany 2 Department of General and Interventional Cardiology, University Heart Center Hamburg Eppendorf, Hamburg, Germany Keywords Abstract Atrial fibrillation, electrophysiology, fibroblasts. The contribution of human atrial fibroblasts to cardiac physiology and patho- physiology is poorly understood. Fibroblasts may contribute to arrhythmogen- Correspondence esis through fibrosis, or by directly altering electrical activity in Claire Poulet, Imperial College London, Imperial cardiomyocytes. The objective of our study was to uncover phenotypic differ- Centre for Translational and Experimental ences between cells from patients in sinus rhythm (SR) and chronic atrial fib- Medicine, Hammersmith Campus, Du Cane rillation (AF), with special emphasis on electrophysiological properties. We Road, London W12 0NN, UK isolated fibroblasts from human right atrial tissue for patch-clamp experi- Tel: +44 207 594 2738 Fax: +44 207 594 3653 ments, proliferation, migration, and differentiation assays, and gene expression E-mail: [email protected] profiling. In culture, proliferation and migration of AF fibroblasts were strongly impaired but differentiation into myofibroblasts was increased. This Present Addresses was associated with a higher number of AF fibroblasts expressing functional Claire Poulet, Imperial College London, Nav1.5 channels. Strikingly Na+ currents were considerably larger in AF cells. National Heart and Lung Institute, London, UK Blocking Na+ channels in culture with tetrodotoxin did not affect prolifera- tion, migration, or differentiation in neither SR nor AF cells. -
Genotypes and Phenotypes of a Family with a Deaf Child Carrying Combined Heterozygous Mutations in SLC26A4 and GJB3 Genes
MOLECULAR MEDICINE REPORTS 14: 319-324, 2016 Genotypes and phenotypes of a family with a deaf child carrying combined heterozygous mutations in SLC26A4 and GJB3 genes YUNLONG LI1,2 and BAOSHENG ZHU1,2 1Medical Faculty, Affiliated Hospital of Kunming University of Science and Technology (The First People's Hospital of Yunnan Province), Kunming University of Science and Technology, Kunming, Yunan 650500; 2Genetic Diagnosis Center, The First People's Hospital of Yunnan Province, Kunming, Yunnan 650032, P.R. China Received May 11, 2015; Accepted March 29, 2016 DOI: 10.3892/mmr.2016.5280 Abstract. Mutations in the SLC26A4 gene have been shown Introduction to cause a type of deafness referred to as large vestibular aqueduct syndrome (LVAS), whereas mutations in the GJB3 Deafness is the partial or total inability to hear (1). In adults, it gene have been associated with nonsyndromic deafness. causes problems in communication (2). In children, as well as However, the clinical phenotypes of these mutations vary and problems in communication, deafness affects the development remain to be fully elucidated. The present study performed of language. Several factors may cause deafness (3,4), including genetic analysis of a Chinese family, in which the child genetic mutations, noise exposure, illness, toxic chemicals and was deaf and the parents were healthy. Sanger sequencing aging. A substantial proportion of cases of deafness are caused demonstrated that the affected individual harbored three by genetic mutations (4-7). Genetic deafness can be divided heterogeneous mutations in the SLC26A4 and GJB3 genes, into two categories: Syndromic and nonsyndromic deafness. as follows: SLC26A4 IVS-2 A>G, SLC26A4 c.2168 A>G The clinical phenotypes of genetic deafness remain to be and GJB3 c.538 C>T. -
Abstracts from the 51St European Society of Human Genetics Conference: Electronic Posters
European Journal of Human Genetics (2019) 27:870–1041 https://doi.org/10.1038/s41431-019-0408-3 MEETING ABSTRACTS Abstracts from the 51st European Society of Human Genetics Conference: Electronic Posters © European Society of Human Genetics 2019 June 16–19, 2018, Fiera Milano Congressi, Milan Italy Sponsorship: Publication of this supplement was sponsored by the European Society of Human Genetics. All content was reviewed and approved by the ESHG Scientific Programme Committee, which held full responsibility for the abstract selections. Disclosure Information: In order to help readers form their own judgments of potential bias in published abstracts, authors are asked to declare any competing financial interests. Contributions of up to EUR 10 000.- (Ten thousand Euros, or equivalent value in kind) per year per company are considered "Modest". Contributions above EUR 10 000.- per year are considered "Significant". 1234567890();,: 1234567890();,: E-P01 Reproductive Genetics/Prenatal Genetics then compared this data to de novo cases where research based PO studies were completed (N=57) in NY. E-P01.01 Results: MFSIQ (66.4) for familial deletions was Parent of origin in familial 22q11.2 deletions impacts full statistically lower (p = .01) than for de novo deletions scale intelligence quotient scores (N=399, MFSIQ=76.2). MFSIQ for children with mater- nally inherited deletions (63.7) was statistically lower D. E. McGinn1,2, M. Unolt3,4, T. B. Crowley1, B. S. Emanuel1,5, (p = .03) than for paternally inherited deletions (72.0). As E. H. Zackai1,5, E. Moss1, B. Morrow6, B. Nowakowska7,J. compared with the NY cohort where the MFSIQ for Vermeesch8, A. -
Supp Figures & Tables.Pdf
SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. H226 cells express ΔNp63α and functional p53. (A) Western blot of total cell extracts from H226 cells as well as myc tagged p63 isoforms using a pan-p63 antibody and an antibody that specifically recognizes the α-isoforms of p63. (B) FACS analysis of cell cycle profile following staining with propidium iodide. H226 cells were treated with 10uM Nutlin-3, a non-genotoxic activator of p53, for 48 hours. (C) Sulforhodamine B (SRB) assay of cell proliferation following 5 days of knockdown of ΔNp63α and/or p53. (D) Cell cycle profile following 5 days of knockdown of ΔNp63α and/or p53. (E) Apoptotic index of cells following 5 days of knockdown of ΔNp63α. Treatment with 375 µM of the antimetabolite 5-fluorouracil (5FU) for 48 hours serves as a positive control. Cells were stained with annexin V and propidium iodide and analyzed by flow cytometry. Histograms represent the percentage of cells positive for annexin V staining. Supplemental Figure 2. ΔNp63α does not repress 14-3-3σ, GADD45A, NOXA or PUMA in H226 cells. Validation of microarray results by quantitative RT-PCR analysis of additional Class I genes following 12 hours of 10 µM Nutlin-3 treatment, 48 hours of ΔNp63α knockdown, or combination treatment. Supplemental Figure 3. Gene-specific repression by ΔNp63α in diverse cell types. Q-RT-PCR analysis of selected Class I, II, and III target genes following 48 hours of ΔNp63α knockdown in (A) HaCaT cells (immortalized keratinocytes), (B) SCC-13 cells (oral HNSCC), (C) Cal-27 (tongue HNSCC). Supplemental Figure 4. -
PRODUCT SPECIFICATION Anti-GJB5 Product
Anti-GJB5 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-GJB5 Product Number HPA038146 Gene Description gap junction protein, beta 5, 31.1kDa Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLL PDRPRDHVKK Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:200 - 1:500 - Retrieval method: HIER pH6 WB (Western Blot) - Working concentration: 0.04-0.4 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA038146 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.