DOCSLIB.ORG

Effects of Neuronal Nogo-A on Properties of Excitatory Synapses of the Sensorimotor Cortex

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Effects of Neuronal Nogo-A on Properties of Excitatory Synapses of the Sensorimotor Cortex Loyola University Chicago Loyola eCommons Dissertations Theses and Dissertations 2011 Effects of Neuronal Nogo-A on Properties of Excitatory Synapses of the Sensorimotor Cortex Alicia Marie Case Loyola University Chicago Follow this and additional works at: https://ecommons.luc.edu/luc_diss Part of the Neuroscience and Neurobiology Commons Recommended Citation Case, Alicia Marie, "Effects of Neuronal Nogo-A on Properties of Excitatory Synapses of the Sensorimotor Cortex" (2011). Dissertations. 192. https://ecommons.luc.edu/luc_diss/192 This Dissertation is brought to you for free and open access by the Theses and Dissertations at Loyola eCommons. It has been accepted for inclusion in Dissertations by an authorized administrator of Loyola eCommons. For more information, please contact [email protected]. This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 License. Copyright © 2011 Alicia Marie Case LOYOLA UNIVERSITY CHICAGO EFFECTS OF NEURONAL NOGO-A ON PROPERTIES OF EXCITATORY SYNAPSES OF THE SENSORIMOTOR CORTEX A DISSERTATION SUBMITTED TO THE FACULTY OF THE GRADUATE SCHOOL IN CANDIDACY FOR THE DEGREE OF DOCTOR OF PHILOSOPHY PROGRAM IN NEUROSCIENCE BY ALICIA M. CASE CHICAGO, ILLINOIS MAY 2011 Copyright by Alicia M. Case, 2011 All rights reserved ACKNOWLEDGEMENTS My thanks to the members of the Kartje lab, whose support has proved invaluable, especially Dr. Wendy Kartje, Melanie Bollnow, Becky Gillani, and Ian Vaagenes. I also owe a debt of gratitude to the neuroscience community at Hines and Loyola for moral backing, invigorating discussion, and scientific enthusiasm, particularly Cynthia Von Zee. Cynthia further aided this work with advice on qRT-PCR, as did Maggie Szymanska and Dr. Toni Pak. Thanks also to Dr. Ed Campbell, for generous use of his deconvolution microscope, and for patient instruction in the mechanics of this form of microscopy. I would be remiss without thanks to a network of support from the Neuroscience graduate students who began coursework with me, Maureen Petrunich-Rutherford, Michael Calik, and Sandra Rokosik. I would also like to thank my committee for their valuable guidance. Particular appreciation goes to Dr. Bill Wolf for his insightful scientific review and counsel on immunohistochemistry, Dr. Jody Martin for patient instruction on cloning, viral construction, and scientific writing, Dr. Evan Stubbs for recommendations on PCR and kind encouragement throughout the course of study, and Dr. E.J. Neafsey, an excellent instructor in the classroom and at the bench. iii Final thanks go to my family for their support and encouragement on this project, as with all things. iv For all the teachers who have inspired my love of science through the years, particularly Susan Osterlie, Susan Sarejko, Tom Bahl and James Doyle. I think, at a child's birth, if a mother could ask a fairy godmother to endow it with the most useful gift, that gift should be curiosity. -Eleanor Roosevelt TABLE OF CONTENTS ACKNOWLEDGEMENTS ...................................................................................... iii III LIST OF TABLES ..................................................................................................... x LIST OF FIGURES ................................................................................................. xi LIST OF ABBREVIATIONS ................................................................................. xiii ABSTRACT ........................................................................................................... xvii CHAPTER ONE: OVERVIEW AND HYPOTHESIS ................................................ 1 CHAPTER TWO: REVIEW OF THE LITERATURE .............................................. 5 Nogo-A ............................................................................................................... 5 Introduction .................................................................................................... 5 Axon Guidance ................................................................................................ 7 Nogo-A is a member of the Reticulon family .................................................. 8 Nogo-A Receptors ......................................................................................... 10 Nogo-A at the synapse .................................................................................... 13 Neocortical expression of Nogo-A ................................................................. 15 Dendritic spines ................................................................................................ 15 Postsynaptic molecules important for synaptic function ................................ 18 RNA Interference ...............................................................................................21 RNAi machinery ............................................................................................ 22 Synthetic RNAi as a tool for neuroscientists ................................................ 25 CHAPTER THREE: POSTNATAL KNOCKDOWN OF NEURONAL NOGO-A LEADS TO A DECREASE IN APICAL DENDRITIC SPINE DENSITY IN THE NEOCORTEX ............................................................................................. 29 Abstract ............................................................................................................ 29 Introduction ..................................................................................................... 30 Methods ........................................................................................................... 32 AAV production .............................................................................................. 32 Animals .......................................................................................................... 34 Verifying Nogo-A knockdown in vitro and in vivo ....................................... 35 Dendritic spine imaging via laser scanning confocal microscopy ................ 38 Statistical analysis ......................................................................................... 39 Results .............................................................................................................. 40 vii Recombinant virus, AAV-shNogo, mediated in vitro and in vivo Nogo-A gene knockdown ......................................................................................... 40 Neuronal Nogo-A knockdown in vivo results in reduced apical dendritic spine density and alterations in apical spine morphology ........................ 46 Reduced levels of postnatal, neuronal Nogo-A did not alter basilar spine density or morphology ............................................................................... 47 Discussion ........................................................................................................ 52 CHAPTER FOUR: POSTNATAL KNOCKDOWN OF NEURONAL NOGO-A LEADS TO A DECREASE IN MESSAGE LEVELS OF GENES IMPORTANT FOR SYNAPTIC PLASTICITY ..................................................... 57 Abstract ............................................................................................................ 57 Introduction ..................................................................................................... 58 Methods ........................................................................................................... 60 Quantitative RT-PCR (qRT-PCR) ................................................................. 60 Statistical analysis ......................................................................................... 62 Results .............................................................................................................. 65 AAV-shNogo leads to reduced levels of Nogo-A, with no changes to Nogo-B or Cofilin expression ..................................................................... 65 Postnatal loss of Nogo-A influences expression of genes important for synaptic plasticity ....................................................................................... 66 Discussion ........................................................................................................ 70 CHAPTER FIVE: POSTNATAL KNOCKDOWN OF NEURONAL NOGO-A LEADS TO A DECREASE IN THE APICAL COUNT OF AN EXCITATORY PRESYNAPTIC MARKER, VGLUT1, IN THE ADULT SENSORIMOTOR CORTEX ............................................................................................................. 75 Abstract ............................................................................................................ 75 Introduction ..................................................................................................... 76 Methods ........................................................................................................... 78 Immunohistochemical staining .................................................................... 78 Synaptic protein imaging via deconvolution microscopy ............................ 79 Statistical analyses ........................................................................................ 80 Results .............................................................................................................. 82 vGlut1 immunohistochemistry identifies potential presynaptic terminals . 82 AAV-shNogo leads to reduced number potential presynaptic connections onto apical dendrites .................................................................................. 82 Decreased postnatal
Load more

Recommended publications
  • Cellular and Molecular Signatures in the Disease Tissue of Early
    Cellular and Molecular Signatures in the Disease Tissue of Early Rheumatoid Arthritis Stratify Clinical Response to csDMARD-Therapy and Predict Radiographic Progression Frances Humby1,* Myles Lewis1,* Nandhini Ramamoorthi2, Jason Hackney3, Michael Barnes1, Michele Bombardieri1, Francesca Setiadi2, Stephen Kelly1, Fabiola Bene1, Maria di Cicco1, Sudeh Riahi1, Vidalba Rocher-Ros1, Nora Ng1, Ilias Lazorou1, Rebecca E. Hands1, Desiree van der Heijde4, Robert Landewé5, Annette van der Helm-van Mil4, Alberto Cauli6, Iain B. McInnes7, Christopher D. Buckley8, Ernest Choy9, Peter Taylor10, Michael J. Townsend2 & Costantino Pitzalis1 1Centre for Experimental Medicine and Rheumatology, William Harvey Research Institute, Barts and The London School of Medicine and Dentistry, Queen Mary University of London, Charterhouse Square, London EC1M 6BQ, UK. Departments of 2Biomarker Discovery OMNI, 3Bioinformatics and Computational Biology, Genentech Research and Early Development, South San Francisco, California 94080 USA 4Department of Rheumatology, Leiden University Medical Center, The Netherlands 5Department of Clinical Immunology & Rheumatology, Amsterdam Rheumatology & Immunology Center, Amsterdam, The Netherlands 6Rheumatology Unit, Department of Medical Sciences, Policlinico of the University of Cagliari, Cagliari, Italy 7Institute of Infection, Immunity and Inflammation, University of Glasgow, Glasgow G12 8TA, UK 8Rheumatology Research Group, Institute of Inflammation and Ageing (IIA), University of Birmingham, Birmingham B15 2WB, UK 9Institute of
    [Show full text]
  • Supplementary Materials
    Supplementary material. S1. Images from automatic imaging reader Cytation™ 1. A, A’, A’’ present the same field of view. Cells migrating from the upper compartment of the inserts are stained with DID (red color), Cell nuclei are stained with DAPI (blue color). A’ and A’’ demonstrate the method of analysis (A’ – nuclei numbering, A’’ – migrating cells numbering), scale bar – 300 µm. ASC BM-MSC Y BM-MSC A mean SEM mean SEM mean SEM CXCL6 2.240 0.727 4.158 0.677 2.149 1.816 CXCL16 4.277 0.248 0.763 0.405 1.130 0.346 CXCL12 -2.855 0.483 -4.528 0.226 -3.616 0.318 SMAD3 -0.511 0.191 -1.522 0.188 -1.332 0.215 TGFB2 3.742 0.533 1.238 0.210 0.990 0.568 COL14A 1.532 0.357 -0.397 0.736 -1.522 0.469 MHX 1.397 0.414 1.145 0.412 0.642 0.613 SCX 2.984 0.301 2.062 0.320 2.031 0.249 RUNX2 3.290 0.359 2.319 0.388 2.546 0.529 PPRAG 1.720 0.303 2.926 0.423 2.912 0.215 Supplementary material S3. The table provides the mean Δct and SEM values for all genes and all groups analyzed in this study (n=8 in each group). Supplementary material S2. The table provides the list of genes which displayed significantly different expression between hASCs and hBM-MSCs A based on microarray nr Exp p-value Exp Fold Change ID Symbol Entrez Gene Name 1 2.84E-05 16.896 16960355 TM4SF1 transmembrane 4 L six family member 1 2 9.10E-09 12.238 16684080 IFI6 interferon alpha inducible protein 6 3 3.93E-08 11.851 16667702 VCAM1 vascular cell adhesion molecule 1 4 1.54E-05 9.944 16840113 CXCL16 C-X-C motif chemokine ligand 16 5 2.01E-06 9.123 16852463 RAB27B RAB27B, member RAS oncogene
    [Show full text]
  • Identification of RNA Bound to the TDP-43 Ribonucleoprotein Complex in the Adult Mouse Brain
    Identification of RNA bound to the TDP-43 ribonucleoprotein complex in the adult mouse brain Running Title: Identification of RNA bound to TDP-43 Ramesh K. Narayanan1, Marie Mangelsdorf1, Ajay Panwar1, Tim J. Butler1, Peter G. Noakes1,2, Robyn H. Wallace1,3* 1Queensland Brain Institute, 2School of Biomedical Sciences, 3School of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane, QLD, 4072, Australia *Corresponding author: [email protected] Objectives. Cytoplasmic inclusions containing TDP-43 are a pathological hallmark of several neurodegenerative disorders, including amyotrophic lateral sclerosis (ALS) and frontotemporal dementia. TDP-43 is an RNA binding protein involved in gene regulation through control of RNA transcription, splicing and transport. However, the function of TDP-43 in the nervous system is largely unknown and its role in the pathogenesis of ALS is unclear. The aim of this study was to identify genes in the central nervous system that are regulated by TDP-43. Methods. RNA-immunoprecipitation with anti-TDP-43 antibody, followed by microarray analysis (RIP- chip), was used to isolate and identify RNA bound to TDP-43 protein from mouse brain. Results. This analysis produced a list of 1,839 potential TDP-43 gene targets, many of which overlap with previous studies and whose functions include RNA processing and synaptic function. Immunohistochemistry demonstrated that the TDP-43 protein could be found at the presynaptic membrane of axon terminals in the neuromuscular junction in mice. Conclusions. The finding that TDP-43 binds to RNA that codes for genes related to synaptic function, together with the localisation of TDP-43 protein at axon terminals, suggest a role for TDP-43 in the transport of synaptic mRNAs into distal processes.
    [Show full text]
  • Human Social Genomics in the Multi-Ethnic Study of Atherosclerosis
    Getting “Under the Skin”: Human Social Genomics in the Multi-Ethnic Study of Atherosclerosis by Kristen Monét Brown A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Epidemiological Science) in the University of Michigan 2017 Doctoral Committee: Professor Ana V. Diez-Roux, Co-Chair, Drexel University Professor Sharon R. Kardia, Co-Chair Professor Bhramar Mukherjee Assistant Professor Belinda Needham Assistant Professor Jennifer A. Smith © Kristen Monét Brown, 2017 [email protected] ORCID iD: 0000-0002-9955-0568 Dedication I dedicate this dissertation to my grandmother, Gertrude Delores Hampton. Nanny, no one wanted to see me become “Dr. Brown” more than you. I know that you are standing over the bannister of heaven smiling and beaming with pride. I love you more than my words could ever fully express. ii Acknowledgements First, I give honor to God, who is the head of my life. Truly, without Him, none of this would be possible. Countless times throughout this doctoral journey I have relied my favorite scripture, “And we know that all things work together for good, to them that love God, to them who are called according to His purpose (Romans 8:28).” Secondly, I acknowledge my parents, James and Marilyn Brown. From an early age, you two instilled in me the value of education and have been my biggest cheerleaders throughout my entire life. I thank you for your unconditional love, encouragement, sacrifices, and support. I would not be here today without you. I truly thank God that out of the all of the people in the world that He could have chosen to be my parents, that He chose the two of you.
    [Show full text]
  • Autism Gene Ube3a and Seizures Impair Sociability by Repressing VTA Cbln1
    Autism gene Ube3a and seizures impair sociability by repressing VTA Cbln1 The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters Citation Krishnan, V., D. C. Stoppel, Y. Nong, M. A. Johnson, M. J. Nadler, E. Ozkaynak, B. L. Teng, et al. 2017. “Autism gene Ube3a and seizures impair sociability by repressing VTA Cbln1.” Nature 543 (7646): 507-512. doi:10.1038/nature21678. http://dx.doi.org/10.1038/ nature21678. Published Version doi:10.1038/nature21678 Citable link http://nrs.harvard.edu/urn-3:HUL.InstRepos:34491817 Terms of Use This article was downloaded from Harvard University’s DASH repository, and is made available under the terms and conditions applicable to Other Posted Material, as set forth at http:// nrs.harvard.edu/urn-3:HUL.InstRepos:dash.current.terms-of- use#LAA HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Nature. Manuscript Author Author manuscript; Manuscript Author available in PMC 2017 September 15. Published in final edited form as: Nature. 2017 March 23; 543(7646): 507–512. doi:10.1038/nature21678. Autism gene Ube3a and seizures impair sociability by repressing VTA Cbln1 Vaishnav Krishnan*,1, David C. Stoppel*,1,2,7, Yi Nong*,1,2, Mark A. Johnson1,2, Monica J.S. Nadler1,2, Ekim Ozkaynak1,2, Brian L. Teng1,2, Ikue Nagakura1,2, Fahim Mohammad2, Michael A. Silva1,2, Sally Peterson1,2, Tristan J. Cruz1,2, Ekkehard M. Kasper3, Ramy Arnaout2,4,5, and Matthew P. Anderson‡,1,2,6,7 1Department of Neurology, Beth Israel Deaconess
    [Show full text]
  • SF3B1-Mutated Chronic Lymphocytic Leukemia Shows Evidence Of
    SF3B1-mutated chronic lymphocytic leukemia shows evidence of NOTCH1 pathway activation including CD20 downregulation by Federico Pozzo, Tamara Bittolo, Erika Tissino, Filippo Vit, Elena Vendramini, Luca Laurenti, Giovanni D'Arena, Jacopo Olivieri, Gabriele Pozzato, Francesco Zaja, Annalisa Chiarenza, Francesco Di Raimondo, Antonella Zucchetto, Riccardo Bomben, Francesca Maria Rossi, Giovanni Del Poeta, Michele Dal Bo, and Valter Gattei Haematologica 2020 [Epub ahead of print] Citation: Federico Pozzo, Tamara Bittolo, Erika Tissino, Filippo Vit, Elena Vendramini, Luca Laurenti, Giovanni D'Arena, Jacopo Olivieri, Gabriele Pozzato, Francesco Zaja, Annalisa Chiarenza, Francesco Di Raimondo, Antonella Zucchetto, Riccardo Bomben, Francesca Maria Rossi, Giovanni Del Poeta, Michele Dal Bo, and Valter Gattei SF3B1-mutated chronic lymphocytic leukemia shows evidence of NOTCH1 pathway activation including CD20 downregulation. Haematologica. 2020; 105:xxx doi:10.3324/haematol.2020.261891 Publisher's Disclaimer. E-publishing ahead of print is increasingly important for the rapid dissemination of science. Haematologica is, therefore, E-publishing PDF files of an early version of manuscripts that have completed a regular peer review and have been accepted for publication. E-publishing of this PDF file has been approved by the authors. After having E-published Ahead of Print, manuscripts will then undergo technical and English editing, typesetting, proof correction and be presented for the authors' final approval; the final version of the manuscript will
    [Show full text]
  • Novel Noncatalytic Substrate-Selective P38α-Specific
    Novel Noncatalytic Substrate-Selective p38α -Specific MAPK Inhibitors with Endothelial-Stabilizing and Anti-Inflammatory Activity This information is current as of September 26, 2021. Nirav G. Shah, Mohan E. Tulapurkar, Aparna Ramarathnam, Amanda Brophy, Ramon Martinez III, Kellie Hom, Theresa Hodges, Ramin Samadani, Ishwar S. Singh, Alexander D. MacKerell, Jr., Paul Shapiro and Jeffrey D. Hasday J Immunol 2017; 198:3296-3306; Prepublished online 15 Downloaded from March 2017; doi: 10.4049/jimmunol.1602059 http://www.jimmunol.org/content/198/8/3296 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2017/03/15/jimmunol.160205 Material 9.DCSupplemental References This article cites 61 articles, 17 of which you can access for free at: http://www.jimmunol.org/content/198/8/3296.full#ref-list-1 by guest on September 26, 2021 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2017 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Novel Noncatalytic Substrate-Selective p38a-Specific MAPK Inhibitors with Endothelial-Stabilizing and Anti-Inflammatory Activity Nirav G.
    [Show full text]
  • Supplementary Table S2. Cpuorfs Extracted from D
    Supplementary Table S2. CPuORFs extracted from D. melanogaster , D. rerio , G. gallus , and H. sapiens . K a/K s analysis K a/K s analysis before manual validation after manual validation Gene † uORF-mORF Previous Species Gene ID Gene description Median Median CPuORF amino acid sequence symbol fusion ratio U -test U -test report pairwise q value pairwise HG number p value p value K a/K s ratio K a/K s ratio D. melanogaster FBgn0024734 PRL-1 PRL-1 0.00 0.06 0.0E+00 0.0E+00 0.06 0.0E+00 Crowe MCMAIVLVRPVPTSMEFHLDSAEYCQAQHK* ENSDARG00000006242 ptp4a1 protein tyrosine phosphatase type IVA, member 1 0.04 0.10 0.0E+00 0.0E+00 0.10 0.0E+00 Crowe MIKLQSSMSKHIPFCGVLGHTFMEFLKGSGDYCQAQHGVYAEK* ENSDARG00000035676 ptp4a2b protein tyrosine phosphatase type IVA, member 2b 0.00 0.22 0.0E+00 0.0E+00 0.22 0.0E+00 Crowe MVGPFFCFRVDSDHTYMAFVTVCREFCQAQHLTFADK* D. rerio ENSDARG00000039997 ptp4a3 protein tyrosine phosphatase type IVA, member 3 0.00 0.07 0.0E+00 0.0E+00 0.07 0.0E+00 Crowe MAFLQRTGDYCHAQHLHI* ENSDARG00000054814 PTP4A3 protein tyrosine phosphatase 4A3b 0.00 0.08 0.0E+00 0.0E+00 0.08 0.0E+00 Crowe MEFWQGSGDYCHAQHHTA* HG0001 ENSDARG00000087443 ptp4a2a protein tyrosine phosphatase type IVA, member 2a 0.00 0.14 0.0E+00 0.0E+00 0.14 0.0E+00 Crowe MQSSQLVFCSLIEGCTFMAFVSVSGDFCQAQHLVIVDK* ENSGALG00000003265 PTP4A2 protein tyrosine phosphatase type IVA, member 2 0.00 0.24 0.0E+00 0.0E+00 0.24 0.0E+00 Crowe MPGVFCWNLRRTFMAILSVRAEFCQAQHSALADK* G. gallus ENSGALG00000016271 PTP4A1 protein tyrosine phosphatase type IVA, member 1 0.00 0.08 0.0E+00 0.0E+00 0.08 0.0E+00 Crowe MIRLQSSMSNHIPQFCGVLGHTFMEFLKGSGDYCQAQHDLYADK* ENSG00000112245 PTP4A1 protein tyrosine phosphatase type IVA, member 1 0.00 0.09 0.0E+00 0.0E+00 0.09 0.0E+00 Crowe MIRPQSSMSKHIPQFCGVLGHTFMEFLKGSGDYCQAQHDLYADK* H.
    [Show full text]
  • Supplemental Material
    Supplemental Material The Antitumoral Effect of the S- Adenosylhomocysteine Hydrolase Inhibitor, 3-Deazaneplanocin A, is Independent of EZH2 but is Correlated with EGFR Downregulation in Chondrosarcomas Juliette Aury-Landasa Nicolas Girarda Eva Lhuissiera Drifa Adouanea Raphael Delépéeb Karim Boumedienea Catherine Baugéa aBioConnecT EA7451, Normandie Université, UNICAEN, Caen, France, bPRISMM, SF4206 ICORE, Normandie Université, UNICAEN, Comprehensive Cancer Center F. Baclesse, Caen, France Legends of supplementary figures Suppl figure 1: Pretreatment with DZNep reduced CS implantation and growth in xenograft mice model CH2879 cells were treated with DZNep (1 µM) for 5 days before subcutaneous grafting in nude mice. (A) Tumors were measured regularly by a caliper and tumoral volume calculated. (B) 46 days after cell injection, tumors were weighted. Data are expressed as means + SEM. A total of ten mice were used (five pre-treated and five controls). Suppl figure 2: Expression of mRNA of identified genes in DZNep-treated CS and chondrocytes EGFR, MAD1L1 mRNA expression was analyzed by RT-PCR from chondrosarcomas and chondrocytes treated with 1 µM DZNep for 24 h. Data are expressed as means + SEM (N=3-5). *: p-value < 0.05. 1 A 700 B 600 ) pretreatment 3 500 500 * 400 400 * volume (mm volume 300 300 * Tumor 200 200 C 100 100 (mg) weight Tumor 0 0 DZNep 25 30 35 40 45 50 Control Pretreated Time after implantation (days) Suppl figure 1 A 1.6 1.4 EGFR 1.2 Control 1 * DZNep 0.8 * (relative unit) (relative 0.6 * level ** 0.4 mRNA 0.2 0 CH2879 SW1353 JJ012 FS090 HAC 1.41.4 MAD1L1 1.21.2 1 * 0.80.8 (relative unit) (relative 0.6 * level *** 0.40.4 *** mRNA 0.20.2 0 CH2879 SW1353 JJ012 FS090 HAC Suppl figure 2 Table S1: Clinical characteristics of primary chondrosarcomas.
    [Show full text]
  • Ncounter® Human Neuroinflammation Panel
    nCounter® Human Neuroinflammation Panel - Gene and Probe Details Official Symbol Accession Alias / Previous Symbol Official Full Name Other targets or Isoform Information ABCC3 NM_001144070.1 MRP3,cMOAT2,EST90757,MLP2,MOAT-D ATP binding cassette subfamily C member 3 ABCC8 NM_000352.3 HI,PHHI,SUR1,MRP8,ABC36,HHF1,TNDM2,SUR,HRINS ATP binding cassette subfamily C member 8 ABL1 NM_005157.3 JTK7,c-ABL,p150,ABL ABL proto-oncogene 1, non-receptor tyrosine kinase ADAMTS16 NM_139056.2 ADAMTS16s ADAM metallopeptidase with thrombospondin type 1 motif 16 ADRA2A NM_000681.2 ADRAR,ADRA2,ADRA2R adrenoceptor alpha 2A AGO4 NM_017629.3 hAGO4,KIAA1567,FLJ20033,EIF2C4 argonaute 4, RISC catalytic component AGT NM_000029.3 SERPINA8 angiotensinogen AK1 NM_000476.2 adenylate kinase 1 AKT1 NM_001014432.1 RAC,PKB,PRKBA,AKT AKT serine/threonine kinase 1 AKT2 NM_001626.4 AKT serine/threonine kinase 2 ALDH1L1 NM_012190.2 10-fTHF,FTHFD aldehyde dehydrogenase 1 family member L1 AMBRA1 NM_017749.2 FLJ20294,KIAA1736,WDR94,DCAF3 autophagy and beclin 1 regulator 1 AMIGO2 NM_001143668.1 ALI1,DEGA adhesion molecule with Ig like domain 2 ANAPC15 NM_001278486.1 HSPC020,DKFZP564M082,APC15,C11orf51 anaphase promoting complex subunit 15 ANXA1 NM_000700.1 ANX1,LPC1 annexin A1 APC NM_000038.3 DP2,DP3,DP2.5,PPP1R46 APC, WNT signaling pathway regulator APEX1 NM_001641.2 APE,REF1,HAP1,APX,APEN,REF-1,APE-1,APEX apurinic/apyrimidinic endodeoxyribonuclease 1 APOE NM_000041.2 AD2 apolipoprotein E ARC NM_015193.3 KIAA0278,Arg3.1 activity regulated cytoskeleton associated protein ARHGAP24
    [Show full text]
  • Geneid Dynabeads Basemean Log2foldchange Lfcse
    GeneID Dynabeads baseMean log2FoldChange lfcSE stat pvalue padj GeneName GeneDescription EntrezID neg.log10padj Regulation.Direction Expamers ENSG00000121807.5 893,8381542 4326,266888 2,509195823 0,06830113 36,73725212 1,86E-295 3,06E-291 CCR2 chemokine (C-C motif) receptor 2 729230 290,5148703 Upregulated 5184,374072 ENSG00000111796.3 171,8606164 2280,431839 3,813804551 0,106153054 35,92741254 1,14E-282 9,38E-279 KLRB1 killer cell lectin-like receptor subfamily B, member 1 3820 278,027831 Upregulated 2807,574645 ENSG00000115956.9 281,7229522 3514,849467 3,664044697 0,119183846 30,74279619 1,53E-207 8,37E-204 PLEK pleckstrin 5341 203,0773654 Upregulated 4323,131096 ENSG00000126822.16 636,59815 2533,943419 2,190856148 0,073869465 29,65848122 2,64E-193 1,08E-189 PLEKHG3 pleckstrin homology domain containing, family G (with RhoGef domain) member 3 26030 188,9649002 Upregulated 3008,279737 ENSG00000113088.5 408,0200475 2262,243984 2,631436561 0,089963665 29,24999289 4,49E-188 1,48E-184 GZMK granzyme K (granzyme 3; tryptase II) 3003 183,8304948 Upregulated 2725,799968 ENSG00000100450.12 192,8465176 3224,353267 3,90556013 0,133689072 29,2137574 1,30E-187 3,56E-184 GZMH granzyme H (cathepsin G-like 2, protein h-CCPX) 2999 183,4491206 Upregulated 3982,229954 ENSG00000150938.9 35,93199057 735,4794196 4,006341654 0,15907078 25,18590559 5,72E-140 1,34E-136 CRIM1 cysteine rich transmembrane BMP regulator 1 (chordin-like) 51232 135,8718591 Upregulated 910,3662768 ENSG00000172215.5 493,7070147 1913,700179 2,129504917 0,084771863 25,12042134 2,98E-139
    [Show full text]
  • Coordinated Activation of the RAC-GAP Β2-CHIMAERIN by an Atypical Proline-Rich Domain and Diacylglcercol Bruce J
    University of Connecticut OpenCommons@UConn UCHC Articles - Research University of Connecticut Health Center Research 1-2013 Coordinated Activation of the RAC-GAP β2-CHIMAERIN by an Atypical Proline-Rich Domain and Diacylglcercol Bruce J. Mayer University of Connecticut School of Medicine and Dentistry Follow this and additional works at: https://opencommons.uconn.edu/uchcres_articles Part of the Medicine and Health Sciences Commons Recommended Citation Mayer, Bruce J., "Coordinated Activation of the RAC-GAP β2-CHIMAERIN by an Atypical Proline-Rich Domain and Diacylglcercol" (2013). UCHC Articles - Research. 185. https://opencommons.uconn.edu/uchcres_articles/185 NIH Public Access Author Manuscript Nat Commun. Author manuscript; available in PMC 2013 July 03. NIH-PA Author ManuscriptPublished NIH-PA Author Manuscript in final edited NIH-PA Author Manuscript form as: Nat Commun. 2013 ; 4: 1849. doi:10.1038/ncomms2834. COORDINATED ACTIVATION OF THE RAC-GAP β2-CHIMAERIN BY AN ATYPICAL PROLINE-RICH DOMAIN AND DIACYLGLYCEROL Alvaro Gutierrez-Uzquiza1,*, Francheska Colon-Gonzalez1,*, Thomas A. Leonard2, Bertram J. Canagarajah2, HongBin Wang1, Bruce J. Mayer3, James H. Hurley2, and Marcelo G. Kazanietz1 1Department of Pharmacology, Perelman School of Medicine, University of Pennsylvania, Philadelphia, PA 19104-6160, USA 2Laboratory of Molecular Biology, National Institutes of Health, Bethesda, MD 20892, USA 3Department of Genetics and Developmental Biology, University of Connecticut Health Center, Farmington, CT 06030-6403, USA Abstract Chimaerins, a family of GTPase activating proteins (GAPs) for the small G-protein Rac, have been implicated in development, neuritogenesis, and cancer. These Rac-GAPs are regulated by the lipid second messenger diacylglycerol (DAG) generated by tyrosine-kinases such as the epidermal growth factor receptor (EGFR).
    [Show full text]