7KHUHDUHIUHTXHQWIOXFWXDWLRQVLQWKHFRVWRILQSXW6RZHPD\QRWEHDEOHWRJLYH SULRULQWLPDWLRQUHJDUGLQJFKDQJHVLQWKHSULFHVWUXFWXUH
3DFNLQJ)RUZDUGLQJ)UHLJKWDQG,QVXUDQFHZLOOEH&KDUJHG([WUD
6DOHV7D[DQG([FLVH'XW\ZLOOEHH[WUDDVSHU&HQWUDORU6WDWH*RYHUQPHQW5XOHV
(YHU\SRVVLEOHFDUHLVWDNHQLQSDFNLQJEXWLWLVGLIILFXOWWRXQGHUWDNHUHVSRQVLELOLW\RI ORVVEUHDNDJHRUGDPDJHGXULQJWUDQVLW
55DQGRXUELOOEHVHQWWKRXJK933RUDQ\VFKHGXOHGEDQN1HZFXVWRPHUVDUH UHTXHVWHGWRDGYDQFHRIWKHHVWLPDWHGYDOXH
:KLOH SODFLQJ WKH RUGHU SOHDVH JLYH FOHDU GHVSDWFK LQVWUXFWLRQV LQGLFDWLQJ & 6 71XPEHU 1DPH RI 5DLOZD\ 6WDWLRQ $OOSUREOHPVVKDOOEHVROYHGDPLFDEO\VXEMHFWWR$PEDOD-XULVGLFWLRQ 1RWH PPP rice List 2017-18 CATALOGUE CONTENTS Product Range Pages Interchangeable Standard Joints, Adapters, Stirrers, Condensers, 1 to 49 Laboratory Flasks, Columns, Separating Funnels, Assemblies, Glasswares Water Distillation, Essential Oil, Soxhlet Apparatus. Volumetric Burettes, Pipettes, Micro Pipettes, Measuring Cylinders & Glasswares Measuring Flasks,Culture Tubes,Centrifuge Tube & Test Tubes. 50 to 74 Sintered Sintered Crucibles, Funnels, Chromatography Columns & Glasswares Filter Assembly. 75 to 84 Gas Estimation Impinger, Gas Burettes, Tubes, Gas Wash Bottles, 85 to 90 Apparatus Oxygen Purity & Orsat Apparatus. Special Semi Micro Ware, Clinical Laboratory Apparatus, 91 to 97 Glasswares Electrodes & Milk Testing Apparatus. Supplementary Stopcocks, Rotaflow Screw Type Stopcocks, Teflon Key 98 to 123 Glasswares Stopcocks, Manometers, Weighing Bottles, S. G. Bottles, Reagent Bottles, Beakers, Tissue Grinders, Teflon Rotors, Teflon Ware, Funnels, Viscometers, Stalaganometers, Polarimeter Tubes, Dessicators,Jars,Dishes, Carbon Sulphur Glass Parts. Fused Silica Silica Crucibles & Silica Basins, Nickel Crucibles, 124 to 125 Laboratory Ware Porcelain Crucibles & Mortar and Pestle. Photochemical Photochemical Reactor & Photochemical Glass Reactor 126126126 Reactor Assembly. Laboratory & Capillary, Long Immersion, Precision, Standard Joint and 127 to 131 Industrial Soil Thermometers, Specific Gravity, Beaumes and Thermometers, Twaddle Hydrometers. Hydrometers Amber Colour Burettes, Pipettes, Measuring Flasks, Reagent Bottles, 132 to 136 Glasswares Petri Dishes & Flasks. I N D E X ●●● AAA ●●● CCC Absorption Bulb Midvale's ...... 115 Calcium Chloride Tube ...... 90-91 Absorption Pipette Orsat...... 88 to 90 Calcium Chloride Tower ...... 91 Acetylization Unit...... 119 Carbon Dioxide Apparatus ...... 87 Absorption Vessel Carbon Sulphur Apparatus 123 Carbon & Sulphur Glass Parts ...... 123 Acetyl Group Determination...... 40 Carbon Sulphur Burette ...... 123 Adapters for Liebig Condensers...... 115 Cassia Flask ...... 68 Adapters for Crucibles ...... 115 Cavett Blood Test Apparatus...... 40 Alkoxyl & Amino Group Centrifuge Tubes for Milk ...... 97 Determination ...... 40 Centrifuge Machines S.M...... 94 Amber Colour Glassware ...... 132 to 136 Centrifuge Tubes ...... 70 to 72 Aspirator Bottle...... 123 Chromatography Columns ...... 81 to 84 Arsenic Apparatus ...... 103 Chromatography Apparatus ...... 81 Assembly Simple Type...... 37 Clevenger Apparatus ...... 45 AutomaticAA Cut Off Device for Colourimetric Tubes ...... 85 Electrical Distillation ...... 42 Combustion Pipette Orsat ...... 88 to 90 Condensers Various ...... 16 to20 ●●● B Condensers with Standard Joints ...... 16 to19 Ball & Cup Joints ...... 2 Conductivity Cell Dip Type ...... 96 Beaker Graduated...... 110 Cone Double ...... 1 Beaker Semi - Micro ...... 91 Conical Flask ...... 92 Beaumes Hydrometer ...... 130 Conical Filters ...... 77 Beaker Teflon ...... 112-113 Conway Diffusion Unit ...... 104 Blood Sugar Tubes Folins ...... 95 Conical Flask Interchangeable Joint ...... 26-27 Brix Hydrometer ...... 131 Conical Flask Screw Neck ...... 26 Boiling Flask Micro ...... 92 Conical Flask Graduated ...... 110 Boiling Point Apparatus ...... 114 Crow Receiver ...... 63 - 64 Burette Automatic withww Teflon Stopcock ...... 55 Crucible S. M ...... 94 Burette Automatic AmberAA Colour ...... 132 Crucible Nickel...... 125 Bottles Reagent ...... 107-108 Crucible Sintered ...... 75 B.O.D. Bottles ...... 104 Crucible Silica ...... 124 Burettes Different Type ...... 50 to 55 Culture Tubes ...... 69 - 70 Burettes Automatic ...... 53 to 55 ●●● DDD Burettes for Orsat Apparatus...... 88 to 90 Digestion Tubes ...... 119 Burners Semi Micro ...... 93 Dilatometer ...... 118 Buchner Filters Sintered ...... 75 -76 Dewar Flask ...... 104 Bulb Condenser Spherical ...... 20 Dean & Stark Apparatus ...... 45 - 46 Butyrometer Tubes ...... 96 Dessicators Glass ...... 120 Digital Micro Pipette ...... 60 Distillation Assemblies Various ...... 37 to 40 I N D E X Dip Tube ...... 121 ●●● HHH Distillation Electrical Glass ...... 42- 43 Hoffman Bottle ...... 114 Distillation Electrical Quartz ...... 44 Hydrometers ...... 129 to131 ●●● III Dishes Silica ...... 124 Impingers ...... 85 Dishes...... 121 Insemination Pipette ...... 59 Dirt Correction Apparatus ...... 115 ●●● JJJ Droppers ...... 93 Jars Museum ...... 121 Drying Pistol ...... 40 Jolly's Air Bulb ...... 119 Dropping Bottle ...... 93,109 ●●● Dreyer's Agglutination Tube ...... 95 KKK Dumas Bulb ...... 115 Kahn's Test Tube...... 95 Durham Tubes...... 95 Kahn's Antigen Dilution Tube ...... 95 Kipps Apparatus ...... 91 ●●● EEE Kjeldahl Absorption Trap ...... 48 Erlenmeyer Flask Interchangeable Joint ...... 26 Kjeldahl Digestion Tube ...... 119 Electrodes Various Type...... 96 Kjeldahl Flask Micro ...... 92 Evaporating Dish ...... 121 Kjeldahl Flask with Standard Joint ...... 25-26 Essential Oil Determination Apparatus...... 45 Kjeldahl Bulb ...... 119 E. S. R. Tube ...... 95 Kohlrauch Flask ...... 68 Expansion Adapters ...... 2 Kozelka & Hine A pparatus ...... 40 ●●● FFF ●●● LLL Filter Apparatus Sinterted Glass ...... 79 Lactometer ...... 97 Filter Holder Assembly...... 79-80 Le Chatelier Flask ...... 68 Filter Pump...... 115 Levelling Bottles for Orsat ...... 88,90 Filter Pump Edward Type Brass ...... 116 Leighton Tube ...... 70 Filter Tubes Semi - Micro ...... 93 Liebig Condenser for Polenske Apparatus...... 97 Filter Tubes ...... 116 Lids for Reaction Flask ...... 27 Filter Apparatus Witts ...... 79 ●●● MMM ●●● GGG Gas Absorption Pipette Semi Micro ...... 93 Manifold Orsat Apparatus ...... 88 to 90 Gas Sampling Tube ...... 85- 86 Manometers ...... 105 Gas Measuring Burettes ...... 85 Maximum & Minimum Thermometer ...... 128 Gas Estimation Apparatus ...... 85 to 91 Measuring Cylinders...... 61 to 63 Gas Distribution Tube Sintered ...... 78 Mercury Diffusion Pump ...... 105 Gas Jar...... 87 Measuring Flask ...... 65 to 68 Gas Washing Bottle ...... 86 Measuring Flask Screw Neck ...... 65,67 Glass Beads ...... 30 Melting Point Tubes ...... 117 Gooch Crucible Sintered ...... 75 Micro Pipette ...... 60 Milk Testing Apparatus ...... 96-97 Milk Pipette ...... 96 I N D E X Miscellaneous Fitting Adapters...... 9 to12 ●●● R Micro Kjeldahl Apparatus Markham ...... 47 R.B./F.B. Boiling Flasks ...... 110-111 Micro Kjeldahl Appatatus Pregl's ...... 47 Rasching Ring ...... 30 Moisture Determination Apparatus ...... 45- 46 Reagent Bottles ...... 107-108, 135-136 Molecular Weight Apparatus McCoy's...... 114 Reagent Bottle Wide Mouth ...... 108 Molecular Weight Apparatus Land Berger's..... 114 Retort Stoppered ...... 119 Murphy Drip ...... 95 Reichert Wollny's Apparatus...... 97 Multiple Adapters ...... 3 - 4 Reduction Adaptors ...... 2 ●●● N Receiver Adaptors ...... 5 - 6 Nessler Cylinder ...... 64 Rotors Teflon Coated ...... 112 Nitrogen Distillation Apparatus ...... 47-48 Rotaflow Stopcocks ...... 101-102 Nickel Crucible...... 125 ●●● SSS ●●● O Saponification Flask ...... 68 Orsat Gas Analysis Apparatus ...... 88 to 90 Saybolt Viscosity Flask ...... 68 Orsat Gas Analysis Apparatus with Teflon Stopcock ...... 89-90 Semi-Micro Kjeldahl Apparatus ...... 48 Semi-Micro Analysis Apparatus ...... 91 to 94 Oxygen Determination Apparatus...... 87 ●●● P Separating Funnels ...... 31 to 36 Separating Funnels Globe Shape ...... 32 Palladium / Platinum Asbestose Tube ...... 88 to 90 Semi-micro Flask with Standard Joint...... 28-29 Particle Size Determination Apparatus ...... 114 Sintered Crucible ...... 75 Pasteur Pipette ...... 59 Sikes Hydrometer ...... 131 Petri Dish Amber Colour ...... 135 Silica Crucibles & Dishes ...... 124 Petri Dish ...... 109 Sockets Double ...... 1 Photo chemical Reactor Assembly ...... 126 Soxhlet Fat Extraction Apparatus ...... 49 Photochemical Reactor (Srinivasan Griffin Rayonet Soxhlet Apparatus Flask Type ...... 49 Type) ...... 126 Soil Thermometer ...... 128 Pipette Sterlising Box ...... 60 Soil Moisture Gauge ...... 46 Pipettes Various ...... 57 to 60 Specific Gravity Bottles ...... 106-107 Pipette for Milk ...... 96 Specific Gravity with Thermometer ...... 107 Platinum Wire S. M...... 94 Splash Heads ...... 7 to 9 Polenske Apparatus ...... 97 Sprayer...... 120 Spot Plate S. M...... 94 Polarimeter Tubes ...... 118 Spatula S. M...... 93 Powder Funnel...... 116 Stalaganometers ...... 117 Pressure Test Tube ...... 74 Stopcocks ...... 98 to 103 Pyknometer ...... 118 Stopcocks for Carbon Sulphur Apparatus ...... 123 ●●● QQQ Stopcock Teflon Plug...... 102 - 103 Quartz Distillation ...... 44 Stopcock Vacuum...... 99 to 101 Standard Joint Glass ...... 1 - 2 I N D E X Still Heads ...... 7 to 9, 97 Utility Sets ...... 41 Stirrers Rod Glass Bladed ...... 13 Stoppers Standard ...... 12 ●●● VVV Stoppers for Pressure Tube ...... 74 Vacuum Distillation Apparatus...... 40 Stoppers Standard Teflon ...... 111-112 Vacuum Drying Pistol ...... 40 Steam Distillation Apparatus ...... 37 Vacuum Dessicators...... 120 Stirrer Gland & Guide ...... 14 Viscometer ...... 117 Stuffing Box Teflon ...... 15 Victor Meyer Apparatus ...... 114 Sugar Estimation Flasks ...... 67 Vidal Tube ...... 95 ●●● TTT ●●● WWW Teflon Cone For Holding Thermometer ...... 113 Wall Thermometer ...... 128 Teflon Mercury Seal ...... 113 Washing Flasks ...... 119 Teflon W.M. Bottles ...... 113 Water Still Glass ...... 43 Teflon Bladed Stirrers ...... 13 Wash Bottle Semi- Micro ...... 93 Teflon Beaker ...... 112-113 Wasserman Tubes...... 95 Teflon Pestle Tissue Grinders ...... 111 Watch Glass ...... 93 Teflon Laboratory Apparatus...... 111 to113 Water Distillation Quartz...... 44 Test Tubes Stoppered Graduated ...... 73 Weighing Bottles ...... 106 Test Tubes Interchangeable Stopper ...... 73 Wet & Dry Thermometer ...... 128 Test Tubes Standard Socket...... 12 Wintrobe Tube...... 95 Test Tubes Plain ...... 73 Wooden Stand S. M...... 94 Test Tubes Graduated ...... 74 Woulf Bottles...... 109 T & Y Tubes ...... 117 Test Tube Brush S. M...... 94 Thiele's Melting Point Tubes ...... 117 Thistle Funnel ...... 116 Thermometer Pocket ...... 7 Thermometer Various ...... 127 to 129 Thermometer Precision ...... 127 Thermometer with Standard Cone...... 127 Thermometer Oven/Incubator ...... 128 Thumberg Tubes ...... 95 Tissue Culture Tubes Leighton ...... 70 Tissue Grinders Teflon Pestle ...... 111 Tilt Measures ...... 97 Tower Distillation Apparatus ...... 40 Twaddle Hydrometer ...... 131 ●●● UUU STANDARD JOINTS Interchangeable Lab Glasswares 'PERFIT' Interchangeable Joints 111 Cone sss and Socket sss RPERFITS Single Catalogue Joint Price/Piece No.No.No. Size Rs. P. 1/01 B 5 90-00 1/02 B 7 90-00 1/03 B 10 90-00 1 1/04 B 12 90-00 1/05 B 14 90-00 1/06 B 19 110-00 1/07 B 24 140-00 1/08 B 29 180-00 1/09 B 34 220-00 1/10 B 40 320-00 1/11 B 45 385-00 1/12 B 50 450-00 1/13 B 55 600-00 1/14 B 60 750-00 (Note : Sockets /Cones with Hooks or Cones with Drip ends ,,, 15% Extra) 1A1A1A Clip to hold cone & socket for B-24 joint. 50-00 1 222 Sockets, Double RPERFITS Catalogue Socket Shank Length Price/Piece No.No.No. Size mm. Rs. P. 2/01 B 7 80 60-00 2/02 B 10 80 60-00 2/03 B 14 80 65-00 2/04 B 19 80 75-00 2/05 B 24 80 90-00 2/06 B 29 80 110-00 2/07 B 34 100 155-00 2 2/08 B 40 110 250-00 333 Cones, Plain End, Double RPERFITS Catalogue Socket Shank Length Price/Piece No.No.No. Size mm. Rs. P. 3/01 B 7 80 60-00 3/02 B 10 80 60-00 3/03 B 14 80 65-00 3/04 B 19 80 75-00 3/05 B 24 80 90-00 3/06 B 29 80 110-00 3/07 B 34 100 155-00 3 3/08 B 40 110 250-00 (Cones with Drip ends,15% Extra) 1 STANDARD ADAPTERS 444 Spherical Joints, Ball and Cup Spherical Joints, Ball and Cup 'PERFIT' Catalogue Joint Price/Piece Clip Price No.No.No. SizeSizeSize Rs. P. Rs. P. 4/01 S 13 205-00 125-00 4/02 S 19 225-00 160-00 4/03 S 29 325-00 180-00 4/04 S 35 425-00 200-00 4/05 S 41 1075-00 425-00 QPERFITR AD AD AD APTERS 555 Reduction Adapters RPERFITS Catalogue Socket Cone Price/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P. 4 5/01 B 10 B 14 70-00 5/02 B 14 B 19 70-00 5/03 B 14 B 24 75-00 5/04 B 14 B 29 90-00 5/05 B 19 B 24 80-00 5/07 B 19 B 29 90-00 5/08 B 19 B 34 102-00 5/09 B 19 B 40 135-00 5/10 B 19 B 45 165-00 5/11 B 19 B 55 315-00 5/12 B 24 B 29 95-00 5/13 B 24 B 34 110-00 5/14 B 24 B 40 135-00 5/15 B 24 B 45 165-00 5/16 B 24 B 50 200-00 5/17 B 24 B 55 315-00 5/19 B 29 B 34 125-00 5/20 B 29 B 40 155-00 5/21 B 29 B 45 165-00 5 5/22 B 34 B 40 170-00 5/23 B 34 B 45 180-00 5/25 B 34 B 50 250-00 5/26 B 34 B 55 260-00 5/27 B 40 B 55 335-00 5/28 B 34 B 60 450-00 666 Expansion Adapters RPERFITS Catalogue Socket Cone Price/Piece No.No.No. SizeSizeSize Size Rs. P. 6/01 B 14 B 10 75-00 6/02 B 19 B 14 80-00 6/03 B 24 B 14 90-00 6/04 B 24 B 19 90-00 6 6/05 B 29 B 14 105-00 6/06 B 29 B 19 110-00 2 6/08 B 29 B 24 125-00 STANDARD ADAPTERS Catalogue Socket Cone Price/Piece No. Size Size Rs. P. 6/09 B 34 B 19 130-00 6/10 B 34 B 24 130-00 6/11 B 34 B 29 145-00 6/12 B 40 B 29 155-00 6/13 B 40 B 19 135-00 6/14 B 45 B 19 165-00 6/15 B 50 B 19 200-00 6/16 B 55 B 19 315-00 6/17 B 40 B 24 190-00 6/19 B 45 B 24 165-00 6/20 B 50 B 24 200-00 6/21 B 55 B 24 315-00 6/22 B 45 B 29 165-00 6/23 B 50 B 29 230-00 6/24 B 55 B 29 250-00 6/25 B 40 B 34 175-00 6/26 B 45 B 34 185-00 6/27 B 50 B 34 250-00 6/29 B 55 B 34 275-00 6/30 B 55 B 40 350-00 777 Multiple Adapters RPERFITS www ith ith ith TTT wo wo wo NNN ecks PPP arallel. Catalogue Cone Socket Price/Piece No. Size Size Rs. P. 7/01 B 10 B 10 140-00 7/02 B 14 B 14 165-00 7/03 B 19 B 19 180-00 7/04 B 24 B 19 195-00 230-00 7/05 B 24 B 24 230-00 7 7/06 B 34 B 19 250-00 7/08 B 34 B 24 280-00 7/09 B 55 B 19 425-00 7/10 B 29 B 29 280-00 7/11 B 34 B 24 & B 34 295-00 888 Multiple Adapters RPERFITS with Two Necks at 45 0 0 0 angle. Catalogue Cone Socket Price/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P. 8/01 B 19 B 19 180-00 8/02 B 24 B 19 190-00 8/03 B 34 B 19 250-00 999 Multiple Adapters RPERFITS with Three Necks, Two Parallel and One at 454545 0 0 0 angle. 8 Catalogue Parallel Neck Angled Cone Price/Piece No.No.No. Socket Size Neck SizeSizeSize Rs. P. 9/01 B 14 B 14 B 19 222 45-00 9/02 B 19 B 14 B 24 245-00 3 STANDARD ADAPTERS Catalogue Parallel Neck Angled Cone Price/Piece No.No.No. Socket Size Neck SizeSizeSize Rs. P. 9/03 B 19 B 19 B 24 265-00 9/04 B 19 B 19 B 29 305-00 9/06 B 19 B 19 B 34 315-00 9/07 B 19 B 19 B 55 520-00 9/08 B 24 B 24 B 34 325-00 9/10 B 24 B 24 B 24 275-00 9 101010 Multiple Adapters, Swan Neck RPERFITS Catalogue Cone Socket Price/Piece No.No.No. SizeSizeSize Size Rs. P. 10/01 B 14 B 14 125-00 10/02 B 19 B 19 140-00 10/03 B 24 B 19 140-00 10/04 B 19 B 24 140-00 10/05 B 24 B 24 150-00 10/06 B 34 B 24 165-00 10 111111 Conical/Spherical Adapters (Socket to Ball) RPERFITS Catalogue Socket Ball Price/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P. 11/0111 B 14 S 29 375-00 11/02 B 19 S 29 375-00 11/04 B 24 S 35 490-00 11 121212 Conical/Spherical Adapters (Cone to Cup) RPERFITS Catalogue Socket CupCupCup Price/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P. 12/01 B 14 S 29 375-00 12/02 B 19 S 29 375-00 12/04 B 24 S 35 490-00 12 4 STANDARD ADAPTERS QPERFITR R eceiver Adapters 131313 Plains Bend Short/Long RPERFITS Catalogue Socket PPP rice/Piece No.No.No. SSS izeizeize Rs. P ... 13/0111 B 14 75-00 13/02 B 19 85-00 13/03 B 24 105-00 13/04 B 29 110-00 13/05 B 34 135-00 13/07 B 40 205-00 13/08 B 45 260-00 13 13/09 B 50 325-00 13/10 B 55 340-0 000 141414 Plain Bend RPERFITS Catalogue Cone Socket PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 14/01 B 19 B 19 135-00 14/02 B 24 B 19 140-00 14/03 B 24 B 24 165-00 165-00 14 14/05 B 34 B 34 240-00 151515 Straig ht Deliver y Adapters RPERFITS Catalogue Socket PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 15/01 B 14 75-00 15/02 B 19 85-00 15/03 B 24 105-00 15/04 B 29 110-00 15/05 B 34 135-00 151515 161616 Bend with V ent RPERFITS Catalogue Cone Socket PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 16/01 B 10 B 10 105-00 16/02 B 14 B 14 125-00 16/03 B 19 B 19 140-00 16 16/05 B 24 B 19 145-00 16/06 B 24 B 24 165-00 16/07 B 29 B 29 190-00 16/09 B 34 B 34 250-00 5 STANDARD ADAPTERS 171717 Bend with V acuum Connection RPERFITS Catalogue Cone Socket PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 17/01 B 14 B 14 160-00 17/02 B 19 B 19 170-00 17/03 B 24 B 19 175-00 17/05 B 24 B 24 200-00 17/06 B 29 B 29 240-00 17/07 B 24 B 34 235-00 17 17/09 B 34 B 34 270-00 181818 Straight V acuum Connection RPERFITS Catalogue Cone Socket PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 18/01 B 19 B 19 170-00 18/02 B 24 B 19 175-00 18 18/03 B 24 B 24 200-00 18/04 B 34 B 34 270-00 191919 Bend with Socket ConnectionsBend with Socket Connections RPERFITS Catalogue Cone Socket PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 19/01 B 14 B 14 165-00 19/02 B 19 B 19 185-00 19 19/03 B 24 B 19 190-00 202020 Bend with Multiple Connections (Pig) RPERFITS Catalogue Cone Socket PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 20/01 B 10 B 10 310-00 20/02 B 14 B 14 330-00 20 20/03 B 14 B 19 345-00 20/04 B 19 B 19 365-00 212121 PPP erkin Intermediate R eceiver RPERFITS Catalogue Cone Socket Minimum PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Cap. Rs. P ... 21/01 B 14 B 14 10 ml. 875-00 21/02 B 19 B 19 32 ml. 880-00 21/03 B 24 B 19 32 ml. 895-00 21/04 B 24 B 24 32 ml. 925-00 21 21/06 B 24 B 34 --- 1075-00 21/08 B 34 B 34 --- 1325-00 222222 VVV acuum R eceiver Adapterseceiver Adapters RPERFITS to to to take 3x100ml. flasks. Catalogue Socket Cone PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 6 22 22/01 B 19 B 19 375-00 STANDARD ADAPTERS RPERFITS Still Heads / Splash Heads 252525 RRR ecover y Bend Sloping (Elbow) RPERFITS Catalogue Size of Cone Fitting Size of Cone Fitting PPP rice/Piece No.No.No. Flask or Column Condenser Rs. P ... 25/01 B 14 B 14 110-00 25/02 B 24 B 14 155-00 25/03 B 19 B 19 135-00 25/04 B 24 B 19 160-00 25 25/05 B 29 B 19 175-00 25/06 B 34 B 19 215-00 25/07 B 24 B 24 155-00 25/09 B 34 B 24 215215215 -00-00-00 25/10 B 34 B 34 250-00 25/11 B 55 B 24 385-00 25/13 B 29 B 29 185-00 25/14 B 55 B 55 550-00 25/15 B 55 B 34 425-00 262626 RRR ecover y Bend, V ertical RPERFITS Catalogue Size of Cone Fitting Size of Cone Fitting PPP rice/Piece No.No.No. Flask or Column Condenser Rs. P ... 26/01 B 14 B 14 145-00 26/02 B 19 B 19 165-00 26/03 B 24 B 19 205-00 26/05 B 24 B 24 220-00 26/06 B 34 B 34 325-00 272727 Thermometer P P P ocket RPERFITS Catalogue Cone PPP rice/Piece 27 No.No.No. SizeSizeSize Rs. P ... 27/01 B 14 85-00 27/02 B 19 100-00 27/03 B 24 105-00 27A27A27A Thermometer P ocket RPERFITS Long type, sealing to length required. Catalogue Cone PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 27A/04 B 14 90-00 27A/05 B 19 105-00 27A/06 B 24 120-00 27A/07 B 34 175-00 27A 7 STANDARD ADAPTERS 282828 Plain Still Head with Thermometer Socket RPERFITS Catalogue Cone Cone Socket PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize SizeSizeSize Rs. P ... 28/01 B 10 B 10 B 10 155-00 28/02 B 14 B 14 B 14 165-00 28/03 B 19 B 19 B 14 190-00 28 28/04 B 24 B 19 B 14 200-00 28/05 B 29 B 19 B 14 225-00 28/06 B 34 B 19 B 14 250-00 28/08 B 24 B 24 B 14 225-00 28/09 B 34 B 24 B 14 360-00 28/10 B 55 B 24 B 14 415-00 28/11 B 29 B 29 B 14 250-00 28/13 B 34 B 34 B 14 390-00 28/14 B 24 B 24 B 24 240-00 28/15 B 55 B 34 B 34 425-00 28/16 B 55 B 34 B 24 425-00 292929 Air Leak T ube RPERFITS Catalogue Cone PPP rice/Piece 29 No.No.No. SizeSizeSize Rs. P ... 29/01 B 10 85-00 29/02 B 14 90-00 29/03 B 19 95-00 29/04 B 24 100-00 29/05 B 34 130-00 303030 Claisen Head, Sloping RPERFITS with 2 x B 14 Sockets. Catalogue Cone Cone PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 30/01 B 14 B 14 245-00 30/02 B 19 B 19 275-00 30/03 B 24 B 19 275-00 30 30/04 B 34 B 19 335-00 8 30/05 B 24 B 24 310-00 30/06 B 34 B 24 350-00 30/08 B 29 B 29 330-00 313131 Splash Head, P ear Shape, Sloping RPERFITS Catalogue Size of Cone Fitting Size of Cone Fitting PPP rice/Piece No.No.No. Flask or Column Condenser Rs. P ... 31/01 B 19 B 19 225-00 31 31/02 B 24 B 19 235-00 8 STANDARD ADAPTERS Catalogue Size of Cone Fitting Size of Cone Fitting PPP rice/Piece No.No.No. Flask or Column Condenser Rs. P ... 31/03 B 34 B 19 255-00 31/04 B 34 B 24 265-00 31/05 B 24 B 24 240-00 31/06 B 29 B 29 265-00 31/08 B 34 B 34 275-00 323232 Splash Head, P ear Shape, V ertical RPERFITS Catalogue Size of Cone Fitting Size of Cone Fitting PP rice/Piece Catalogue Size of Cone Fitting Size of Cone Fitting PPP rice/Piece 32 No.No.No. Flask or Column Condenser Rs. P ... 32/01 B 19 B 19 295-00 32/02 B 24 B 19 300-00 32/03 B 34 B 19 325-00 32/04 B 24 B 24 315-00 32/06 B 34 B 24 350-00 333333 Steam Dist illation Head, P ear Shape, Sloping RPERFITS Catalogue Cone Cone PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 33/01 B 24 B 19 345-00 33/02 B 34 B 19 355-00 33/03 B 34 B 24 365-00 353535 Splash Head Adapter RPERFITS 33 Catalogue Socket Cone PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 35/01 B 19 B 24 235-00 RPERFITS Miscellaneous Fittings 35 363636 Adapters ,,, Cone to R ubber T ubing ,,, Right Angle Connection RPERFITS Catalogue Cone PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 36/01 B 10 65-00 36/02 B 14 65-00 36/03 B 19 75-00 36/04 B 24 80-00 36 36/05 B 29 95-00 36/07 B 34 125-00 9 STANDARD ADAPTERS 373737 Adapters, Cone to R ubber T ubing, Straight Connection RPERFITS Catalogue Cone PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 37/01 B 10 65-00 37/02 B 14 65-00 37/03 B 19 75-00 37/04 B 24 80-00 37/05 B 29 95-00 37/06 B 34 125-00 37 383838 Adapters with Stopcock ,,, Right Angle or Straight Connection RPERFITS Catalogue Cone PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 38/01 B 14 195-00 38/02 B 19 200-00 38/03 B 24 205-00 38/04 B 29 215-00 38/05 B 34 275-00 38 393939 AdAdAd apters, Socket to R ubber T ubing Right Angle or Straight Connection RPERFITS Catalogue Socket PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 38 39/01 B 14 65-00 39/02 B 19 75-00 39/04 B 24 80-00 39/06 B 29 95-00 39/07 B 34 125-00 404040 Adapt ers Socket to R ubber T ubing, Right Angle or Straight Connection RPERFITS with Stopcock. 39 Catalogue Socket PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 40/01 B 14 200-00 40/02 B 19 205-00 40/03 B 24 210-00 40/04 B 29 220-00 40/05 B 34 275-00 414141 Adapters, Socket/Cone RPERFITS with Stopcock. 40 Catalogue Socket Cone PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 41/01 B 19 B 24 425-00 41/02 B 24 B 24 450-00 41/03 B 34 B 24 525-00 10 STANDARD ADAPTERS 424242 VVV acuum Control Stopcock RPERFITS Catalogue Cone PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 42/02 B 19 375-00 434343 VVV acuum R elease Stopcock RPERFITS Catalogue Cone PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 42 43/02 B 19 375-00 444444 AdAdAd apter s, s, s, Cone with StemStemStem ,,, RR R ubber TT T ubing Right Angle Connection RPERFITS Catalogue Cone PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 43 44/01 B 14 100-00 44/02 B 19 110110110 --- 000000 44/03 B 24 115-00 44/04 B 34 145-00 454545 Adapter s,s,s, Socket to Cone with T ee Connection RPERFITS Catalogue Socket Cone PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize Rs. P ... 45/01 B 10 B 10 85-00 44 45/02 B 14 B 14 90-00 45/03 B 14 B 19 95-00 45/04 B 14 B 24 100-00 45/05 B 19 B 19 105-00 45/07 B 19 B 24 110-00 45/08 B 19 B 29 145-00 45/09 B 19 B 34 150-00 45/10 B 24 B 24 125-00 45/12 B 24 B 29 155-00 45/13 B 29 B 29 165-00 45/14 B 34 B 34 180-00 464646 DrDrDr ying T ube RPERFITS Catalogue Cone PPP rice/Piece 45 No.No.No. SizeSizeSize Rs. P ... 46/01 B 10 85-00 46/02 B 14 90-00 46/03 B 19 105-00 46 46/05 B 24 115-00 46/06 B 29 145-00 11 46/07 B 34 175-00 STANDARD ADAPTERS 484848 TTT est T ube with Socket RPERFITS without Stopper ... Catalogue Socket Dia. Overall Length Approx. Cap. PPP rice/Piece No.No.No. SizeSizeSize mm. mm. ml.ml.ml. Rs. P ... 48/01 B 10 12 65 2 42-00 48/02 B 10 12 100 5 45-00 48/03 B 10 15 125 10 54-00 48/05 B 14 18 100 12 56-00 48/07 B 14 18 125 15 58-00 48/08 B 14 18 150 20 60-00 48/10 B 19 25 100 22 70-00 48/11 B 19 25 150 25 75-00 48/13 B 19 25 200 50 95-00 48 14 B 24 32 200 100 130-00 48/15 B 24 38 200 150 175-00 48 494949 Stoppers, Hollow RPERFITS Catalogue Shape Cone PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 49/01 Hexagonal B 7 20-00 49/02 Hexagonal B 10 19-00 49/03 Hexagonal B 12 19-00 49/04 Hexagonal B 14 20-00 49/05 Hexagonal B 19 25-00 49/06 Hexagonal B 24 35-00 49/07 Hexagonal B 29 60-00 49 49/09 Hexagonal B 34 85-00 49/10 Penny Head B 40 165-00 49/11 Penny Head B 45 210-00 49/13 Penny Head B 50 240-00 49/14 Penny Head B 55 255-00 49A49A49A Stopp ersersers ,,, Solid ,,, P P P enny Or Flat Head RPERFITS Catalogue Cone PPP rice/Piece No.No.No. SizeSizeSize Rs. P ... 49A/16 B 10 32-00 49A/17 B 14 37-00 49A/18 B 19 46-00 49A/19 B 24 80-00 49A/20 B 34 210-00 49A/21 B 29 125-00 12 STIRRERS RPERFITS Stirrers 505050 Stirrers RPERFITS Catalogue TTT ypeypeype Shaft Dia. Shaft Length PPP rice/Piece No.No.No. mm. mm. Rs. P ... 50/01 Collapsible Link 6 450 155-00 50/02 Collapsible Link 6 600 170-00 50/03 Collapsible Link 8 450 185-00 50/04 Collapsible Link 8 600 195-00 50A50A50A Glass Stirring R ods RPERFITS OOO .D. X Length PPP rice/Piece mm. Rs. P ... OO O OO 50A/01 7 x 150 14-00 50A/02 7 x 200 19-00 50A/03 7 x 250 23-00 50A/04 7 x 300 28-00 50A/05 9 x 150 23-00 50A/06 9 x 200 28-00 50A/07 9 x 250 36-00 50A/08 9 x 300 38-00 515151 TTT eflon (P(P(P .T.T.T .F.F.F .E.) Bladed Stirrers RPERFITS The teflon blades may be removed from and are mutually interchangeable with th glass shafts factor which simplify assembly and cleaning and reduce breakages. They are designed to sweep close to vessel walls & will not cause scratching. Catalogue Shaft DDD ia.ia.ia. Shaft Smallest Socket Blade PPP rice/Piece No.No.No. mm. Length through which WWW idthidthidth Rs. P ... mm. stirrer will pass mm. 51/01 6 450 B 19 52 325-00 51/02 8 450 B 19 52 340-00 51/03 6 450 B 24 76 425-00 51/04 8 450 B 24 76 440-00 51/05 8 600 B 24 76 465-00 51/06 10 450 B 24 76 475-00 51 51/07 8 450 B 29 100 540-00 51/09 8 600 B 29 100 565-00 51/10 10 600 B 34 100 610-00 51/11 10 600 B 34 125 735-00 51/12 10 600 B 50 150 935-00 51A51A51A Shaft only for T eflon Bladed Stirrers eflon Bladed Stirrers RPERFITS Catalogue Sizes PPP rice/Piece No.No.No. mm. Rs. P ... 51A/14 450 x 6 100-00 51A/15 450 x 8 115-00 51A/16 450 x 10 150-00 51A/17 600 x 8 140-00 51A/18 600 x 10 185-00 51A/19 400 x 8 110-00 51A/20 500 x 8 125-00 13 GLANDS & GUIDES 51B51B51B TTT eflon Blade only for T eflon Bladed Stirrers RPERFITS 51B/21 52x6 225-00 51B/22 52x8 225-00 51B/23 76x6 325-00 51B/24 76x8 325-00 51B/25 76x10 325-00 51B/26 100x8 425-00 51B/27 100x10 425-00 51B/28 125x10 550-00 51B/29 150x10 750-00 525252 Stirrer Gland and GuideStirrer Gland and Guide RPERFITS Catalogue TTT o fit Stirrer Socket Cone Approx. Stem PP P rice/Piece No.No.No. Shaft mm. sizesizesize sizesizesize Length mm. Rs. P ... 52/01 6 B 19 B 19 200 270-00 52/02 6 B 24 B 24 200 280280280 -00-00-00 53 GGG round Sleeve Gland with Cap and T eflon Ring RPERFITS 52 Catalogue Cone TTT o Fit Stirrer PPP rice/Piece No.No.No. sizesizesize Shaft mm. Rs. P ... 53/01 B 19 6 425-00 53/02 B 24 8 425-00 53/03 B 29 8 425-00 53/04 B 34 8 450-00 53/05 B 34 10 450450450 -00-00-00 53/11 B 24 with teflon tube 8 1025-00 53/13 B 34 with teflon tube 8 1175-00 54 StStSt uffing Box with Integral Driving P ulleyulley QPERFITR Adequate seal is achieved by suitable compression of synthetic rubber O-ring. Catalogue Cone To Fit Stirrer Price/Piece No.No.No. sizesizesize Shaft mm. Rs. P. 53 54/01 B 14 6 2750-00 54/02 B 19 6 2950-00 54/03 B 19 8 2950-00 54/04 B 24 6 3150-00 54/05 B 24 8 3150-00 54/07 B 29 8 3500-00 54/08 B 29 10 3500-00 54/09 B 34 8 3950-00 54/10 B 34 10 3950-00 54 14 GLANDS & GUIDES 555555 Stuffing Box Gland All Teflon (PTFE) RPERFITS Catalogue Cone To Fit Stirrer Price/Piece No.No.No. sizesizesize Shaft mm. Rs. P. 55/01 B 14 6 540-00 55/02 B 19 6 575-00 55/03 B 19 8 575-00 55/04 B 24 6 795-00 55/05 B 24 8 795-00 55/07 B 29 8 950-00 55/08 B 29 10 950-00 55/09 B 34 8 1150-00 55/10 B 34 10 1150-00 55/11 B 40 10 1750-00 55/12 B 55 10 3500-00 55 Note :Sizes not listed can be supplied, mention stirrer shaft diameter. 565656 Rubber Sleeve Gland RPERFITS Catalogue Cone To Fit Stirrer Price/Piece No.No.No. sizesizesize Shaft mm. Rs. P. 56/01 6 B 14 85-00 56/02 6 B 19 90-00 56/03 6 B 24 95-00 56 575757 Mercury Seal Gland with Ste m at Bottom RPERFITS Catalogue Cone To Fit Stirrer Price/Piece No.No.No. sizesizesize Shaft mm. Rs. P. 57/01 6 B 19 350-00 57/02 8 B 24 350-00 57/03 8 B 34 425-00 585858 Water Cooled Stir rer with Teflon Blade RPERFITS Catalogue Cone To Fit Stirrer Price/Piece No.No.No. sizesizesize Shaft mm. Rs. P. 57 58/01 8 B 24 1250-00 58/02 10 B 34 1400-00 (Please Mention the Length of Stirrer Rod) 15 CONDENSERS QPERFITR Condensers 595959 Liebig Condensers RPERFITS Catalogue Effective Length Socket Cone PPP rice/Piece No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P ... 59/01 150 B 14 B 14 195-00 59/02 300 B 14 B 14 250-00 59/03 200 B 19 B 19 220-00 59/04 200 B 24 B 24 250-00 59/05 250 B 19 B 19 250-00 59/06 250 B 24 B 24 275-00 59/07 300 B 19 B 19 265-00 59/08 300 B 24 B 24 300-00 59/10 350 B 19 B 19 305-00 59/11 350 B 24 B 24 315-00 59/12 400 B 19 B 19 325-00 59/13 400 B 24 B 24 335-00 59/15 350 B 29 B 29 375-00 59 59/16 400 B 29 B 29 425-00 59/17 450 B 19 B 19 335-00 59/18 450 B 24 B 24 350-00 59/19 500 B 19 B 19 390-00 59/20 500 B 24 B 24 405-00 59/21 500 B 34 B 34 750-00 59/22 600 B 24 B 24 450-00 59/24 600 B 29 B 29 750-00 59/25 600 B 34 B 34 825-00 59/26 750 B 24 B 24 650-00 59/27 750 B 29 B 29 925-00 59/28 750 B 34 B 34 950-00 59/29 900 B 34 B 34 1050-00 59/30 300 --- B 19 260-00 59/31 350 --- B 24 300-00 59/32 250 --- B 34 320-00 606060 Air Condensers RPERFITS Catalogue Effective Length Socket Cone PPP rice/Piece No. m mmmm ... sizesizesize sizesizesize Rs. P ... 60/01 100 B 10 B 10 115-00 60/02 200 B 14 B 14 130-00 60/03 200 B 19 B 19 155-00 60/04 250 B 24 B 24 215-00 60/05 400 B 19 B 19 240-00 60/06 400 B 24 B 24 275-00 60/08 500 B 24 B 24 300-00 60/09 600 B 19 B 19 275-00 60/10 750 B 24 B 24 460-00 60/11 450 --- B 14 105-00 60/13 750 --- B 19 150-00 60/14 750 --- B 24 160-00 60 60/15 1000 --- B 19 185-00 16 60/16 1000 --- B 24 205-00 CONDENSERS 616161 Coil Condenser sss Grah aaa mmm ,,, Coil ed ed ed Distillate Type RPERFITS Catalogue Effective Length Socket Cone Price/Piece No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P. 61/01 150 B 19 B 19 390-00 61/02 200 B 19 B 19 415-00 61/03 200 B 24 B 24 425-00 61/04 300 B 19 B 19 475-00 61/05 300 B 24 B 24 525-00 61/06 350 B 19 B 19 520-00 61/07 350 B 24 B 24 545-00 61/09 400 B 19 B 19 570-00 61/10 400 B 24 B 24 590-00 61/11 400 B 34 B 34 690-00 61/12 500 B 19 B 19 600-00 61/13 500 B 24 B 24 625-00 61/14 500 B 34 B 34 830-00 61 61/15 600 B 34 B 34 905-00 626262 Coil Condensers, R eversible T ype RPERFITS Catalogue Effective Length Cone PPP rice/Piece No.No.No. mmm m.m.m. size Rs. P ... 62/01 150 B 24 & B 19 480-00 62/02 150 B 34 & B 19 515-00 62/03 150 B 34 & B 24 575-00 636363 Double Coil Condensers with Common Inlet RPERFITS 62 Catalogue Effective Length Socket Cone PPP rice/Piece No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P ... 63/01 200 B 19 B 19 985-00 63/02 200 B 24 B 24 1005-00 63/03 350 B 34 B 34 2400-00 63/04 450 B 34 B 34 3625-00 63/05 600 B 34 B 34 4200-00 646464 Jacketed Coil CondensersJacketed Coil Condensers RPERFITS 63 Catalogue Effective Length Socket Cone PPP rice/Piece No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P ... 64/01 150 B 19 B 19 525-00 64/02 150 B 24 B 24 535-00 64/03 200 B 19 B 19 575-00 64/04 200 B 24 B 24 585-00 64/05 300 B 19 B 19 680-00 64/06 300 B 24 B 24 690-00 64/07 400 B 24 B 24 825-00 64/08 400 B 34 B 34 915-00 64/10 500 B 34 B 34 1325-00 64 17 CONDENSERS 656565 Inland R evenue Condensers RPERFITS Catalogue Effective Length Socket Cone PPP rice/Piece No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P ... 65/01 200 B 19 B 19 850-00 65/02 200 B 24 B 24 950-00 666666 Davies Condensers, Double Sur face RPERFITS Catalogue Effective Length Socket Cone PPP rice/Piece 65 No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P ... 66/01 100 B 10 B 10 380-00 66/02 150 B 14 B 14 455-00 66/03 150 B 19 B 19 465-00 66/05 200 B 19 B 19 515-00 66/06 200 B 24 B 24 525-00 66/07 200 B 29 B 29 560-00 66/09 200 ___ B 19 485-00 66/10 200 ----- B 24 490-00 66/11 200 ----- B 29 510-00 66/12 200 ----- B 34 520-00 66/13 250 B 19 B 19 540-00 66/14 250 B 24 B 24 555-00 66/15 250 B 29 B 29 610-00 66/17 300 B 19 B 19 620-00 66/18 300 B 24 B 24 635-00 66/19 300 B 29 B 29 675-00 66 66/20 400 B 19 B 19 705-00 66/21 400 B 24 B 24 715-00 66/22 400 B 29 B 29 790-00 66/24 500 B 24 B 24 1000-00 66/25 500 B 34 B 34 1150-00 66/26 600 B 34 B 34 1350-00 676767 Allihn Condensers (Bulb)Allihn Condensers (Bulb) RPERFITS Catalogue Effective Length Socket Cone PPP rice/Piece No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P ... 67/01 200 ---- B 19 340-00 67/02 200 ---- B 24 350-00 67/03 200 ---- B 29 360-00 67/04 200 ---- B 34 340-00 67/05 200 ---- B 40 380-00 67/06 200 ---- B 50 495-00 67 67/08 250 ---- B 50 575-00 67/09 200 B 19 B 19 340-00 67/10 200 B 24 B 24 370-00 67 67/11 300 B 19 B 19 415-00 67/12 300 B 24 B 24 435-00 67/13 400 B 19 B 19 480-00 67/14 400 B 24 B 24 510-00 67/16 400 B 29 B 29 540-00 18 67/17 500 B 24 B 24 615-00 CONDENSERS Catalogue Effective Length Socket Cone PPP rice/Piece No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P ... 67/18 500 B 29 B 29 680-00 67/19 600 B 24 B 24 725-00 67/20 600 B 29 B 29 755-00 67/21 600 B 34 B 34 775-00 67/22 750 B 24 B 24 1250-00 67/23 750 B 29 B 29 1275-00 67/25 750 B 34 B 34 1375-00 686868 Immersion Condensers (Cold Finger) RPERFITS Catalogue Length Cone PPP rice/Piece No.No.No. mmm m.m.m. sizesizesize Rs. P ... 68/01 130 B 19 160-00 696969 Ether Condensers Ether Condensers RPERFITS Catalogue Length Socket Cone PPP rice/Piece No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P ... 69/01 150 B 19 B 24 1850-00 69/02 200 B 19 or B 24 B 24 1950-00 69/03 250 B 19 or B 24 B 24 2125-00 707070 F F F riedrich Condensersriedrich Condensers RPERFITS Catalogue Length Socket Cone PPP rice/Piece 68 No.No.No. mmm m.m.m. sizesizesize sizesizesize Rs. P ... 70/01 150 B 19 B 24 1325-00 70/02 200 B 19 or B 24 B 19 or B 24 1375 -00-00-00 70/03 250 B 19 or B 24 B 19 or B 24 1425 -00-00-00 70/04 300 B 24 B 24 1525-00 69 70 19 CONDENSERS RPERFITS Condensers wi thout Joints 71 Liebig CondensersLiebig Condensers RPERFITS Catalogue Effective length PPP rice/Piece No.No.No. mm. Rs. P ... 71/01 200 175-00 71/02 300 195-00 71/03 400 250-00 71/04 500 320320320 -00-00-00 71 727272 Allihn Condensers (Bulb)Allihn Condensers (Bulb) RPERFITS Catalogue Effective length PPP rice/Piece No.No.No. mm. Rs. P ... 72/01 200 295-00 72/02 300 370-00 72/03 400 430-00 72/04 500 510-00 737373 Coil Condensers RPERFITS 72 Catalogue Effective length PPP rice/Piece No.No.No. mm. Rs. P ... 73/01 200 350-00 73/02 300 410-00 73/03 400 475-00 73/04 500 600- 000000 73 747474 Air Condensers ‘PERFITS Catalogue Effective length PPP rice/Piece No.No.No. mm. Rs. P ... 74/01 400 100-00 74/02 600 120-00 74/03 750 165-00 74/04 1000 225-00 74 757575 Condensers Bulb Shape RPERFITS Suitable for 1000 ml. spoutless, T allallall form, Beaker ... Catalogue PPP rice/Piece No.No.No. Rs. P ... 75/01 390-00 20 FLASKS QPERFITR Flasks 767676 Flask s Round Bottom, Short or Medium Neck RPERFITS with Socket. Catalogue Socket Capacity of Flasks Price/Piece No.No.No. SizeSizeSize mmm l.l.l. Rs. P. 76/01 B 10 5 60-00 76/02 B 14 5 60-00 76/03 B 14 10 65-00 76/04 B 14 25 85-00 76/06 B 14 50 115-00 76/07 B 14 100 135-00 76/08 B 19 50 115-00 76 76/09 B 24 50 115-00 76/10 B 19 100 135-00 76/11 B 19 150 150-00 76/12 B 19 250 175-00 76/13 B 24 100 135-00 76/14 B 24 150 150-00 76/15 B 24 250 165-00 76/16 B 29 250 175-00 76/17 B 34 250 175-00 76/19 B 24 500 225-00 76/20 B 29 500 225-00 76/21 B 34 500 235-00 76/22 B 24 1000 335-00 76/23 B 24 2000 660-00 76/24 B 24 3000 1650-00 76/25 B 29 1000 335-00 76/26 B 34 1000 335-00 76/27 B 34 2000 660-00 76/28 B 29 3000 1650-00 76/30 B 34 3000 1650-00 76/31 B 24 5000 2550-00 76/32 B 34 5000 2550-00 76/33 B 40 5000 2550-00 76/34 B 55 5000 2550-00 76/35 B 34 10000 4750-00 76/36 B 40 10000 4750-00 76/37 B 50 10000 4750-00 76/38 B 55 10000 4750-00 76/39 B 34 20000 9250-00 76/40 B 40 20000 9250-00 76/41 B 50 20000 9250-00 76/42 B 55 20000 9250-00 76 A Flask s Flat Bottom, Short or Medium Neck RPERFITS with Socket. Catalogue Socket Capacity of Flasks Price/Piece No.No.No. SizeSizeSize mmm l.l.l. Rs. P. 76A 76A/01 B 10 5 60-00 76A/02 B 14 5 60-00 76A/03 B 14 10 65-00 76A/04 B 14 25 85-00 76A/06 B 14 50 115-00 76A/07 B 14 100 135-00 21 FLASKS Catalogue Socket Capacity of Flasks Price/Piece No.No.No. SizeSizeSize mmm l.l.l. Rs. P. 76A/08 B 19 50 115-00 76A/09 B 24 50 115-00 76A/10 B 19 100 135-00 76A/11 B 19 150 150-00 76A/12 B 19 250 175-00 76A/13 B 24 100 135-00 76A/14 B 24 150 150-00 76A/15 B 24 250 165-00 76A/16 B 29 250 175-00 76A/17 B 34 250 175-00 76A/19 B 24 500 225-00 76A/20 B 29 500 225-00 76A/21 B 34 500 235-00 76A/22 B 24 1000 335-00 76A/23 B 24 2000 660-00 76A/24 B 24 3000 1650-00 76A/25 B 29 1000 335-00 76A/26 B 34 1000 335-00 76A/27 B 34 2000 660-00 76A/28 B 29 3000 1650-00 76A/30 B 34 3000 1650-00 76A/31 B 24 5000 2550-00 76A/32 B 34 5000 2550-00 76A/33 B 40 5000 2550-00 76A/34 B 55 5000 2550-00 76A/35 B 34 10000 4750-00 76A/36 B 40 10000 4750-00 76A/37 B 50 10000 4750-00 76A/38 B 55 10000 4750-00 76A/39 B 34 20000 9250-00 76A/40 B 40 20000 9250-00 76A/41 B 50 20000 9250-00 76A/42 B 55 20000 9250-00 777777 Flasks Round Botto m, Two Necks, Centre Neck and One Parallel Side Neck RPERFITS with Interchangeable Joints. Catalogue Capacity Centre SideSideSide Price/Piece No.No.No. ml.ml.ml. Socket Socket Rs. P. 77/00 100 B 24 B 19 190-00 77/01 250 B 19 B 14 255-00 77/02 250 B 24 B 14 255-00 77/03 250 B 24 B 19 255-00 77/04 500 B 24 B 14 365-00 77/05 500 B 24 B 19 365-00 77/06 500 B 24 B 24 365-00 77 77/07 1000 B 24 B 14 475-00 77/08 1000 B 24 B 19 475-00 77/09 1000 B 24 B 24 475-00 77/10 1000 B 34 B 19 475-00 77/11 1000 B 34 B 24 475-00 77/12 2000 B 24 B 14 925-00 22 77/13 2000 B 24 B 19 925-00 FLASKS Catalogue Capacity Centre SideSideSide Price/Piece No.No.No. ml.ml.ml. Socket Socket Rs. P. 77/13A 2000 B 24 B 24 925-00 77/14 2000 B 34 B 19 925-00 77/15 2000 B 34 B 24 925-00 77/16 3000 B 24 B 19 2125-00 77/17 3000 B 34 B 24 2125-00 77/18 5000 B 34 B 19 3050-00 77/19 5000 B 34 B 24 3050-00 77/20 5000 B 55 B 24 3050-00 77/21 10000 B 34 B 24 5500-00 77/22 10000 B 55 B 24 5500-00 77/23 20000 B 34 B 24 9750-00 77/24 20000 B 55 B 24 9750-00 787878 Flasks Roun d Bottom, Two Necks, Centre Neck and One Angled Side Neck RPERFITS with Interchangeable Joints. Catalogue Capacity Centre SideSideSide Price/Piece No.No.No. mmm l.l.l. Socket Socket Rs. P. 78/00 50 B 24 B 19 198-00 78/01 100 B 19 B 14 190-00 78/02 100 B 24 B 14 190-00 78/03 100 B 24 B 19 190-00 78/04 250 B 19 B 14 255-00 78/05 250 B 24 B 14 255-00 78/06 250 B 24 B 19 255-00 78/07 500 B 24 B 14 365-00 78/08 500 B 24 B 19 365-00 78/09 500 B 24 B 24 365-00 78 78/10 1000 B 24 B 14 475-00 78/11 1000 B 24 B 19 475-00 78/11A 1000 B 24 B 24 475-00 78/12 1000 B 34 B 19 475-00 78/13 1000 B 34 B 24 475-00 78/14 2000 B 24 B 19 925-00 78/15 2000 B 24 B 24 925-00 78/16 2000 B 34 B 19 925-00 78/17 2000 B 34 B 24 925-00 78/18 3000 B 24 B 19 2125-00 78/20 3000 B 34 B 24 2125-00 78/21 5000 B 34 B 19 3050-00 78/22 5000 B 34 B 24 3050-00 78/23 5000 B 55 B 24 305305305 0-00 78/24 10000 B 34 B 24 5500-00 78/25 10000 B 55 B 24 5500-00 78/26 20000 B 34 B 24 9750-00 78/27 20000 B 55 B 24 9750-00 797979 Flasks Round Bottom, Three Necks, All Necks Parallel RPERFITS with Interchangeable Joints. Catalogue Capacity Centre SideSideSide Price/Piece No.No.No. ml.ml.ml. Socket Socket Rs. P. 79 79/00 100 B 24 B 14 250-00 79/01 250 B 19 B 14 340-00 79/02 250 B 19 B 19 340-00 23 FLASKS Catalogue Capacity Centre SideSideSide Price/Piece No.No.No. ml.ml.ml. Socket Socket Rs. P. 79/03 250 B 24 B 14 340-00 79/04 250 B 24 B 19 340-00 79/05 250 B 29 B 14 340-00 79/06 500 B 24 B 14 510-00 79/07 500 B 24 B 19 510-00 79/08 500 B 29 B 14 510-00 79/09 500 B 29 B 19 510-00 79/10 1000 B 24 B 14 645-00 79/11 1000 B 24 B 19 645-00 79/11A 1000 B 24 B 24 645-00 79/12 1000 B 34 B 19 655-00 79/13 1000 B 34 B 24 655-00 79/14 2000 B 24 B 19 1150-00 79/14 A 2000 B 24 B 24 1150-00 79/15 2000 B 34 B 19 1150-00 79/17 2000 B 34 B 24 1150-00 79/18 3000 B 34 B 19 2575-00 79/19 3000 B 34 B 24 2575-00 79/20 5000 B 34 B 19 3675-00 79/21 5000 B 34 B 24 3675-00 79/22 5000 B 45 B 24 3675-00 79/23 5000 B 55 B 24 3675-00 79/24 10000 B 34 B 24 6250-00 79/25 10000 B 45 B 24 6250-00 79/27 10000 B 55 B 24 6250-00 79/28 20000 B 34 B 24 10750-00 79/29 20000 B 55 B 24 10750-00 79/30 20000 B 55 B 34 10750-00 808080 Flasks Roun d Bottom , Three Necks, Centre Neck and Two Angled Side Necks RPERFITS with Interchangeable Joints. Catalogue Capacity Centre SideSideSide Price/Piece No.No.No. ml.ml.ml. Socket Socket Rs. P. 80/00 50 B 24 B 14 225-00 80/01 100 B 19 B 14 250-00 80/02 100 B 24 B 14 250-00 80/03 100 B 24 B 19 250-00 80/04 250 B 19 B 14 340-00 80/05 250 B 19 B 19 340-00 80/06 250 B 24 B 14 340340340 -00-00-00 80 80/07 250 B 24 B 19 340-00 80/08 250 B 29 B 14 340-00 80/10 500 B 24 B 14 510-00 80/11 500 B 24 B 19 510-00 80/12 500 B 29 B 14 510-00 80/13 500 B 29 B 19 510-00 80/15 1000 B 24 B 14 645-00 80/16 1000 B 24 B 19 645-00 80/16 A 1000 B 24 B 24 645-00 80/17 1000 B 34 B 19 655-00 80/18 1000 B 34 B 24 655-00 80/19 2000 B 24 B 19 1150-00 24 80/19 A 2000 B 24 B 24 1150-00 80/20 2000 B 34 B 19 1150-00 FLASKS Catalogue Capacity Centre SideSideSide Price/Piece No.No.No. ml.ml.ml. Socket Socket Rs. P. 80/21 2000 B 34 B 24 1150-00 80/22 3000 B 34 B 19 2575-00 80/23 3000 B 34 B 24 2575-00 80/24 5000 B 34 B 19 3675-00 80/25 5000 B 34 B 24 3675-00 80/26 5000 B 45 B 24 3675-00 80/27 5000 B 55 B 24 3675-00 80/28 10000 B 34 B 24 6250-00 80/29 10000 B 45 B 24 6250-00 80/30 10000 B 55 B 24 6250-00 80/31 20000 B 34 B 24 10750-00 80/32 20000 B 55 B 24 10750-00 80/33 20000 B 55 B 34 10750-00 818181 Flasks Round Bottom , Four Necks RPERFITS with Interchangeable Joints. Catalogue Capacity Price/Piece No.No.No. ml.ml.ml. Rs. P. 81/00 100 385-00 81/01 250 525-00 81 81/02 500 720-00 81/03 1000 900-00 81/05 2000 1500-00 81/07 3000 2800-00 81/09 5000 4325-00 81/11 10000 7250-00 81/13 20000 12500-00 (While placing order please mention the size of the centre socket and side sockets and whether at angle or parallel). RPERFITS 828282 Flasks Filter (Buchner) with Socket. 82 Catalogue Socket Capacity of PPP rice/Piece No.No.No. SizeSizeSize Flask ml.ml.ml. Rs. P ... 82/01 B 19 100 225-00 82/02 B 24 250 365-00 82/03 B 24 500 485-00 82/04 B 24 1000 825-00 82/05 B 34 1000 825-00 82/06 B 24 2000 1575-00 82/07 B 34 2000 1575 -00-00-00 838383 Flasks Kjeldahl RPERFITS with Socket. Catalogue Socket Capacity of PPP rice/Piece No.No.No. SizeSizeSize Flask ml.ml.ml. Rs. P ... 83/01 B 19 50 145-00 83/02 B 19 100 180-00 83/03 B 24 100 190-00 83 25 FLASKS Catalogue Socket Capacity of PPP rice/Piece No.No.No. SizeSizeSize Flask ml.ml.ml. Rs. P ... 83/04 B 24 300 275-00 83/05 B 24 500 405-00 83/06 B 24 800 480-00 83/07 B 29 800 510-00 848484 Flasks Conical (Erlenmeyer) RPERFITS with Socket. Catalogue Socket Capacity of PPP rice/Piece No.No.No. SizeSizeSize Flask ml.ml.ml. Rs. P ... 84/01 B 10 5 75-00 84/02 B 10 10 80-00 84/03 B 10 25 90-00 84/04 B 14 10 80-00 84/05 B 14 25 90-00 84/06 B 14 50 105-00 84/08 B 14 100 135-00 84/09 B 19 50 105-00 84 84/10 B 19 100 135-00 84/11 B 19 150 155-00 84/12 B 19 250 170-00 84/13 B 19 500 198-00 84/14 B 24 50 105-00 84/15 B 24 100 135-00 84/16 B 24 150 155-00 84/18 B 24 250 170-00 84/19 B 29 250 170-00 84/20 B 34 250 190-00 84/21 B 24 500 240-00 84/22 B 24 1000 440-00 84/23 B 29 500 240-00 84/25 B 34 500 265-00 84/26 B 29 1000 440-00 84/27 B 34 1000 450-00 84/28 B 24 2000 875-00 84/30 B 34 2000 875875875 -00-00-00 858585 FlaFlaFla sks Conical with Screw Cap and Teflon Liner RPERFITS Catalogue Capacity Price/Piece No.No.No. ml.ml.ml. Rs. P. 85/01 25 115-00 85/02 50 140-00 85/03 100 165-00 85/04 150 190-00 85/06 250 225-00 85 85/07 500 295-00 85/08 1000 500-00 85/09 2000 890-00 26 FLASKS 868686 Flasks Conical with Interchangeable StopperFlasks Conical with Interchangeable Stopper RPERFITS Catalogue Capacity PPP rice/Piece No.No.No. ml.ml.ml. Rs. P ... 86/01 10 120-00 86/02 25 125-00 86/03 50 140-00 86/04 100 170-00 86/05 150 200-00 86/06 250 215-00 86/07 500 290-00 86 86/08 1000 525-00 86/10 2000 1050-00 878787 Flasks Iodine with F unnel Shaped Cup and Stopper RPERFITS Catalogue Capacity PPP rice/Piece No.No.No. ml.ml.ml. Rs. P ... 87/01 100 165-00 87/02 150 200-00 87/04 250 210-00 87/05 500 275-00 87/06 1000 550-00 888888 Flasks (V essessess els) R eaction, Wide Mouth, Flat Flange100 mm. I.D., 87 150 mm. O .D. .D..D. RPERFITS Catalogue Capacity PPP rice/Piece No.No.No. ml.ml.ml. Rs. P ... 88/01 1000 1950-00 88/02 2000 2750-00 88/03 3000 3450-00 88/04 5000 4650-00 88/05 10000 7675-00 88 88/06 20000 13875-00 898989 Lids for RRR eaction Flasks, Flat Flange 100 mm. I.D., 150 mm.O ... D. D.D. RPERFITS with Interchangeable Joints. Catalogue Centre PPP arallel Joint Size Side Side PPP rice/Piece No. Side 5 10 10 10 15 15 15 Rs. P ... 89/01 B 19 B 19 B 24 B 19 ----- 3250-00 89/02 B 24 B 19 B 24 B 19 ----- 3250-00 89/03 B 24 B 24 B 24 B 24 ----- 3250-00 89/04 B 19 B 14 B 14 B 14 B 29 3400-00 89 89/05 B 24 B 14 B 14 B 19 B 29 3400-00 89/06 B 34 B 19 B 24 B 24 B 29 3400-00 89/07 B 34 B 24 B 24 B 24 B 24 3400-00 27 FLASKS 909090 Clip for Holding 100 mm. Flat Flanges Q PERFIT R 525525525 -00-00-00 90A90A90A TTT eflon Gasket for 100 mm. Flat Flanges 475-00 919191 Flasks Pear Shaped,Single Neck RPERFITS 90 Catalogue Socket Capacity Price/Piece No.No.No. sizesizesize ml.ml.ml. Rs. P. 91/01 B 14 5 75-00 91/02 B 14 10 85-00 91/03 B 14 25 105-00 91/05 B 14 50 145-00 91/06 B 14 100 190-00 929292 Flasks P ear Shaped, T wo Necks, One Angled Side Neck RPERFITS 91 Catalogue Centre Neck Side Neck Cap. of Flasks PPP rice/Piece No.No.No. Socket Size Socket Size ml.ml.ml. Rs. p. 92/01 B 14 B 14 25 175-00 92/02 B 14 B 14 50 225-00 92/03 B 14 B 14 100 245-00 939393 Flasks P ear Shaped, Three Necks, One Angled Side and One P arallel Side RPERFITS 92 Catalogue Centre Neck Side Neck Cap. of Flasks PPP rice/Piece No.No.No. Socket Size Socket Size ml.ml.ml. Rs. P ... 93/01 B 14 B 14 25 265-00 93/02 B 14 B 14 50 290-00 93/03 B 14 B 14 100 305-00 949494 Flasks Distillation P ear Shapedear Shaped RPERFITS 93 Catalogue Socket Cone Cap. of Flasks PPP rice/Piece No.No.No. SizeSizeSize Size ml.ml.ml. Rs. P ... 94/01 B 14 B 14 10 150-00 94/02 B 14 B 14 25 180-00 94/03 B 14 B 14 50 225-00 94/04 B 14 B 14 100 270-00 94 28 FLASKS 959595 Flasks Claisen, P ear Shaped ear Shaped RPERFITS Catalogue Socket Cone Cap. of Flasks PPP rice/Piece No.No.No. SizeSizeSize Size ml.ml.ml. Rs. P ... 95/01 B 14 B 14 10 255-00 95 95/02 B 14 B 14 25 280-00 95/03 B 14 B 14 50 300-00 95/04 B 14 B 14 100 395-00 969696 Flasks P ear Shaped, Vigreux,Claisen T ype RPERFITS Catalogue Socket Cone Cap. of Flasks PPP rice/Piece No.No.No. SizeSizeSize Size ml.ml.ml. Rs. P ... 96 96/01 B 14 B 14 10 280-00 96/02 B 14 B 14 25 290-00 96/03 B 14 B 14 50 300-00 96/04 B 14 B 14 100 385-00 979797 Flasks P ear Shaped,Vigreux RPERFITS with Side Neck. Catalogue Side Neck Main Neck Cap. of Flasks PP P rice/Piece No.No.No. Socket Size Cone Size ml.ml.ml. Rs. P ... 97/01 B 14 B 14 10 280-00 97/02 B 14 B 14 25 290-00 97/03 B 14 B 14 50 300-00 97 97/04 B 14 B 14 100 385-00 29 COLUMNS 'PERFIT ' FFF ractionating Columns 989898 Dufton Columns Dufton Columns RPERFITS Catalogue Socket Cone Effective Length PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize mm. Rs. P ... 98/01 B 19 B 19 150 380-00 98/02 B 19 B 19 300 440-00 98 98/03 B 24 B 24 150 425-00 98/04 B 24 B 24 300 525-00 999999 Vigreux ColumnsVigreux Columns RPERFITS 99 Catalogue Socket Cone Effective Length PPP rice/Piece No.No.No. SizeSizeSize SizeSizeSize mm. Rs. P ... 99/01 B 24 B 24 360 440-00 99/02 B 24 B 24 600 580-00 99/03 B 29 B 29 360 515-00 99/04 B 34 B 34 600 875-00 101101101 Plain ColumnsPlain Columns RPERFITS Catalogue Socket Cone Effective Length PPP ririri ce/Piece 101 No.No.No. SizeSizeSize SizeSizeSize mm. Rs. P ... 101/01 B 24 B 24 250 215-00 101/02 B 24 B 24 500 300-00 101/03 B 24 B 24 750 420-00 101/04 B 34 B 34 600 610-00 101/05 B 34 B 34 1000 1095-00 101/06 B 34 B 34 250 495-00 102102102 FFF ractionating Columns, R od aod aod a nd Disc P atternattern RPERFITS Catalogue No. of PPP rice/Piece No.No.No. Discs Rs. P ... 102 102/01 15 PPP .O.O.O .R..R..R. 102/02 20 PPP .O.O.O .R..R..R. 103103103 FFF ractionating Columns, P ear Shaped Bulbs RPERFITS Catalogue No. of PPP rice/Piece No.No.No. Bulbs Rs. P ... 103/01 4 PPP .O.O.O .R..R..R. 103/02 8 PPP .O.O.O .R..R..R. 103/03 12 PPP .O.O.O .R..R..R. 1 0 4410 PPP acking for Plain Columnsacking for Plain Columns RPERFITS 103 Catalogue Description Approx. Approx. PPP rice/Kg. No.No.No. Dia. mmmmmm ... Length mmm mmm ... Rs. P ... 104/01 Rasching Ring N.G. 6 6 850-00 104/02 Rasching Ring N.G. 8 8 875-00 104/03 Rasching Ring N.G. 10 10 890-00 104 104/04 Glass Beads N.G. 1250-00 without Holes 30 SEPARATING FUNNELS 'PERFIT ' Separa ting/Dropping F unnels 105105105 Separating F unnels with Glass K ey Stopcock, Interchangeable Stopper ,,, Conical/ PPP ear Shape, Plain Stem RPERFITS Catalogue Capacity PPP rice/Piece No.No.No. ml.ml.ml. Rs. P ... 105/01 25/30 250-00 105/02 50/60 285-00 105/03 100/125 435-00 105/04 250 495-00 105/05 500 650-00 105/06 1000 925-00 105/07 2000 1950-00 105/08 3000 3750-00 105 105/09 5000 5950-00 106106106 Separating F unnels with Screw T ypeypeype PTFE K ey R otaflow Stopcock ,,, Interchangeable Stopper ,,, CCC onical/P ear Shape, Plain Stem RPERFITS Catalogue Capacity PPP rice/Piece No.No.No. mmm l.l.l. Rs. P ... 106/01 25/30 260-00 106/02 50/60 295-00 106/03 100/125 450-00 106/04 250 510-00 106/05 500 675-00 106/06 1000 1050-00 106/07 2000 2075-00 106 106/08 3000 4000-00 106/09 5000 6500-00 107107107 Separating Funnels with PTFE Key Stopcock, Interchangeable Stopper, Conical/Pear Shape, Plain Stem RPERFITS Catalogue Capacity Price/Piece No.No.No. ml.ml.ml. Rs. P. 107/01 25/30 525-00 107/02 50/60 535-00 107/03 100/125 675-00 107/04 250 750-00 107/05 500 1050-00 107/06 1000 1500-00 107/07 2000 2650-00 107/08 3000 5000-00 107 107/09 5000 7400-00 31 SEPARATING FUNNELS 108108108 Separating Funnels with Glass Key Stopcock,Interchangeable Stop per,per,per, Globe Shape ,Plain Stem RPERFITS Catalogue Capacity Price/Piece No.No.No. ml.ml.ml. Rs. P. 108/01 25/30 250-00 108/02 50/60 285-00 108/03 100/125 335-00 108/04 250 405-00 108/05 500 510-00 108/06 1000 810-00 108/07 2000 1625-00 108/08 3000 3250-00 108/09 5000 4375-00 108 108/10 10000 7375-00 108/11 20000 13425- 000000 109109109 Separating Funnels withwithwith Screw Type PTFE KeyKeyKey Rotaflow Stopcock, Interchangeable Stopper, Globe Shape, Plain Stem RPERFITS Catalogue Capacity Price/Piece No.No.No. ml.ml.ml. Rs. P. 109/01 25/30 260-00 109/02 50/60 295-00 109/03 100/125 350-00 109/04 250 425-00 109/05 500 540-00 109/06 1000 915-00 109 109/07 2000 1775-00 109/08 5000 5100-00 110110110 Separating Funnels with PTFE Key Stopcock, Interchangeable Stopper, Globe Shape, Plain Stem RPERFITS Catalogue Capacity Price/Piece No.No.No. ml.ml.ml. Rs. P. 110/01 25/30 500-00 110/02 50/60 525-00 110/03 100/125 600-00 110/04 250 740-00 110/05 500 975-00 110/06 1000 1350-00 110/07 2000 2300-00 110/08 3000 4600 -00-00-00 110/09 5000 6100-00 110 32 DROPPING FUNNELS 111111111 Dropping Funnels, Cylindrical , Cylindrical, with Interchangeable Stopper and Glass Key Stopcock, Plain Stem RPERFITS Catalogue Capacity Price/Piece No.No.No. mmm l.l.l. Rs. P. 111/01 50 265-00 111/02 100 290-00 111/03 150 325-00 111/04 250 375-00 111/05 500 545-00 111/06 1000 1010-00 111 112112112 Dropping Funnels, Cylindrical , Graduated, with Interchangeable Stopper and Glass Key Stopcock, Plain Stem RPERFITS Catalogue Capacity Price/Piece No.No.No. ml.ml.ml. Rs. P. 112/01 50 315-00 112/02 100 360-00 112/03 150 435-00 112/04 250 510-00 112/05 500 725-00 112/06 1000 1300-00 113113113 Dropping Funnels, Cylindrical, with Screw Type PTFE Key Rotaflow 112 Stopcock, Interchange able Stopper, Plain Stem RPERFITS Catalogue Capacity Price/Piece No.No.No. mmm l.l.l. Rs. P. 113/01 50 225-00 113/02 100 260-00 113/03 150 360-00 113/04 250 460-00 113/05 500 660-00 113/06 1000 1175 -00-00-00 114114114 Dropping Funnels ,,, Cylindrical, Graduated ,,, with Screw Type PTFE 113 KeyKeyKey Rotaflow Stopcock ,,, Interchangeable Stopper, Plain Stem RPERFITS Catalogue Capacity Price/Piece No.No.No. mmm l.l.l. Rs. P. 114/01 50 285-00 114/02 100 315-00 114/03 150 410-00 114/04 250 585-00 114 114/0511 500 875-00 114/06 1000 1450-00 33 DROPPING/ SEPARATING FUNNELS 115115115 Dropping Funnels, Cylindrical, Open Top, with Glass Key Stopcock and Stem with Cone RPERFITS Catalogue Capacity Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize Rs. P. 115/01 50 B 19 275-00 115/02 100 B 19 300-00 115/03 100 B 24 310-00 115/04 150 B 24 385-00 115/05 250 B 19 425-00 115/06 250 B 24 435-00 115/07 500 B 24 475-00 116116116 Dropping Funnels, Cylindrical, Open Top, with Screw Type PTFE KeyKeyKey Rotaflow Stopcock and Stem with Cone RPERFITS 115 Catalogue Capacity Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize Rs. P. 116/01 50 B 19 280-00 116/02 100 B 19 310-00 116/03 100 B 24 320-00 116/04 150 B 24 400-00 116/05 250 B 19 445-00 116/06 250 B 24 520-00 117117117 Separating Funnels, Pear shape, with socket with Glass Key Stopcock and Stem with Cone but without Stopper RPERFITS 116 Catalogue Capacity Socket Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize SizeSizeSize Rs. P. 117/01 25 B 14 B 14 325-00 117/02 50 B 14 B 14 335-00 117/03 50 B 19 B 19 350-00 117/04 100 B 14 B 14 400-00 117/05 100 B 19 B 19 410-00 117/06 250 B 14 B 14 440-00 117/07 250 B 19 B 19 450-00 117/08 500 B 19 B 19 575-00 117/09 500 B 24 B 24 620-00 117/10 1000 B 19 B 19 850-00 117 117/11 1000 B 24 B 24 875-00 34 DROPPING / SEPARATING FUNNELS 118118118 Separating Funnels ,,, Pear Shape with sss ocket with Screw Type PTFE Key Rotaflow Stopcock and Stem with Cone butbutbut without Stopper QPERFITR Catalogue Capacity Socket Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize SizeSizeSize Rs. P. 118/01 25 B 14 B 14 330-00 118/02 50 B 14 B 14 340-00 118/03 50 B 19 B 19 360-00 118/04 100 B 14 B 14 410-00 118/05 100 B 19 B 19 420-00 118/06 250 B 14 B 14 490-00 118/07 250 B 19 B 19 500-00 118/08 500 B 19 B 19 595-00 118/09 500 B 24 B 24 640-00 118 118/10 1000 B 19 B 19 925-00 118/11 1000 B 24 B 24 950-00 119119119 Dropping Funnels, Cylindrical , with socket, with Glass Key Stopcock and Stem with Cone, but without Stopper RPERFITS Catalogue Capacity Socket Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize SizeSizeSize Rs. P. 119/01 25 B 14 B 14 280-00 119/02 50 B 14 B 14 300-00 119/03 100 B 14 B 14 360-00 119/04 100 B 19 B 19 365-00 119/05 250 B 19 B 19 470-00 119/06 500 B 19 B 19 680-00 119/07 1000 B 19 B 19 1050-00 120120120 Dropping Funnels, Cylindrical, with socket, with Screw Type PTFE Key Rotaflow Stopcock and Stem with Cone, but without Stopper RPERFITS 119 Catalogue Capacity Socket Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize SizeSizeSize Rs. P. 120/01 25 B 14 B 14 285-00 120/02 50 B 14 B 14 305-00 120/03 100 B 14 B 14 365-00 120/04 100 B 19 B 19 380-00 120/05 250 B 19 B 19 565-00 120/06 500 B 19 B 19 795-00 120/07 1000 B 24 B 24 1250-00 120/08 150 B 24 B 24 505-00 120/09 250 B 24 B 24 585-00 120/10 500 B 24 B 24 820-00 120 35 DROPPING/SEPARATING FUNNELS 121121121 Pressure Equalising Funnels, Pear Shape, with Socket with Glass Key Stopcock and Stem with Cone, but without Stopper RPERFITS Catalogue Capacity Socket Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize SizeSizeSize Rs. P. 121/01 100 B 19 B 19 610-00 121/02 100 B 24 B 24 630-00 121/03 250 B 19 B 19 675-00 121/04 250 B 24 B 24 690-00 121/05 500 B 19 B 19 810-00 121/06 500 B 24 B 24 835-00 121/07 500 B 34 B 34 900-00 122122122 Pressure Equalising Funnels, Cylindrical, with Socket, Glass Key Stopcock andandand Stem with Cone,but without Stopper RPERFITS 121/124 Catalogue Capacity Socket Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize SizeSizeSize Rs. P. 122/01 100 B 19 B 19 540-00 122/02 250 B 19 B 19 640-00 122/03 250 B 24 B 24 650-00 122/04 500 B 19 B 19 895-00 122/05 500 B 24 B 24 915-00 123123123 Dropping Funnels, Cylindrical, Open Top, with Gas Outlet Tube, Stem with B 24 Cone RPERFITS Catalogue Capacity Price/Piece No.No.No. ml.ml.ml. Rs. P. 123/01 100 400-00 122/125 124124124 Pressure Equalising Funnels, P ear Shape, with Socket, withear Shape, with Socket, with PTFE (Teflon) Stopcock and Stem with Cone, but without Stopper RPERFITS Catalogue Capacity Socket Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize SizeSizeSize Rs. P. 124/01 100 B 24 B 24 850-00 124/03 250 B 24 B 24 900-00 124/05 500 B 24 B 24 1075-00 125125125 Pressure Equalising Funnels, Cylindrical, with Socket, with PTFE (Teflon) Stopcock and Stem with Cone, but without Stopper RPERFITS Catalogue Capacity Socket Cone Price/Piece No.No.No. ml.ml.ml. SizeSizeSize SizeSizeSize Rs. P. 123 125/00 50 B 24 B 24 775-00 125/01 100 B 24 B 24 810-00 125/03 250 B 24 B 24 925-00 125/05 500 B 24 B 24 1175-00 36 DISTILLATION ASSEMBLIES QPERFITR Interchangeable Distilla tion Assemblies Catalogue Price/Set No.No.No. Rs. P. 130 130130 Steam Distillation Assembly Assembly RPERFITS Consisting of R. B. flask 500 ml. Two Necked, splash head, air leak tube, liebig condenser 200 mm. and receiver adapter. 1525-00 130/131 131131131 Steam Distillation AssemblySteam Distillation Assembly RPERFITS Consisting of R. B. flask 1000 ml. Two Necked, splash head, air leak tube, liebig condenser 200 mm. and receiver adapter. 1675-00 132132132 Steam Distillation Assembly RPERFITS Consisting of R. B. flask 500 ml., steam distillation head, liebig condenser 350 mm. 132/133 and receiver adapter. 1175-00 133133133 Steam Distillation AssemblySteam Distillation Assembly RPERFITS Consisting of R. B. flask 1000 ml., steam distillation head, liebig condenser 350 mm. and receiver adapter. 1325-00 134 134134134 Steam Distillation AssemblySteam Distillation Assembly RPERFITS Consisting of R. B. flask 1000 ml., multiple adapter two necks, air leak tube bent, recovery bend sloping jacketed coil condenser and receiver adapter. 1625-00 135135135 Solvent Recovery Assembly RPERFITS Consisting of R. B. flask 3000 ml., splash head adapter vertical, still head recovery with thermometer socket, air condenser, ether condenser 150 mm., receiver adapter, receiver flask1000 ml. and thermometer. 5575-00 135 136136136 Distillation Assembly RPERFITS Consisting of R. B. flask, recovery bend, liebig condenser and receiver adapter. Catalogue Flask Capacity Condenser Effective Price/Piece No.No.No. ml.ml.ml. Length mm. Rs. P. 136/01 250 200 800-00 136/02 500 300 950-00 136 136/03 1000 350 1150-00 136/04 2000 400 1525-00 136/05 3000 450 3150-00 136/06 5000 600 4700-00 137137137 Distillation Assembly RPERFITS Consisting of R. B. flask, splash head, liebig condenser and receiver adapter. Catalogue Flask C apacity Condenser Effective PPP rice/Piece No.No.No. ml.ml.ml. Length mm. Rs. P ... 137/01 1000 350 1350-00 137 137/02 2000 400 1725-00 137/03 3000 450 3225-00 137/04 5000 600 4850-00 137/05 10000 750 8250-00 37 DISTILLATION ASSEMBLIES 138138138 RRR ecover y Assemblyy Assembly RPERFITS Consisting of R. B. flask 2000 ml., still head, jacketed coil condenser 150 mm., receiver adapter and dropping funnel 100 ml. with stopper. 2250-00 139139139 RRR ecover y Assemblyy Assembly RPERFITS Consisting of R. B. flask 5000 ml., 138/139 still head, jacketed coil condenser 200 mm., receiver adapter and dropping funnel 100 ml. with stopper. 5250-00 140140140 RRR ecover y Assembly RPERFITS Consisting of R. B. flask 250 ml., 140 multiple adapter two necks, recovery bend slopping, liebig condenser 400 mm., receiver adapter and dropping funnel 100 ml. 1425-00 141 141141141 Solvent R ecover y Assembly RPERFITS Consisting of R. B. flask 250 ml.,recovery bend sloping, liebig condenser 400 mm., bend with vent and R. B. flask 250 ml. 1200-00 142142142 Solvent R ecover y Assemblyy Assembly RPERFITS Consisting of R. B. flask 500 ml.,recovery bend sloping, air condenser 200 mm., ether 142 condenser and buchner flask 250 ml. 3150-00 143143143 RRR eflux Assemblyeflux Assembly RPERFITS Consisting of R.B. flask and air condenser. Catalogue Flask Capacity Condenser Effective PPP rice/Piece No.No.No. ml.ml.ml. Length mm. Rs. P ... 143/01 100 500 425-00 143/02 250 750 450-00 143/03 500 1000 540- 000000 144144144 RRR eflux Assembl y yy QPERFITR Consisting of R.B. flask and liebig condenser. 143 Catalogue Flask Capacity Condenser Effective PPP rice/Piece 144 No.No.No. ml.ml.ml. Length mm. Rs. P ... 144/01 100 300 540-00 145 144/02 250 400 625-00 144/03 500 500 725-00 145145145 RRR eflux Assembly RPERFITS Consisting of R.B. flask 1000 ml. and reversible coil condenser. 1025-00 146146146 RRR eflux with Stirr ererer Assembly RPERFITS Consisting of R.B. flask 146 1000 ml., multiple adapter three necks, stirrer guide, rubber sleeve gland, collapsible paddle stirrer 450 mm. and coil condenser 150 ml. with stopper. 2325 --- 000000 147147147 RRR eaction Assemblyeaction Assembly RPERFITS Consisting of R. B. flask 1000 ml., 147 multiple adapter two necks, stirrer guide stuffing box with pulley, link stirrer 450 mm., still head, thermometer pocket, liebig condenser 400 mm., receiver bend with vent and R. B. flask 250 ml. 3575-00 148 148148148 Kjeldhal Distillation AssemblyKjeldhal Distillation Assembly RPERFITS Consisting of R.B. flask 1000 ml., multiple adapter two necks, splash head vertical, 38 liebig condenser, receiver adapter and dropping funnel 100 ml. 1625-00 DISTILLATION ASSEMBLIES 149149149 Kjeldhal Distillation AssemblyKjeldhal Distillation Assembly RPERFITS Consisting of Kjeldhal flask 500 ml. multiple adapter two necks, splash head vertical, liebig condenser, receiver adapter and dropping funnel 100 ml. 1675-00 150150150 Kjeldhal Distillation AssemblyKjeldhal Distillation Assembly RPERFITS Consisting of R.B. flask 1000 ml., multiple adapter three necks, splash head slopping, 149 liebig condenser, receiver adapter bent, stopper and dropping funnel 100 ml. 1925-00 151151151 Macro Kjeldhal Distillation Assembly RPERFITS Consisting of Kjeldhal flask 500 ml., multiple adapter ,splash head vertical, 152 dropping funnel with plug, liebig condenser and delivery adapter. 1750-00 152152152 VVV acuum Distillationacuum Distillation RPERFITS Consisting of R.B. flask 1000 ml., receiver bend, jacketed coil condenser 150 mm., receiver adapter 153 bend with vacuum connection and R. B. flask 250 ml. 1675-00 153153153 VVV acuum Sublimation Assemblyacuum Sublimation Assembly RPERFITS Consisting of test tube, adapter with T connection and immersion condenser. 480-00 154154154 FFF ractionating Assemblyractionating Assembly RPERFITS Consisting of R. B. flask 500., cup joint adapter, ball joint adapter, joint clip S-35, air condenser, multiple adapter two necks parallel, immersion condenser, still 154 head recovery, thermometer pocket, liebig condenser and receiver adapter straight. 2650-00 155155155 FFF ractio nating Assemblynating Assembly RPERFITS Consisting of R.B. flask 1000 ml., swan neck adapter, air condenser, multiple adapter two necks at 45 o, immersion condenser, still head , thermometer, leibig condenser, ball joint adapter with socket, cup joint adapter with cone, separating funnel 100 ml., reduction adapter, R. B. 155 flask two neck 500ml., vacuum release stopcock and joint clip. 4125-00 156156156 Continuous W W W ater Distillation Assembly RPERFITS Consisting of R.B. flask 2000 ml. Two necked,dropping funnel 100 ml, splash 156 head, jacked coil condenser, receiver adapter and conical flask. 2550-00 157157157 Distillation ApparatusApparatus RPERFITS RPERFITS Vertical type with special double walled condenser and automatic feeding arrangement with standard joints (without stand and heating arragement). Catalogue Flask Capacity Stage Price/Piece No.No.No. ml.ml.ml. Rs. P ... 157/01 1000 Single P.O.R 157/02 2000 Single P.O.R 157/03 3000 Single P.O.R 157/04 5000 Single P.O.R 157/06 1000 Double P.O.R 157/07 2000 Double P.O.R 157/08 3000 Double P.O.R 157/09 5000 Double P.O.R 39 DISTILLATION ASSEMBLES 158158158 VVV acuum Distillation Uniacuum Distillation Unit RPERFITS Consisting of reaction flask 20 litre with100 mm. flat flange at the top, flat flange adapter with 158 five necks, joining clip 100 mm., double surface condenser, gas inlet tube, thermo-meter pocket, stopper, recovery bend, thermometer, stirrer ground sleeve gland,anchor stirrer 750 mm., double coil condenser 400 mm., receiver adapter, intermediate flask 500 ml., vacuum control stopcock, stopcock adapter, R. B. flask two neck 2000 ml. and vacuum release stopcock. PPP . O. O. O .R..R..R. 159159159 Distillation T owersowers RPERFITS A complete Apparatus for the 159 fractionaldistillation of liquids at atmospheric or reduction pressure consisting of flask 500 ml. and 1000 ml. two necked with air leak and stopper, fractionating columns 24 long packed with rasching ring, double walled glass heater jacket, rheostat for 160 temperature control of heater, total condensation variable take off still head, coil condenser, receiver flask 500 ml., calcium chloride tube, tap connecting piece for use when operating under vacuum, thermometer, heating mantle cap. 1000 ml., suitable clamp and stand for holding above unit. PPP . O. O. O .R..R..R. 160160160 Distillation Apparatus RPERFITS Consisting of F.B. flask 500 ml. 161 grahm condenser 200 mm. and stopper. 1125-00 RPERFITS 161161161 Distillation ApparatusDistillation Apparatus Consisting of F.B. flask 2000ml. 162 friedrichSs condenser and stopper. 2700-00 162162162 Distillation ApparatusDistillation Apparatus RPERFITS Consisting of 1000 ml. erlenmeyer flask and friedrichSs condenser. 2150-00 163 163163163 Distillation Apparatus Ammonia RPERFITS Consisting of 500 ml. kjeldhal flask, splash head and grahm condenser. 1350-00 164 164164164 VVV acuum Dr ying Pistol RPERFITS Consisting of jacketed tube ,desicant flask 100 ml., boiling flask 250 ml., coil condenser, still head and tap adapter. 207207207 5-005-005-00 165 165165165 Alkoxyle and Alk ylimino Group Determination Apparatus RPERFITS Micro Zeisel. 1475-00 166166166 Micro Acetyl Group DeterminationMicro Acetyl Group Determination Apparatus RPERFITS 166 [Wiesenberger]. 111 475475475 -00-00-00 167167167 Mercur y Distillation Assemblyy Distillation Assembly RPERFITS Consisting of distillation flask 500 ml, stopcock controlled air bleeding tube, air condenser 500 mm., liebig condenser 200 mm., vacuum 167 receiver adapter and receiving bottle. 1900-00 168168168 FFF reeze Dr ying Manifoldying Manifold RPERFITS . 2250-00 168 169169169 Cavett Blood T est Apparatusest Apparatus RPERFITS . 550-00 170170170 KKK ozelka and Hine Blood T est Apparatus RPERFITS 1925-00 172172172 Cyanide Distillation Apparatus Q PERFITS 2950-00 169 173 Assembly of Apparatus for the Determination of Mancozeb Content QPERFITR IS 8707 : 1978 4750-00 40 170 UTILITY SETS RPERFITS Utility Sets 180180180 Semi Mic ro B 10 Joint S ets etsets RPERFITS Consisting of 22 Parts, similar to Q.F. 10 B.U. 2595 -00-00-00 181181181 Semi Micro B 10 Joint SetsSemi Micro B 10 Joint Sets RPERFITS Consisting of 20 parts similar to Q.F. 12 B.U. 2150-00 182182182 Organic B 14 Joint SetsOrganic B 14 Joint Sets RPERFITS Consisting of 5 Parts, similar to Q.F. 29 B.U. 700-00 183183183 Organic B 14 Joint SetsOrganic B 14 Joint Sets RPERFITS Consisting of 9 parts, similar to Q.F. 27 B.U. 1125-00 184184184 Organic B 14 Joint SetsOrganic B 14 Joint Sets RPERFITS Consisting of 17 parts, similar to Q.F. 23 BU. 1595-00 185185185 Organic B 19 Joint SetsOrganic B 19 Joint Sets RPERFITS Consisting of 11 parts, 180-192 similar to Q.F. 46 BU. 1925-00 186186186 Organic B 19 Joint SetsOrganic B 19 Joint Sets RPERFITS Consisting of 22 Parts, similar to Q.F. 42 BU. 3500-00 187187187 Organic Multi Joint SetsOrganic Multi Joint Sets RPERFITS Consisting of 16 parts, similar to Q.F. 34 BU. 2225-00 188188188 Organic Multi Joint SetsOrganic Multi Joint Sets RPERFITS Consisting of 26 parts, similar Q.F. 33 BU. 4475-00 189189189 Organic Multi Joint SetsOrganic Multi Joint Sets RPERFITS Consisting of 46 parts, similar to Q.F. 32 BU. 9995-00 190190190 Organic Multi Joint SetsOrganic Multi Joint Sets RPERFITS Consisting of 101 parts, similar to Q.F. 30 BU. 21750-00 191191191 General Utility SetsGeneral Utility Sets RPERFITS Consisting of 19 parts, similar to Q.F. 2 BU. 3100 -00-00-00 41 WATER DISTILLATION (ALL GLASS) RPERFITS W ater Distillation 202202202 Automatic Electrically Heated All Glass Distillation Apparatus RPERFITS Heater embedded in spiral glass tube complete with metallic stand, rod, clamps, plug and board etc. Catalogue Flask Description PPP rice/Piece N o . Capacity of Distillation Rs. P ... 202/01 3 Litre Single Distillation without cut off 11500-00 202/02 3 Litre Double Distillation without cut off 23000-00 202/03 3 Litre Tripple Distillation without cut off 34500-00 202/04 5 Litre Single Distillation without cut off 12500-00 202/05 5 Litre Double Distillation without cut off 25000-00 202/06 5 Litre Tripple Distillation without cut off 37500-00 202/07 10 Litre Single Distillation without cut off 17500-00 202/08 10 Litre Double Distillation without cut off 35000-00 202/09 10 Litre Tripple Distillation without cut off 52500-00 202 202/11 Automatic cut off device with electrode for Single Distillation. 4250-00 202/12 Automatic cut off device with electrode for Double Distillation. 4750-00 202/13 Automatic cut off device with electrode for Tripple Distillation. 5250-00 202A RRR eplacement P arts of W ater Distillation 202A/15 Flask with Heater Cap. 3 Litre. 5600-00 202A/16 Flask with Heater Cap. 5 Litre. 6750-00 202A/17 Flask with Heater Cap. 10 Litre. 11950-00 202A/18 Condenser for 3 Litre Distillation with B 40 Cone. 2250-00 202A/19 Condenser for 5 Litre Distillation with B 40 Cone. 2250-00 202A/20 Condenser for 10 Litre Distillation with B 50 Cone. 2550-00 202A/21 Constant Level Cup for Distillation. 250-00 202A/22 Receiver Adapter for Distillation. 175-00 202A/23 Connecting Adapter for Distillation ... 175-00 202A/24 Stand for Single Distillation for 3, 5 or 10 Litre Flask. 3500-00 202A/25 Stand for Double Distillation for 3,5 or 10 Litre Flask. 7000-00 202A/26 Water Softener for above Distillatons. 16500-00 42 WATER STILL (HORIZONTAL TYPE) 'PERFITS W W W ater Still 205205205 WWW ater Stillater Still QPERFITR Water stills are carefully designed to produce high purity pyrogen free distilled water. The water still made of Borosilicate glass comprises of horizontal type boiler, coil condenser, constant level device, silica sheathed (Quartz) heaters along with stand and clamps. All parts are replaceable. Output about 2litres/hour. Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 205/01 Single still without cutoff. 10950-00 205/02 Double still without cutoff. 21900-00 205/03 Automatic cutoff device for singe still. 4250-00 205 205/04 Automatic cutoff device for double still. 4750-00 205A RRR eplacement parts of W ater Still Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 205A/06 Boiling Chamber Horizontal Type. 2450-00 205A/07 Condenser for Water Still. 1975-00 205A/08 Constant Level Device. 350-00 205A/09 Receiver Adapter. 175-00 205A/10 Silica Sheathed (Quartz) Heater. 3750-00 205A/11 Water Softner Suitable for Above. 16500-00 206206206 WWW ater Still QPERFITR Water stills are carefully designed to produce hig h purity pyrogen free distilled water. The water still made of Borosilicate glass comprises of horizontal type boiller, coil condenser, constant level device, silica sheathed (Quartz) heaters along with stand and clamps. All parts are replaceable Output about 4litres/hour. Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 206/01 Single still with safety cutoff power rating 3kw. 24750-00 206/02 Double still with safety cutoff power rating 6kw. 49500-00 RRR eplacement P arts 206/04 Constant Level Device 750-00 206/05 Boiling Chamber for 4ltr./hr. still 5250-00 206/06 Coil Condenser for 4ltr./hr. still 3950-00 206/07 Silica Sheathed (Quartz) Heater 4500-00 206/08 Automatic Thermal Sensor Cut off for single water still 5250-00 206/09 Automatic Thermal Sensor Cut off for double water still 5750-00 206/10 Water Softener for above stills 16500-00 43 QUARTZ DISTILLATION RPERFIT' Water Distillation Apparatus (Quartz) 208208208 WWW ater Distillation Unitater Distillation Unit RPERFITS QUARTZ Boiler with inbuilt heater and borosil glass condenser, complete with stand, clamp etc. Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 208/02208/02 Output Approx. 2.5 Ltr./hr. with Auto thermal sensor cutoff. 42000-00 208/04208/04 Output Approx. 5.0 Ltr./hr. with Auto thermal sensor cutoff. 69750-00 208/06 208/06 Output Approx 10.0Ltr./hr. with Auto thermal sensor cutoff 119000-00 208 A WWW ater Distillation Unitater Distillation Unit RPERFITS QUARTZ Boiler with inbuilt heater and quartz glass condenser, complete with stand, clamp etc. Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 208A/02208A/02 Output Approx. 2.5 Ltr./hr. with Auto thermal sensor cutoff. 64000-00 208 208A/04208A/04 Output Approx. 5.0 Ltr./hr. with Auto thermal sensor cutoff. 116000-00 R eplacement P arts 208A/11 208A/11 Quartz Boiler for 2.5 Ltr./hr unit 32250-00 208A/12208A/12 Quartz Boiler for 5.0 Ltr./hr unit 52750-00 208A/13208A/13 Quartz Boiler for 10.0 Ltr./hr unit 107250-00 208A/14 Quartz Condenser for 2.5 Ltr./hr unit 32250-00 208A/15 Quartz Condenser for 5.0 Ltr./hr unit 52750-00 208A/16 Borosilicate Condenser for 2.5 Ltr./hr unit 6250-00 208A/17 Borosilicate Condenser for 5.0 Ltr./hr unit 8500-00 208A/18 Borosilicate Condenser for 10.0 Ltr./hr unit 21250-00 209209209 All All All QUQUQU ARTZ Double Distillation Unit RPERFITS QUARTZ Boiler with inbuilt heater and quartz condenser, complete with stand, clamp etc. Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 209/02209/02 Output Approx. 1.5 Ltr./hr. with Auto thermal sensor cutoff. 139000-00 209/04209/04 Output Approx. 2.5 Ltr./hr. with Auto thermal senser cutoff. 174000-00 209/06209/06 Output Approx. 5.0 Ltr./hr. with Auto thermal senser cutoff. 326500-00 44 ESSENTIAL OIL & MOSITURE DETERMINATION APPARATUS RPERFIT' Essential Oil Determination Apparatus 210210210 Essential Oil Determination Appara tus (Clevenger T ype)ype) RPERFITS Vertical tube combined with condenser and measuring tube with stopcock. A return tube for the aqeous part of the distillate connects the bottom of the measuring tube and the vertical tube. Catalogue Flask Capacity PPP rice/Piece No.No.No. ml.ml.ml. Rs. P ... 210 210/01 1000 2050-00 210/02 2000 2400-00 210/03 3000 4250-00 210/04 5000 5750-00 210/05 10000 10750-00 210/06 20000 18500-00 211211211 Clevenger Apparatus RPERFITS For determination of volatile oil lighter than water, comprising of 1000 ml. flask, oil seperatory tube and condenser. 1750-00 212212212 Clevenger ApparatusClevenger Apparatus RPERFITS For determination of volatile oil heavier than water, comprising of 1000 ml. flask, oil seperatory 211 tube and condenser. 1750-00 RPERFITS Moisture Deter mination Apparatus 215215215 Moisture Determination Apparatus RPERFITS Dean and Stark with glass key stopcock. Catalouge Cap. of R eceiver Cap. of R.B. PPP rice/Piece No.No.No. with Stopcock Flask Rs. P ... ml.ml.ml. ml.ml.ml. 212 215/01 2 250 1175-00 215/02 5 500 1325-00 215/03 10 1000 1525-00 215/04 25 1000 1575-00 215A Moisture Determination Apparatus RPERFITS Dean and Stark with screw type PTFE key rotaflow stopcock. Catalogue Cap. of R eceiver Cap. of R.B. PPP rice/Piece No.No.No. with Stopcock Flask Rs. P ... ml.ml.ml. ml.ml.ml. 215A/01 2 250 1250-00 215A/02 5 500 1375-00 215 215A/03 10 1000 1600-00 45 215A/04 25 1000 1650-00 MOISTURE DETERMINATION APPARATUS 216216216 Moisture Determination Apparatus RPERFITS Dean and Stark without stopcock. Catalogue Cap. of R eceiver Cap. of R.B. PPP rice/Piece No.No.No. without Stopcock Flask Rs. P ... ml.ml.ml. ml.ml.ml. 216/01 2 250 1025-00 216/02 5 500 1125-00 216/03 10 1000 1250-00 216/04 25 1000 1425-00 216 217217217 Spare R eceiver RPERFITS For Dean and Stark with stopcock. Catalogue Cap. of P P P rice/Piece No.No.No. RRR eceiver Rs. P ... ml.ml.ml. 217/01 2 675-00 217/02 5 675-00 675-00 217 217/03 10 675-00 217/04 25 700-00 217/05 50 1250-00 218218218 Spare R eceiver RPERFITS For Dean and Stark without stopcock. Catalogue Cap. of P P P rice/Piece No.No.No. RRR eceiver Rs. P ... ml.ml.ml. 218 218/01 2 575-00 218/02 5 575-00 218/03 10 575-00 218/04 25 600-00 219219219 Soil Soil Moisture Gauge Moisture Gauge RPERFITS For rapid determination of soil moisture content. The device takes less than 5 minutes, simple, inexpensive, suitable for field use. Highly useful in irrigation and compation control programmes. 1075-00 220220220 Spare R eceiver RPERFITS For Dean and Stark with (PTFE) Teflon Key Stopcock. 219 Catalogue Cap. of P P P rice/Piece No.No.No. RRR eceiver ml. Rs. P ... 220/00 5 825-00 220/01 10 895-00 220/02 25 975-00 220/03 50 1425-00 46 220/04 100 1650-00 NITROGEN DETERMINATION APPARATUS RPERFITS Nitrogen D etermination Apparatus 224224224 Micro Kjeldahl Nitrogen Distillation Apparatus (P reglSs) RPERFITS comprising of steam generation flask, steam trap, vacuum jacketed flask with funnel, condenser tube of silver and receiving flask, complete with stand and clamps, but without burner. Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 224/01 -do - With 1000 ml. steam generating flask. 11250-00 224/02 -do - With 2000 ml. steam generating flask. 11750-00 224/03 -do - With glass tube condenser and 1000 ml. 224 steam generating flask. 7250-00 224/04 - do - With glass tube condenser and 2000 ml. steam generating flask. 7850-00 224A Spare silver tube condenser for Cat. No. 224/01 and 224/02. 575575575 0-00 224B Spare vacuum jacketed flask for Cat. No. 224. 1075-00 225225225 Markham Semi Micro Distillation Apparatus RPERFITS Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 225A Comprising of markham still body with enclosed 225 evaporator vessel in a combined steam jacket and trap,funnel plug, condenser and spherical joint clip. 2250-00 225B Comprising of markham still body with enclosed evaporator vessel in a combined steam jacket and trap, funnel plug, condenser with conical joint. 1725-00 226226226 Nitrogen Distillation Apparatus Micro (K emmemmemm eee rer H aaa lletlletllet ttt ) )) RPERFITS Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 226/01 Double stage for distillation of two samples. 5750-00 226/02 Single stage for distillation of one sample. 4400-00 226 47 NITROGEN DETERMINATION APPARATUS 227 Semi Micro Kjeldahl ApparatusSemi Micro Kjeldahl Apparatus RPERFITS Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 227A Comprising of 50 ml. flask, distillation head with funnel, plug and condenser with spherical joints. 1375-00 227B Comprising of 100 ml. flask, distillation head with funnel, plug and condenser with spherical joints. 1400-00 227C Comprising of 50 ml. flask, distillation head with funnel, plug and condenser with conical joints. 1125-00 227D Comprising of 100 ml. flask, distillation head with funnel, 227 plug and condenser with conical joints. 1150-00 228228228 Kjeldahl Absorption T rapsraps RPERFITS Catalogue Description PPP rice/Piece No.No.No. Rs. P ... 228A Comprising of Kjeldahl flask 500 ml., lower chamber 250 ml. and upper chamber with sintered disc. 1750-00 228B Comprising of Kjeldahl flask 500 ml., lower chamber 250 ml. and upper chamber without sintered disc. 1475-00 228 48 EXTRACTION APPARATUS QPERFITR Extraction Apparatus 235235235 Soxhlet Extrac tion tion Apparatus Apparatus RPERFITS Consisting of flask, extractor and condenser. Catalogue Extractor Extractor Extractor Flask PPP rice/Piece No.No.No. Capacity Socket Cone Capacity Rs. P ... ml.ml.ml. ml.ml.ml. 235/01 20 B 24 B 19 50 825-00 235/02 40 B 29 B 24 100 875-00 235/03 60 B 34 B 24 100 900-00 235/04 60 B 34 B 24 150 925-00 235/05 100 B 34 B 24 250 975-00 235/06 100 B 40 B 24 250 1050-00 235/07 200 B 50 B 24 500 1425-00 235/08 400 B 50 B 24 1000 2300-00 235/09 600 B 50 B 24 2000 2550-00 235/10 1000 B 55 B 34 3000 4325-00 235/11 2000 B 55 B 34 5000 8950-00 235/13 3000 B 55 B 34 10000 13250-00 235 236236236 Spare Extractor Spare Extractor RPERFITS For soxhlet apparatus. Catalogue Capacity Socket Cone PPP rice/Piece No.No.No. ml.ml.ml. SizeSizeSize SizeSizeSize Rs. P ... 236/01 20 B 24 B 19 325-00 236/02 40 B 29 B 24 390-00 236/03 60 B 34 B 24 440-00 236/04 100 B 34 B 24 460-00 236/05 100 B 40 B 24 500-00 236/06 200 B 50 B 24 720-00 236/07 400 B 50 B 24 1100-00 236/08 600 B 50 B 24 1375-00 236/09 1000 B 55 B 34 1750-00 236/10 2000 B 55 B 34 5325-00 236/12 3000 B 55 B 34 6075-00 Note : F or Spare Condenser R efefef . Cat. No. 67 and for Spare Flasks R efefef .Cat.No. 76. 237237237 Soxhlet Extraction Apparatus RPERFITS Consisting of R. B. Flask, 237 extractor with flat flange, reduction adapter with flat flange and double surface condenser. Catalogue Extractor Cap. Flasks Cap. PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. Rs. P ... 237/01 600 2000 7750-00 237/02 1000 3000 9950-00 237/03 2000 5000 11950-00 237/04 3000 10000 16450-00 238238238 Soxhlet Soxhlet Extraction Apparatus Extraction Apparatus RPERFITS Consisting of R.B. Flask, globular type extractor and double surface condenser. Catalogue Extractor Cap. Flasks Cap. Price/Piece No.No.No. m l ..ml m l ..ml Rs. P ... 238 238/01 1000 2000 5950-00 238/02 2000 3000 9650-00 238/03 3000 5000 12500-00 238/04 4000 10000 17950-00 238/05 6000 10000 2695 0-00 49 BURETTES RPERFITS Burettes 250250250 Burettes with Straight Bore Glass Key Stopcock RPERFITS Accuracy as per class RBS of I.S. 1997 : 2008,ISO 385:2005. Catalogue Capacity Sub-Div. Tolerance Price/Piece No.No.No. m l ..ml m l . / ml. Rs. P. 250/01 1 0.01 0.01 280-00 250/02 2 0.02 0.02 280-00 250/03 2 0.01 0.02 280-00 250/04 5 0.02 0.02 280-00 250/05 5 0.05 0.02 280-00 250/06 10 0.02 0.05 325-00 250/07 10 0.05 0.05 280-00 250/08 25 0.10 0.10 240-00 250/09 25 0.05 0.10 280-00 250/10 50 0.10 0.10 255-00 250/11 100 0.20 0.20 300-00 (Burettes 1 ml. to 10 ml. with Cup Top) 251251251 Burettes with Straight Bore Glass K ey ey Stopcock Stopcock RPERFITS Accuracy as per class RAS of 1997 : 2008, ISO 385:2005, with works certificate. 250/251 Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. m l . / ml. Rs. P ... 251/01 1 0.01 0.006 585-00 251/02 2 0.02 0.010 585-00 251/03 5 0.02 0.010 595-00 251/04 10 0.05 0.020 605-00 251/05 25 0.05 0.050 595-00 251/06 50 0.10 0.050 555-00 251/07 100 0.20 0.100 575-00 (Burettes 1ml. to 10 ml. with Cup T op)op)op) 252252252 Burettes with Pinch Cock and Nozzle and Nozzle RPERFITS Accuracy as per class RBSof I.S. 1997 : 2008. ISO 385:2005. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece 252 No.No.No. m l ..ml m l ..ml / ml. Rs. P ... 252/01 10 0.05 0.05 165-00 252/02 25 0.10 0.10 150-00 252/03 50 0.10 0.10 160-00 50 252/04 100 0.20 0.20 165-00 BURETTES 253253253 Burettes with Screw T ype R otaflow Stopcock with PTFE (T eflon) KKK ey ey ey RPERFITS Accuracy as per class RBS of I.S. 1997 : 2008 . Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. m l ..ml m l . / ml. Rs. P ... 253/01 1 0.01 0.01 280-00 253/02 2 0.02 0.02 280-00 253/03 5 0.02 0.02 280-00 253/04 10 0.05 0.05 280-00 253/05 25 0.10 0.10 245-00 253/06 50 0.10 0.10 255-00 253/07 100 0.20 0.20 300-00 (Burettes 1ml. to 10 ml. with Cup T op)op)op) 254254254 Burettes with Screw T ype R otaflow Stopcock with PTFE (T eflon) K eyeyey RPERFITS Accuracy as per class RAS of I.S. 1997:2008 with works certificate. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece 253 No.No.No. m l . m l ..ml / ml. Rs. P ... 254 254/01 1 0.01 0.006 585-00 254/02 2 0.02 0.010 585-00 254/03 5 0.02 0.010 595-00 254/04 10 0.05 0.020 605-00 254/05 25 0.05 0.050 595-00 254/06 50 0.10 0.050 555-00 254/07 100 0.20 0.100 575-00 (Burettes 1ml. to 10 ml. with Cup T op)op)op) 255255255 Burettes wit h Straight B ore PTFE (T(T (T eflon) K ey Stopcock RPERFITS Accuracy as per class RBS of I.S. 1997 : 2008. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. m l ..ml m l . / ml. Rs.PRs.PRs.P ... 255/01 1 0.01 0.01 500-00 255/02 2 0.02 0.02 500-00 255/03 5 0.02 0.02 500-00 255/256 255/04 10 0.05 0.05 500-00 255/05 25 0.10 0.10 425-00 255/06 50 0.10 0.10 465-00 255/07 100 0.20 0.20 550-00 51 (Burettes 1ml. to 10 ml. with Cup T op)opop BURETTES 256256256 Burettes, with Straight Bore PTFE (T eflon) K ey Stopcock ey Stopcock RPERFITS Accuracy as per class RAS of I.S. 1997 : 2008, with works certificate. Catalogue Capacity Sub-Div ... TTT olerance PPP rice/Piece No.No.No. m l ..ml ml.ml.ml. / / / mmm l.l.l. Rs. P ... 256/01 1 0.01 0.006 800-00 256/02 2 0.02 0.010 800-00 256/03 5 0.02 0.010 800-00 256/04 10 0.05 0.020 800-00 256/05 25 0.05 0.050 810-00 256/06 50 0.10 0.050 775-00 256/07 100 0.20 0.100 815-00 (Burettes 1ml. to 10 ml. with Cup T op)op)op) 257257257 Burettes, Double Oblique Bore Glass K ey Stopcock, 3-way , ,, RPERFITS Accuracy as per class RBS of I.S. 1997 : 2008. Catalogue Capacity Sub-Div ... TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs.PRs.PRs.P ... 257/01 10 0.05 0.05 375-00 257/02 25 0.10 0.10 355-00 257/03 50 0.10 0.10 375-00 257/258 257/04 100 0.20 0.20 425-00 258258258 Burettes, Double Oblique Bore Glass K ey Stopcock, 3-way , , , QPERFITR Accuracy as per class RAS of I.S. 1997 : 2008,with works certificate. Catalogue Capacity Sub-Div ... TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 258/01 10 0.02 0.02 675-00 258/02 25 0.05 0.05 625-00 258/03 50 0.10 0.05 655-00 258/04 100 0.20 0.10 710-00 259 259259259 Buret tes Double Oblique Bore Screw T ype R otaflow Stopcock withwithwith PTFE (T(T(T eflon) K ey eyey RPERFITS Accuracy as per class RBS of I.S. 1997 : 2008. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 259/01 10 0.05 0.05 550-00 259/02 25 0.10 0.10 515-00 259/03 50 0.10 0.10 550-00 259/04 100 0.20 0.20 625-00 52 BURETTES 260260260 Burettes ,,, Double Oblique Bore Screw T ype R otaflow Stopcock withwithwith PTFE (T(T(T eflon) K ey eyey RPERFITS Accuracy as per class RAS of I.S. 1997 : 2008, with works certificate. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 260/01 10 0.05 0.02 825-00 260/02 25 0.05 0.05 800-00 260/03 50 0.10 0.05 825-00 260 260/04 100 0.20 0.10 875-00 261261261 Burettes ,,, Double Oblique Bore PTFE (T eflon) K ey Stopcock ,,, 3-way ,,, RPERFITS Accuracy as per class RAS of I.S. 1997 : 2008, with works certificate. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 261/01 10 0.05 0.02 1125-00 261/02 25 0.05 0.05 1125-00 261/03 50 0.10 0.05 1150-00 261/04 100 0.20 0.10 1175-00 262262262 Burettes, Over flow Cup, Automatic Zero, Double Oblique Bore Glass K eyeyey RPERFITS Stopcock, 3-way , ,, Accuracy as per class RBS of I.S. 1997 : 2008. 261 Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 262/01 10 0.05 0.05 600-00 262/02 25 0.10 0.10 600-00 262/03 50 0.10 0.10 650-00 262/04 100 0.20 0.20 700-00 263263263 Burettes, Over flow Cup, Automatic Zero, Double Oblique Bore Glass K ey Stopcock, 3-way , ,, RPERFITS Accuracy as per class RAS of I.S. 1997 : 2008, with works certificate. Catalogue Capacity Sub-Div TT olerance PP rice/Piece Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece 262/263 No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 263/01 10 0.05 0.02 970-00 263/02 25 0.05 0.05 970-00 263/03 50 0.10 0.05 1000-00 263/04 100 0.20 0.10 1065-00 264264264 Burettes, Over flow Cup, Automatic Zero, Double Oblique Bore Screw T ypeypeype RRR otaflow Stopcock with PTFE (T eflon)K eyeyey , 3-way , , , QPERFITS Accuracy as per class RBS of I.S.1997 : 2008. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 264/01 10 0.05 0.05 765-00 264/02 25 0.10 0.10 765-00 264/03 50 0.10 0.10 795-00 264/04 100 0.20 0.20 865-00 53 264/265 BURETTES 265265265 Burettes, Over flow Cup, Automatic Zero, Double Oblique Bore Screw TTT ype R otaflow Stopcock with PTFE (T eflon) K eyeyey , 3-way , , , RPERFITS Accuracy as per class RAS of I.S. 1997 : 2008, with works certificate. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 265/01 10 0.05 0.02 1100-00 265/02 25 0.05 0.05 1100-00 265/03 50 0.10 0.05 1125-00 265/04 100 0.20 0.10 1215-00 266266266 Burettes, Over flow Cup, Automatic Zero, Double Oblique Bore PTFE (T(T(T eflon) K ey Stopcock, 3-way , , , RPERFITS Accuracy as per class RAS of I.S. 1997 : 2008, with works certificate. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 266/01 10 0.05 0.02 1365-00 266/02 25 0.05 0.05 1365-00 266 266/03 50 0.10 0.05 1390-00 266/04 100 0.20 0.10 1425-00 267267267 Burettes, Micro, Automatic Filling Device with R eser voir voirvoir RPERFITS Accuracy as per class RBS of I.S. 1997 : 2008. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 267/01 1 0.01 0.01 1025-00 267/02 2 0.02 0.02 1025-00 267/03 5 0.02 0.02 1025-00 267/04 10 0.05 0.05 1025-00 267 268268268 Burettes Automatic Zero, Mounted on R eser voirvoirvoir , with Glass K ey Stopcock, RRR ubber Belowubber Below RPERFITS Accuracy as per class RBS of I.S. 1997 : 2008. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 268/01 10 0.05 0.05 3250-00 268/02 25 0.10 0.10 4000-00 268/03 50 0.10 0.10 4075-00 268/04 100 0.20 0.20 4375-00 269269269 Burettes, Automatic Zero, Mounted on R eser voirvoirvoir , with Glass K ey Stopcock, RRR ubber Belowubber Below RPERFITS Accuracy as per class RAS of 1997 : 2008, with works certificate ... Catalogu eee Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 269/01 10 0.05 0.02 3500-00 268/269 269/02 25 0.10 0.05 4275-00 54 269/03 50 0.10 0.05 4375-00 269/04 100 0.20 0.10 4675-00 BURETTES 270270270 Burettes, Automatic Zero, Mounted on R eser voirvoirvoir , with ScrewT ypeypeype RRR otaflow Stopcock with PTFE (T eflon) K eyeyey , RR, ubber Bellow RPERFITS Accuracy as per class RB of I.S. 1997 : 2008. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 270/01 10 0.05 0.05 3250-00 270/02 25 0.10 0.10 3975-00 270/03 50 0.10 0.10 4075-00 270/04 100 0.20 0.20 4375-00 271271271 Burettes Automatic Zero, Mounted on R eser voirvoirvoir , with Screw 270/271 TTT ype R otaflow Stopcock with PTFE (T eflon) K eyeyey , RR, ubber Bellow RPERFITS Accuracy as per class RAS of I.S. 1997 : 2008, with works cer tificate. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No.No.No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 271/01 10 0.05 0.02 3500-00 271/02 25 0.10 0.05 4275-00 271/03 50 0.10 0.05 4375-00 271/04 100 0.20 0.10 4675-00 272272272 Burettes, Automatic Zero, Mounted on R eser voir , with PTFE (T(T(T eflon) K ey Stopcock, R ubber ubber Bellow Bellow RPERFITS Accuracy as per class RAS of I.S. 1997 : 2008 with works certificate. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 272/01 10 0.05 0.02 3725-00 272/02 25 0.10 0.05 4475-00 272 272/03 50 0.10 0.05 4575-00 272/04 100 0.20 0.10 4875-00 273273273 Automatic Burettes for K arl Fischer Apparatus without R eser voirvoirvoir ,,, with Glass K ey ey ey Stopcock RPERFITS Accuracy as per Class "A" of 1997:2008, 1997:2008, with works certificate suitable for 500ml. reservoir. Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No. ml.ml.ml. ml.ml.ml. / ml. Rs. P ... 273/01 10 0.05 0.02 3250-00 273/02 25 0.10 0.05 3750-00 Note : R eser voir Capacity for Automatic Burettes is 2 Litre for 25 ml. & 50 ml.Burettes and 1 Litre for 10 ml. Burette. 275275275 Spare R ubber Below ubber Below with net for automatic burette. 325-00 55 All Quartz Glass Single Distillation Apparatus “PERFIT” All Quartz Glass Double Distillation Apparatus “PERFIT” 56 PIPETTES QPERFITR Pipettes 2 8 0 Pipettes T ransfer , VV, olumetric RPERFITS With one mark. Accuracy as per class RBS of I.S. 1117 : 1975. Catalogue Capacity TTT olerance PPP rice/Piece No. m l ..ml / ml. Rs. P ... 280/01 1 0.015 7 5 - 0 0 280/02 2 0.020 7 5 - 0 0 280/03 3 0.030 7 5 - 0 0 280/04 4 0.030 7 5 - 0 0 280/05 5 0.030 7 5 - 0 0 280/06 10 0.040 8 0 - 0 0 280/07 15 0.040 8 5 - 0 0 280/08 20 0.060 9 0 - 0 0 280/09 25 0.060 9 0 - 0 0 280/10 50 0.100 135-00 280/11 100 0.160 185-00 2 8 1 Pipettes, T ransfer , VV, olumetric RPERFITS With one mark. Accuracy as 280 /281 per class RAS of I.S. 1117 :1975, with works certificate. Catalogue Capacity TTT olerance PPP rice/Piece No. m l ..ml / ml. Rs. P ... 281/01 1 0.006 130-00 281/02 2 0.010 130-00 281/03 3 0.015 130-00 281/04 4 0.015 130-00 281/05 5 0.015 130-00 281/06 10 0.020 135-00 281/07 15 0.025 160-00 281/08 20 0.030 160-00 281/09 25 0.030 165-00 281/10 50 0.050 215-00 281/11 100 0.080 295-00 2 8 2 Pipettes, Measuring Graduated, Mohr T ype RPERFITS Accuracy as per class RBS of I.S. 835:2007 (These pipettes are graduated for delivery from zero mark at top to the last graduation mark). 282 Catalogue Capacity Sub-Div TTT olerance PPP rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 282/01 0.1 0.01 0.01 95-00 282/02 0.2 0.01 0.01 95-00 57 PIPETTES Catalogue Capacity Sub-Div ... TTT olerance PPP rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 282/03 0.5 0.01 0.01 95-00 282/04 1.0 0.01 0.01 90-00 282/05 1.0 0.10 0.01 90-00 282/06 2.0 0.02 0.02 95-00 282/07 2.0 0.10 0.02 95-00 282/08 5.0 0.05 0.05 95-00 282/09 5.0 0.10 0.05 95-00 282/10 10.0 0.10 0.10 100-00 282/11 20.0 0.20 0.20 110-00 282/12 25.0 0.20 0.20 110-00 2 8 3 Pipettes ,,, Measuring Graduated, Mohr T ype RPERFITS Accuracy as per class RAS of I.S. 835 : 2007, with works certificate (These pipettes are graduated for delivery from zero mark at top to the last graduation mark). Catalogue Capacity Sub-Div ... TTT olerance P rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 283/01 0.1 0.01 0.006 160-00 283/02 0.2 0.01 0.006 160-00 283/03 0.5 0.01 0.006 160-00 283/04 1.0 0.01 0.006 160-00 283/05 1.0 0.10 0.006 160-00 283/06 2.0 0.02 0.010 160-00 283/07 2.0 0.10 0.010 160-00 283/08 5.0 0.05 0.030 160-00 283/09 5.0 0.10 0.050 160-00 283/10 10.0 0.10 0.050 160-00 283/11 20.0 0.20 0.100 225-00 283/12 25.0 0.20 0.100 225-00 2 8 4 Pipettes,Measuring Graduated, Serological RPERFITS Accuracy as per class RBS of I.S. 835 : 2007 (These pipettes are graduated to tip and calibrated to deliver their total capacity when the last drop is blown out) . Catalogue Capacity Sub-Div ... TTT olerance PPP rice/Piece No. ml. ml. / ml. Rs. P. 284/01 0.1 0.01 0.01 9 5 - 0 0 284/02 0.2 0.01 0.01 95-00 284/03 0.5 0.01 0.01 9 5 - 0 0 284/04 1.0 0.01 0.01 9 0 - 0 0 284/05 1.0 0.10 0.01 9 0 - 0 0 284/06 2.0 0.02 0.02 9 5 - 0 0 284/07 2.0 0.10 0.02 9 5 - 0 0 284/08 5.0 0.05 0.05 9 5 - 0 0 284/09 5.0 0.10 0.05 9 5 - 0 0 284/10 10.0 0.10 0.10 100-00 284/11 20.0 0.20 0.20 110-00 58 284/12 25.0 0.20 0.20 110-00 PIPETTES 2 8 5 Pipettes, Measuring Graduated, Serological RPERFITS Accuracy as per class RAS of I.S. 835 : 2007, with works certificate (These pipettes are graduated to tip and calibrated to deliver their total capacity when the last drop is blown out). 285 Catalogue Capacity Sub-Div TTT olerance Price/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 285/01 0.1 0.01 0.006 160-00 285/02 0.2 0.01 0.006 160-00 285/03 0.5 0.01 0.006 160-00 285/04 1.0 0.01 0.006 160-00 285/05 1.0 0.10 0.006 160-00 285/06 2.0 0.02 0.010 160-00 285/07 2.0 0.10 0.010 160-00 285/08 5.0 0.05 0.030 160-00 285/09 5.0 0.10 0.050 160-00 285/10 10.0 0.10 0.050 160-00 285/11 20.0 0.20 0.100 225-00 285/12 25.0 0.20 0.100 225-00 2 8 7 Automatic Pipettes RPERFITS With overflow cup. 286 Catalogue Capacity Price/Piece No. m l ..ml Rs. P ... 287/01 5 PPP .O.O.O .R..R..R. 287/02 10 PPP .O.O.O .R..R..R. 287/03 20 PPP .O.O.O .R..R..R. 287/04 25 PPP .O.O.O .R..R..R. 287/05 50 PPP .O.O.O .R..R..R. 287/06 100 PPP .O.O.O .R..R..R. 2 8 8 Pipette, Artificial Insemination, Cattle, Taper Tip, Neutral Hard Glass, 450mm. long. 55-00 287 2 8 9 Pipette, P asteur ,,, Disposable, Neutral hard glass. 289/01 Length 145mm. 7-75 289/02 Length 230mm. 9-75 288 289 59 DIGITAL AUTOMATIC MICRO PIPETTES Digital Automatic Micro Pipettes 2 9 0 Digital V ariable V olume Micropipette This pipette has stream lined tip ejector and having adjustment of volume by turning the plunger with two step operation. Catalogue Capacity Steps P rice/Piece No. 3l. 3l. Rs. P ... 290/01 0.5 -10 0.1 4175-00 290/02 5-50 1.0 4175-00 290/03 20-200 1.0 4175-00 290/04 100-1000 10.0 4175-00 290/05 2-20 1.0 4175-00 290/06 10-100 1.0 4175-00 290/291 2 9 1 Digital Fixed V olume Micropipette. Catalogue Capacity PPP rice/Piece No. ml.ml.ml. Rs. P ... 291/01 5 2575-00 291/02 10 2575-00 291/03 20 2575-00 291/04 25 2575-00 291/05 50 2575-00 291/06 100 2575-00 291/07 200 2575-00 291/08 500 2575-00 291/09 1000 2575-00 2 9 2 Digital Multi Channel (Eight) Micropipette This Pipette has stream lined tip ejector and the volume can be adjust by turning the plunger with two step operations. Catalogue Capacity PPP rice/P ackackack No. 3l.3l.3l. Rs. P ... 292/01 5 - 5 0 PPP .O.O.O .R..R..R. 292/02 20-100 PPP .O.O.O .R..R..R. 292/03 40-200 PPP .O.O.O .R..R..R. 2 9 3 Tips for Micropipette (P ack of 1000). Catalogue Capacity PPP rice/P ackackack No. 3l.3l.3l. Rs. P ... 293/01 Yellow Tip (0 -200) 795-00 293/02 Blue Tip (200 - 1000) 995-00 293 2 9 4 Pipette Sterilizing Box Made of S.S. 1750-00 60 MEASURING CYLINDERS RPERFITS Measuring Cylinders 2 9 5 Measuring Cylinders Graduated R PERFITS With spout, pour out. Accuracy as per class RBS of I.S. 878 : 2008, ISO 4788 : 2005. Catalogue Capacity Sub-Div. Tolerance Price/Piece No. m l ..ml m l ..ml / ml. Rs. P. 295/01 5 0.1 0.1 105-00 295/02 10 0.2 0.2 110-00 295/03 25 0.5 0.5 145-00 295/04 50 1.0 1.0 165-00 295/05 100 1.0 1.0 200-00 295/06 250 2.0 2.0 390-00 295/07 500 5.0 5.0 560-00 295/08 1000 10.0 10.0 900-00 295/09 2000 20.0 20.0 1575-00 295/ 296 2 9 6 Measuring Cylinders Graduated RPERFITS With spout, pour out. Accuracy as per class RAS of I.S. 878 : 2008, ISO 4788:2005, with works certificate. Catalogue Capacity Sub-Div. Tolerance Price/Piece No. m l ..ml m l ..ml / ml. Rs. P. 296/01 5 0.1 0.05 140-00 296/02 10 0.2 0.10 145-00 296/03 25 0.5 0.25 185-00 296/04 50 1.0 0.50 250-00 296/05 100 1.0 0.50 300-00 296/06 250 2.0 1.00 550-00 296/07 500 5.0 2.50 990-00 296/08 1000 10.0 5.00 1100-00 296/09 2000 20.0 10.00 1750-00 2 9 6 A Measuring Cylinders Graduated RPERFITS With spout, pour out,Hexagonal Base. Accuracy as per class RAS of I.S. 878 : 2008, ISO 4788:2005, with works certificate. Catalogue Capacity Sub-Div. Tolerance Price/Piece No. m l ..ml m l ..ml / ml. Rs. P. 296A/01 5 0.1 0.05 235-00 296A/02 10 0.2 0.10 260-00 296A/03 25 0.5 0.25 285.00 296A/04 50 1.0 0.50 355-00 296A/05 100 1.0 0.50 430-00 61 MEASURING CYLINDERS Catalogue Capacity Sub-Div. Tolerance Price/Piece No. m l ..ml m l ..ml / ml. Rs. P. 296A/06 250 2.0 1.00 655-00 296A/07 500 5.0 2.50 935-00 296A/08 1000 10.0 5.00 1145-00 296A/09 2000 20.0 10.00 1855-00 2 9 6 B Measuring Cylinders Graduated RPERFITS With spout, pour out. Accuracy as per ASTME 1272 Class RAS PUSP(US Pharmacopeia)Q, with works certificate. Catalogue Capacity Sub-Div. Tolerance Price/Piece No. m l ..ml m l ..ml / ml. Rs. P. 296B/01 5 0.1 0.05 275-00 296B/02 10 0.2 0.10 305-00 296B/03 25 0.5 0.17 335-00 296B/04 50 1.0 0.25 415-00 296B/05 100 1.0 0.50 515-00 297/298 296B/06 250 2.0 1.00 775-00 296B/07 500 5 .0 2.00 1100-00 296B/08 1000 10.0 3.00 1365-00 296B/09 2000 20.0 6.00 2185-00 2 9 7 Measuring Cylinders Graduated RPERFITS With interchangeable stopper Accuracy as per class RBS of I.S. 878 : 2008, ISO 4788:2005. Catalogue Capacity Sub-Div. Tolerance Price/Piece No. m l ..ml m l ..ml / ml. Rs. P. 297/01 5 0.1 0.1 145-00 297/02 10 0.2 0.2 150-00 297/03 25 0.5 0.5 200-00 297/04 50 1.0 1.0 240-00 297/05 100 1.0 1.0 300-00 297/06 250 2.0 2.0 500-00 297/07 500 5.0 5.0 775-00 297/08 1000 10.0 10.0 1090-00 297/09 2000 20.0 20.0 1875-00 62 CROW RECEIVER 2 9 8 Measuring Cylinders Graduated RPERFITS With interchangeable stopper Accuracy as per class RAS of I.S. 878 : 2008, ISO 4788:2005, with works certificate. Catalogue Capacity Sub-Div. Tolerance Price/Piece No. m l ..ml m l ..ml /ml. Rs. P 298/01 5 0.1 0.05 205-00 298/02 10 0.2 0.10 210-00 298/03 25 0.5 0.25 250-00 298/04 50 1.0 0.50 300-00 298/05 100 1.0 0.50 355-00 298/06 250 2.0 1.00 640-00 298/07 500 5.0 2.00 1200-00 298/08 1000 10.0 5.00 1360-00 298/09 2000 20.0 10.00 1975-00 2 9 9 Cylinders, Rain Measure RPERFITS Metric scale graduated as per I.S. 4849 : 1992. Catalogue Size Collector Sub-Div. Tolerance Price/Piece No. m m . Area cm. 222 m l ..ml / ml. Rs. P. 299/01 20 Rain 200 0.2 0.05 675-00 299 299/02 20 Rain 100 0.2 0.10 575-00 3 0 0 Crow Receiver RPERFITS Accuracy as per class RBS. Catalogue Capacity Price/Piece No. m l ..ml Rs. P. 300/01 25 240-00 300/02 50 290-00 300/03 100 375-00 300/04 250 540-00 301301301 Crow R eceiver QPERFITR Accuracy as per class RAS, with works certificate. Catalogue Capacity TTT olerance Price/Piece N o . m l . / ml. Rs. P ... 301/01 25 0.04 & 0.1 300-00 301/02 50 0.1 & 0.2 375-00 301/03 100 0.2 & 0.4 465-00 301/04 250 0.4 & 0.6 650-00 300/301 63 NESSLER CYLINDERS 3 0 1 A Crow R eceiver QPERFITR with interchangeable stopper. Accuracy as per class RAS, with works certificate. Catalogue Capacity TTT olerance PPP rice/Piece No. m l ..ml +/- ml. Rs. P ... 301A/01 50 0.1 & 0.2 475-00 301A/02 100 0.2 & 0.4 560-00 301A/03 250 0.4 & 0.6 775-00 3 0 2 Cylinder RPERFITS With single graduation mark at 1000 ml. for sedimentation of sand. 950-00 3 0 3 Nessler Cylinder RPERFITS For colour comparison graduated as per class RBS of I.S. 4161:1967. Catalogue Capacity Sub-Div ... PPP rice/Piece No. m l ..ml m l ..ml Rs. P ... 303/01 50 25 & 50 8 0 - 0 0 303/02 100 50 & 100 115-00 3 0 4 Nessler Cylinder RPERFITS For colour comparison, graduated as per 303/304 class RAS of I.S. 4161 : 1967, with works certificate. Catalogue Capacity Sub-Div ... TTT olerance PPP rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 304/01 50 25 & 50 0.4 130-00 304/02 100 50 & 100 0.8 155-00 64 VOLUMETRIC FLASKS RPERFITS Measuring / Volumetric Flasks 3 0 8 Flask V olumetric QPERFITR With I/C stopper 'A' Grade, Capacity 1ml. to 200ml. With certificate of a NABL Approved Laboratory. 1750-00 3 0 9 Flask V olumetric RPERFITS With I/C stopper 'A' Grade, Capacity 250 ml. to 2000 ml. With certificate of a NABL Approved Laboratory. 2500-00 3 1 0 Flask V olumetric (Measuring) RPERFITS With interchangeable Glass Stopper. Accuracy as per class RBS of I.S. 915 : 2012, ISO 1042:1998. Catalogue Capacity TTT olerance Stopper PPP rice/Piece No. m l ..ml / ml. Size Rs. P ... 310/01 1 0.02 10/15 90-00 310/02 2 0.03 10/15 90-00 310 310/03 5 0.05 10/15 95-00 310/04 10 0.05 10/15 105-00 310/05 20 0.08 10/15 110-00 310/06 25 0.08 10/15 110-00 310/07 50 0.12 10/15 135-00 310/08 100 0.20 14/15 145-00 310/09 200 0.30 14/15 200-00 310/10 250 0.30 14/15 205-00 310/11 500 0.50 19/20 315-00 310/12 1000 0.80 19/20 515-00 310/13 2000 1.20 24/25 1000-00 (1 ml. and 2 ml. Flasks are of T est T ube Shape ) 3 1 1 Flask V olumetric (Measuring) RPERFITS With Screw Cap. Accuracy as per class RBS of I.S. 915 : 2012, ISO 1042 : 1998. Catalogue Capacity TTT olerance PPP rice/Piece No. m l ..ml / ml. Rs. P ... 311/01 1 0.02 90-00 311/02 2 0.03 90-00 311/03 5 0.05 125-00 311/04 10 0.05 125-00 311/05 20 0.08 125-00 311/06 25 0.08 125-00 311 311/07 50 0.12 150-00 311/08 100 0.20 190-00 311/09 200 0.30 250-00 65 VOLUMETRIC FLASKS Catalogue Capacity TTT olerance PPP rice/Piece No. m l ..ml / ml. Rs. P ... 311/10 250 0.30 250-00 311/11 500 0.50 425-00 311/12 1000 0.80 665-00 311/13 2000 1.20 1415-00 ( 1 ml. and 2 ml. Flasks are of T est T ube Shape ) 3 1 2 Flask V olumetric (Measuring) RPERFITS With interchangeable Glass Stopper. Accuracy as per class RAS of I.S. 915 : 2012, ISO 1042:1998 with works certificate. Catalogue Capacity TTT olerance Stopper PPP rice/Piece No. m l ..ml / ml. Size Rs. P ... 312/01 1 0.010 10/15 180-00 312/02 2 0.015 10/15 180-00 312/03 5 0.025 10/15 190-00 312/04 10 0.025 10/15 225-00 312/05 20 0.040 10/15 235-00 312 312/06 25 0.040 10/15 235-00 312/07 50 0.060 10/15 250-00 312/08 100 0.100 14/15 290-00 312/09 200 0.150 14/15 375-00 312/10 250 0.150 14/15 375-00 312/11 500 0.250 19/20 675-00 312/12 1000 0.400 19/20 995-00 312/13 2000 0.600 24/25 1850-00 (1 ml. and 2 ml. Flasks are of T est T ube Shape ) 3 1 2 A Flask V olumetric (Measuring) RPERFITS With interchangeable Glass Stopper. Accuracy as per ASTME 288, Class RAS PUSP(US Pharmacopeia)Q, with works certificate. Catalogue Capacity TTT olerance Stopper PPP rice/Piece No. m l ..ml / ml. Size Rs. P ... 312A/03 5 0.02 10/19 375-00 312A/04 10 0.02 10/19 385-00 312A/06 25 0.03 10/19 365-00 312A/07 50 0.05 10/19 375-00 312A/08 100 0.08 14/23 385-00 66 312A/09 200 0.10 14/23 475-00 VOLUMETRIC FLASKS Catalogue Capacity TTT olerance Stopper PPP rice/Piece No. m l ..ml / ml. Size Rs. P ... 312A/10 250 0.12 14/23 485-00 312A/11 500 0.20 19/26 815-00 312A/12 1000 0.30 19/26 1125-00 (5 ml. and 10 ml. Flasks are of T rapezoidal Shape ) 3 1 3 Flask V olumetric (Measuring) RPERFITS With Screw Cap, Accuracy as per class RAS of I.S. 915 : 2012, ISO 1042:1998, with works certificate. Catalogue Capacity TTT olerance PPP rice/Piece No. m l ..ml / ml. Rs. P ... 313/01 1 0.010 180-00 313/02 2 0.015 180-00 313/03 5 0.025 200-00 313/04 10 0.025 250-00 313/05 20 0.040 250-00 313/06 25 0.040 250-00 313 313/07 50 0.060 275-00 313/08 100 0.100 350-00 313/09 200 0.150 425-00 313/10 250 0.150 425-00 313/11 500 0.250 795-00 313/12 1000 0.400 1175-00 313/13 2000 0.600 2275-00 ( 1 ml. and 2 ml. Flasks are of T est T ube Shape ) 3 1 4 Flask V oluoluolu metric RPERFITS Sugar estimation with two marks without stopper. Accuracy as per class RBS of B.S 675:1953 . Catalogue Capacity PPP rice/Piece 314 No. m l ..ml Rs. P ... 314/01 Lines marked at 50 ml. and 55 ml. 150-00 314/02 Lines marked at 100 ml. and 110 ml. 200-00 314/03 Lines marked at 200 ml. and 220 ml. 240-00 3 1 5 Flask V olumetric RPERFITS Sugar estimation with two marks without stopper. Accuracy as per class RAS of B.S. 675:1953 with works certificate. Catalogue Capacity PPP rice/Piece 315 No. m l ..ml Rs. P ... 315/01 Lines marked at 50 ml. and 55 ml. 250-00 315/02 Lines marked at 100 ml. and 110 ml. 285-00 315/03 Lines marked at 200 ml. and 220 ml. 350-00 67 VOLUMETRIC FLASKS 3 1 6 Kohlrausch Flask (Mud Flask) RPERFITS With cup at top. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 316/01 50 180-00 316/02 100 210-00 316/03 200 300-00 316 3 1 6 A Kohlrausch Flask (Mud Flask) RPERFITS With cup at top. Accuracy as per class RAS, with words certificate. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 316A/01 50 240-00 316A/02 100 300-00 317 316A/03 200 405-00 3 1 7 Saybolt Viscosity Flask RPERFITS Capacity 60 ml. 275-00 3 1 8 Cassia Flask RPERFITS Capacity 100 ml. with graduated long neck. 540540540 -00-00-00 3 1 9 FFF lask Saponification RPERFITS With neck graduated 0 to 10 ml. and figured 0 to 100% for determination of olefin plus aromatic content. 555 777 5-00 318 3 2 0 LeLeLe C hatelier Flask RPERFITS For Sp. Gr. Test, bulb cap. approx. 250 ml. neck graduation from 0 to 1 ml. and 18 to 24 ml. in 0.1 ml., class 'B'. 909090 0-00 3 2 1 Le Chatelier Flask RPERFITS For Sp. Gr. Test, bulb cap. approx. 250 ml. neck graduation from 0 to 1 ml. and 18 to 24 ml. in 0.1 ml., class 'A', with works certificate. 1425-00 319 68 TUBES 'PERFIT' T ubes 3 2 5 TTT ubes Culture Media RPERFITS Round bottom with screw cap and rubber liner. Catalogue Capacity OOO . D. x Length PPP rice/Piece No. m l ..ml m m . Rs. P ... 325/01 5 15 x 75 22-00 325/02 10 15 x 125 24-00 325/03 15 15 x 150 29-00 325/04 20 18 x 150 30-50 325/05 30 25 x 100 34-00 325/06 45 25 x 150 38-00 325/07 60 25 x 200 47-00 325/08 100 32 x 200 105-00 325/09 150 38 x 200 205-00 326 T ubes, Culture, Media RPERFITS Round bottom, with screw cap and PTFE (Teflon) liner. 325/326 Catalogue Capacity OOO .D. x Length PPP rice/Piece No. m l ..ml m m . Rs. P ... 326/01 5 15 x 75 2 9 - 0 0 326/02 10 15 x 125 3 4 - 0 0 326/03 15 15 x 150 3 7 - 0 0 326/04 20 18 x 150 4 1 - 0 0 326/05 30 25 x 100 4 3 - 0 0 326/06 45 25 x 150 4 6 - 0 0 326/07 60 25 x 200 5 4 - 0 0 326/08 100 32 x 200 125-00 326/09 150 32 x 200 230-00 3 2 7 TTT ubes, Culture, Media RPERFITS Flat bottom, with screw cap and rubber liner. Catalogue Capacity OOO . D. X Length PPP rice/Piece No. m l ..ml m m . Rs. P ... 327/328 327/01 5 18 x 45 2 0 - 0 0 327/02 15 25 x 57 2 5 - 5 0 327/03 30 25 x 95 3 3 - 0 0 327/04 40 25 x 145 39-00 69 TUBES 3 2 7 A TTT ubes, Culture, Media RPERFITS Flat bottom, with screw cap and PTFE (Teflon) liner. Catalogue Capacity OOO . D. X Length PPP rice/Piece No. m l ..ml m m . Rs. P ... 327A/01 5 18 x 45 2 7 - 0 0 327A/02 15 25 x 57 3 4 - 0 0 327A/03 30 25 x 95 4 0 - 0 0 327A/04 40 25 x 145 55-00 3 2 8 TTT ubes, Culture, Media, Amber Colour RPERFITS Flat bottom, with screw cap and PTFE (Teflon) liner. Catalogue Capacity OOO . D. x Length PPP rice/Piece No. m l ..ml m m . Rs. P ... 328/01 5 18 x 45 5 8 - 0 0 328/02 15 25 x 57 7 4 - 0 0 328/03 30 25 x 95 8 5 - 0 0 328/04 40 25 x 145 110-00 3 2 9 Leighton T ubes RPERFITS For culture work, plain top. Catalogue Length OOO . D. Window Size PPP rice/Piece No. m m . m m . m m . Rs. P ... 329 329/01 125 16 11 x 37 42-00 329/02 150 16 11 x 37 50-00 3 3 0 Leighton T ubes RPERFITS For culture work, with screw cap. Catalogue Length OOO . D.D.. Window Size PPP rice/Piece No.No.No. mm. mm. mm. Rs. P ... 330 330/01 125 16 11 x 37 60-00 330/02 150 16 11 x 37 65-00 3 3 1 Centrifuge T ubes RPERFITS Conical bottom, plain. Catalogue Capacity Length x O . D. PPP rice/Piece No. m l ..ml m m . Rs. P ... 331/01 3 76 x 10 16-00 331/02 5 100 x 13 18-00 331 331/03 10 110 x 15 22-00 331/04 12 110 x 16 23-00 70 TUBES Catalogue Capacity Length x O . D. PPP rice/Piece No. m l ..ml m m . Rs. P ... 331/05 15 120 x 17 24-00 331/06 25 125 x 22 72-00 331/07 50 125 x 28 92-00 3 3 2 Centrifuge T ubes RPERFIT R Conical bottom, graduated. Catalogue Capacity Length x O . D. PPP rice/Piece No. m l ..ml m m . Rs. P ... 332/01 5 100 x 13 42-00 332/02 10 110 x 15 45-00 332 332/03 15 120 x 17 52-00 332/04 25 125 x 22 92-00 332/05 50 125 x 28 115-00 3 3 3 Centrifuge T ubes RPERFITS Conical bottom, with screw cap, plain. Catalogue Capacity Length x O . D. PPP rice/Piece No. m l ..ml m m . Rs. P ... 333/01 10 110 x 15 60-00 333 333/02 15 120 x 17 62-00 3 3 4 Centrifuge T ubes RPERFITS Conical bottom, with screw cap, graduated. Catalogue Capacity Length x O . D. PPP rice/Piece No. m l ..ml m m . Rs. P ... 334/01 10 110 x 15 85-00 334/02 15 120 x 17 90-00 3 3 5 Centrifuge T ubes RPERFITS Conical bottom, with interchangeable 334 stopper, plain. Catalogue Capacity Length x O . D. PPP rice/Piece No. m l ..ml m m . Rs. P ... 335/01 10 110 x 15 75-00 335/02 12 110 x 16 78-00 335 335/03 15 120 x 17 80-00 335/04 25 125 x 22 120-00 335/05 50 125 x 28 160-00 71 TUBES 3 3 6 Centrifuge T ubes RPERFITS Conical bottom, with interchangeable stopper, graduated. Catalogue Capacity Length x O . D. PPP rice/Piece No. m l ..ml m m . Rs. P ... 336/01 10 110 x 15 85-00 336/02 15 120 x 17 95-00 336/03 25 125 x 22 145-00 336/04 50 125 x 28 185-00 333 3 7737 Centrifuge T ubes RPERFITS Short, conical bottom, pour out, 336 heavy duty, plain, capacity 40 ml., Approx. O. D. x L is 29 x 116 mm. 125125125 -00-00-00 3 3 8 Centrifuge T ubes RPERFITS Short, conical bottom, pour out,heavy duty, plain, capacity 40 ml., Approx. O. D. x L is 29 x 116 mm., graduated. 180-00 337 3 3 9 Centrifuge T ubes, Oil RPERFITS Fully graduated 0 to 0.5 ml. in 0.05 ml. div., 0.5 to 2 ml. in 0.1 ml. div., 2 ml. to 3 ml. in 0.2 ml. div., 3 ml. to 5 ml. in 0.5 ml.div., 5 ml. to 10 ml. in 1 ml. div., 10 ml. to 25 ml. in 5 ml. div., graduations are marked at 50, 75 and 100 ml. 550-00 3 4 0 Centrifuge T ubes, Oil RPERFITS The lower stem is graduated 338 0 to 1.5 ml. in 0.1 ml. div., the body is graduated 1.5 ml. to 5 ml. in 0.5 div., from 5 ml. to 10 ml. in 1ml. div., graduations are marked at 15, 20, 25, 50, and 100 ml. 590-00 339 3 4 1 Centrifuge T ubes QPERFITR Round bottom, graduated. Catalogue Capacity OOO .D. x Length PPP rice/Piece 340 No. m l ..ml m m . Rs. P ... 341/01 12 16 x 110 6 2 - 0 0 341/02 30 24 x 110 7 0 - 0 0 341/03 40 28 x 110 8 6 - 0 0 341/04 50 30 x 110 100-00 341/05 100 45x 110 275-00 341/06 200 55 x 116 325-00 341 3 4 2 Stokes T ube RPERFITS 50 ml., graduated, with stopper. 185-00 72 TUBES 3 4 3 TTT est T ubes QPERFITR Plain with interchangeable stopper. Catalogue Length x OOO .D..D..D. Approx. Cap. Stopper PPP rice/Piece No. m m . m l ..ml S i z e R s . P ... 343/01 100 x 12 5 B 10 55-00 343/02 125 x 15 10 B 12 66-00 343/03 150 x 18 20 B 14 75-00 343/04 150 x 22 30 B 19 82-00 343/05 150 x 25 45 B 19 93-00 343 343/06 200 x 25 50 B 19 110-00 343/07 200 x 32 100 B 24 154-00 343/08 200 x 38 125 B 24 178-00 3 4 4 TTT est T ubes QPERFITR Graduated with interchangeable stopper. Catalogue Length x O.D. Capacity Sub-Div ... Stopper Price/Piece NNN o ..o. mm. ml.ml.ml. ml. sizesizesize Rs. P ... 344/01 100 x 12 5 0.1 B 10 808080 -00-00-00 344/02 125 x 15 10 0.1 B 12 878787 -00-00-00 344/03 150 x 18 20 0.5 B 14 105105105 -00-00-00 344/04 150 x 22 25 0.5 B 19 109109109 -00-00-00 344/05 200 x 25 50 1.0 B 19 111 404040 -00-00-00 344/06 200 x 32 100 2.0 B 24 111 808080 -00-00-00 3 4 5 TTT est T ubes QPERFITR Round or Flat bottom with rim or without rim, plain. Catalogue A ppAp prox. Capacity OOO . D . x Length PPP rice/Piece N o . m l . m m . Rs. P ... 345/01 3 10 x 75 5 - 5 0 345/02 5 12 x 75 6 - 0 0 345/03 8 12 x 100 7-25 345/04 10 15 x 125 1 0 - 0 0 345/05 12 15 x 150 1 2 - 0 0 345/06 25 18 x 150 1 3 - 0 0 345/07 50 25 x 150 1 9 - 5 0 345 345/08 75 25 x 200 25-00 73 TUBES 3 4 6 TTT est T ubes QPERFITR Round or Flat bottom, with rim or without rim, graduated. Catalogue Approx. Capacity OOO .D..D..D. x Length PPP rice/Piece N o . m l . m m . Rs. P ... 346/01 3 10 x 75 1 2 - 0 0 346/02 5 12 x 75 1 5 - 0 0 346/03 8 12 x 100 1 8 - 0 0 346/04 10 15 x 125 2 2 - 0 0 346/05 12 15 x 150 2 5 - 0 0 346/06 25 18 x 150 3 2 - 0 0 346/07 50 25 x 150 4 0 - 0 0 346/08 75 25 x 200 52-00 (Please Clearly Mention with Rim or without Rim) 346 333 4 7747 TTT est T ubes RPERFITS Neutral hard glass, heat resistant, with rim or without rim, Round Bottom. Catalogue OOO .D. x Length PPP rice/Piece No. mm. Rs. P ... 347/01 10 x 75 3 - 5 0 347/02 12 x 100 4 - 5 0 347/03 15 x 125 6 - 5 0 347/04 15 x 150 7 - 7 5 347/05 18 x 150 9 - 2 5 347/06 25 x 150 13-00 347/07 25 x 200 16-25 347/08 12 x 75 4 - 0 0 347 4 - 0 0 (Please Clearly Mention with Rim or without Rim) 348 P ressure T est T ube RPERFITS Pencilin type 20 mm. neck, 18 x 150 mm. 56-00 3 4 9 Stopper for above P ressure T est T ubes (Suba Seal). 28-00 348 74 SINTERED GLASSWARE QPERFITR Sintered Glassware PPP orosity Grades and their General Use PPP orosity PPP ore Size General use Grade Microns G-1 100-160 Coarse precipitate, filteration, gas dispersion, coarse grain material filtration. G-2 40-100 Filteration of medium precipitates, gas dispersion, gas washing. G-3 16-40 Filteration of fine grain precipitates,mercury filteration, analytical work and medium precipitates. G-4 4-16 Analytical work with fine and very fine precipitates non-return mercury valves. 3 6 0 Sintered Crucible QPERFITR Gooch type. Catalogue Capacity PPP orosity DiDiDi sc Dia. PPP rice/Piece No. m l ..ml Grade m m . Rs. P ... 360/01 15 G 1 20 85-00 360/02 15 G 2 20 85-00 360/03 15 G 3 20 85-00 360/04 15 G 4 20 85-00 360/05 30 G 1 30 95-00 360/06 30 G 2 30 95-00 360/07 30 G 3 30 95-00 360/08 30 G 4 30 95-00 360/09 50 G 1 40 185-00 360/10 50 G 2 40 185-00 360/11 50 G 3 40 185-00 360/12 50 G 4 40 185-00 3 6 1 Buchner F unnel QPERFITR With sintered disc, plain stem . Catalogue Capacity PPP orosity DiDiDi sc Dia PPP rice/Piece No. m l ..ml Grade m m . Rs. PPP ... 361/01 35 G 1 30 111 777 0-00 361/02 35 G 2 30 111 777 0-00 361/03 35 G 3 30 111 777 0-00 361/04 35 G 4 30 111 777 0-00 361/05 80 G 1 40 222 858585 -00-00-00 361 361/06 80 G 2 40 222 858585 -00-00-00 361/07 80 G 3 40 222 858585 -00-00-00 361/08 80 G 4 40 222 858585 -00-00-00 75 SINTERED GLASSWARE Catalogue Capacity PPP orosity DiDiDi sc Dia PPP rice/Piece No. m l ..ml Grade m m . Rs. PPP ... 361/09 100 G 1 50 333 707070 -00-00-00 361/10 100 G 2 50 333 707070 -00-00-00 361/11 100 G 3 50 333 777 0-00 361/12 100 G 4 50 333 777 0-00 361/13 200 G 1 65 555 959595 -00-00-00 361/14 200 G 2 65 555 959595 -00-00-00 361/15 200 G 3 65 555 959595 -00-00-00 361/16 200 G 4 65 555 959595 -00-00-00 361/17 500 G 1 90 111 750750750 -00-00-00 361/18 500 G 2 90 111 750750750 -00-00-00 361/19 500 G 3 90 111 750750750 -00-00-00 361/20 500 G 4 90 1750-00 361/21 1000 G 1 120 4200-00 361/22 1000 G 2 120 4200-00 361/23 1000 G 3 120 4200-00 361/24 1000 G 4 120 4200-00 3 6 2 Buchner F unnel QPERFITR With sintered disc and cone at stem. Catalogue Cap. PPP orosity Disc Dia. C o n e PPP rice/Piece N o . m l . Grade mm. S i z e Rs. P ... 362/01 100 G 1 50 B 14 or B 19 444 777 5-00 362/02 100 G 2 50 B 14 or B 19 444 777 5-00 362/03 100 G 3 50 B 14 or B 19 444 777 5-00 362/04 100 G 4 50 B 14 or B 19 444 777 5-00 362/05 200 G 1 65 B 19 or B 24 777 777 5-00 362/06 200 G 2 65 B 19 or B 24 777 777 5-00 362/07 200 G 3 65 B 19 or B 24 777 777 5-00 362/08 200 G 4 65 B 19 or B 24 777 777 5-00 362/09 500 G 1 90 B 19 or B 24 or B 29 111 975975975 -00-00-00 362/10 500 G 2 90 B 19 or B 24 or B 29 111 975975975 -00-00-00 362/11 500 G 3 90 B 19 or B 24 or B 29 111 975975975 -00-00-00 362/12 500 G 4 90 B 19 or B 24 or B 29 111 975975975 -00-00-00 362 362/13 1000 G 1 120 B 24 or B 29 444 750750750 -00-00-00 362/14 1000 G 2 120 B 24 or B 29 444 750750750 -00-00-00 362/15 1000 G 3 120 B 24 or B 29 444 750750750 -00-00-00 362/16 1000 G 4 120 B 24 or B 29 444 750750750 -00-00-00 76 SINTERED GLASSWARE 3 6 3 TTT ube Sealed QPERFITR (Pipe Line Filter) WiWith reduced ends, with sintered disc. Catalogue Disc Dia. PPP orosity PPP rice/Piece N o . m m . Grade Rs. P ... 363/01 30 G 1 350-00 363/02 30 G 2 350-00 363/03 30 G 3 350-00 363/04 30 G 4 350-00 363/05 40 G 1 525-00 363/06 40 G 2 525-00 363/07 40 G 3 525-00 363/08 40 G 4 525-00 363/09 50 G 1 725-00 363/10 50 G 2 725-00 366363 363/11 50 G 3 725-00 363 363/12 50 G 4 725-00 363/13 65 G 1 1325-00 363/14 65 G 2 1325-00 363/15 65 G 3 1325-00 363/16 65 G 4 1325-00 363/17 90 G 1 2150-00 363/18 90 G 2 2150-00 363/19 90 G 3 2150-00 363/20 90 G 4 2150-00 3 6 4 Conical Filter QPERFITR (Hirsch Type) With sintered disc. Catalogue Capacity Disc Dia. PPP orosity PPP rice/Piece N o . m l . m m . G r a d e Rs. P ... 364/01 25 20 G 1 200-00 364/02 25 20 G 2 200-00 364/03 25 20 G 3 200-00 364/04 25 20 G 4 200-00 364/05 60 30 G 1 290-00 364/06 60 30 G 2 290-00 364/07 60 30 G 3 290-00 364 364/08 60 30 G 4 290-00 364/09 100 30 G 1 385-00 364/10 100 30 G 2 385-00 364/11 100 30 G 3 385-00 364/12 100 30 G 4 385-00 77 SINTERED GLASSWARE 3 6 5 Sintered Glass Filter QPERFITS (Straight Type) With sintered disc sealed in the centre. Catalogue Disc Dia. PPP orosity PPP rice/Piece No. m m . Grade Rs. P ... 365/01 10 G 1 130-00 365/02 10 G 2 130-00 365/03 10 G 3 130-00 365/04 10 G 4 130-00 365/05 20 G 1 190-00 365/06 20 G 2 190-00 365/07 20 G 3 190-00 365/08 20 G 4 190-00 365/09 30 G 1 290-00 365 365/10 30 G 2 290-00 365/11 30 G 3 290-00 365/12 30 G 4 290-00 365/13 40 G 1 495-00 365/14 40 G 2 495-00 365/15 40 G 3 495-00 365/16 40 G 4 495-00 365/17 50 G 1 765-00 365/18 50 G 2 765-00 365/19 50 G 3 765-00 365/20 50 G 4 765-00 3 6 6 Sintered Glass Gas Distribution T ube RPERFITS (Filter Stic). Catalogue Disc Dia. PPP orosity PPP rice/Piece No. m m . Grade Rs. P ... 366/01 15 G 1 325-00 366/02 15 G 2 325-00 366/03 15 G 3 325-00 325-00 366 366/04 15 G 4 325-00 366/05 20 G 1 400-00 366/06 20 G 2 400-00 366/07 20 G 3 400-00 366/08 20 G 4 400-00 78 FILTER HOLDER ASSEMBLY 3367 6 7 Filter Apparatus QPERFITS Complete with filtering flask. Catalogue Flask Cap. Crucible Cap. PPP rice/Piece No. m l ..ml m l ..ml Rs. P ... 367/01 250 30 540-00 367/02 500 30 675-00 367/03 1000 50 1075-00 (Please mention porosity of disc while placing order). 367 3 6 8 Filter Apparatus QPERFITS Complete with filter flask with socket and buchner funnel, with sintered disc of porosity G-1 or G-2 or G-3 or G-4 having cone. Catalogue Flask Cap. FFF unnel Cap. PPP rice/Piece No. m l ..ml m l ..ml Rs. P ... 368/01 250 80 725-00 368/02 500 200 1150-00 368/03 1000 500 2525-00 368 368/04 2000 1000 6200-00 (Please mention porosity of disc while placing order). 3 6 9 Filtering Apparatus WittSs RPERFITS Complete with flanged jar, flanged lid, funnel and 250 ml.beaker. 4850-00 3 7 0 Filtering Apparatus RPERFITS For bacteriological use, consisting of a sintered buchner funnel capacity 80 ml., porosity G-5, with inverted B 29 ground joint and an erlenmeyer flask ground, to fit of capacity 250 ml. 369 1525-00 3 7 1 Membrane Filter Holder Assembly RPERFITS With membrane support, funnel, flask and clamp. Rubber cock fitting. Catalogue Membrane Dia. F unnel Cap. Flask Cap. P rice/Piece No. m m . ml. m l ..ml Rs. P ... 371/01 25 25 250 1800-00 371/02 25 50 500 1900-00 371/03 47 300 1000 3325-00 371/04 47 300 2000 3700-00 370 79 FILTER HOLDER ASSEMBLY 3 7 2 Membrane Filter Holder Assembly RPERFITS With membrane support, funnel, flask and clamp. Standard joint fitting. Catalogue Membrane Dia. F unnel Cap. Flask Cap. P rice/Piece No. m m . ml. m l ..ml Rs. P ... 372/01 25 25 250 1875-00 372/02 25 50 500 1975-00 372/03 47 300 1000 3525-00 372/04 47 300 2000 4075-00 372/05 47 300 5000 6750-00 3 7 2 A Spare Flask for Membrane Filter Assembly RPERFITS Catalogue Flask Cap. P rice/Piece No. m l ..ml Rs. P ... 372 372A/01 250 445-00 372A/02 500 575-00 372A/03 1000 1025-00 372A/04 2000 1595-00 372A/05 5000 5200-00 3 7 3 Glass Membrane Filter Holder Assembly RPERFITS 47mm. standard joint fitting with suitable oil free vacuum pump. 19750-00 3 7 4 Stainless Steel V acuum Filter Holder 47 mm. RPERFITS Feature Stainless steel top in base for simple control of the vacuum.Stainless steel frit filter support gives optimally uniform distribution of retained bacteria or particles on the membrane filter surface. Can be flamed to sanitize between samples. Application Microbiological quality control, e.g. of water, bear, wine and soft drinks. Analytical determination e.g. of metal particles in lubricating oil, iron oxides in boiler water. Materials Stainless steel lid, funnel, base, clamp and teflon coated filter support screen, silicone, teflon sealing ring in lid. Filter diameter 47 mm. Filteration area 12.4 cm., Funnel capacity 250 ml., Max operating pressure for vacuum only. Sterilization Autoclaving at upto 130 0 C or dry heat at 180 0 C, without mounted membrane filter but with filter flask. 6950-00 375 S.S. Membrane Filter Holder Assembly RPERFITS 80 47mm. with suitable oil free vacuum pump. 23250-00 CHROMATOGRAPHY QPERFITR Chromatography Apparatus 3 8 0 Chromatography Apparatus Semi Micro QPERFITR Consisting of funnel reservior 50 ml. capacity with B14 cone and socket column tube with stopcock 12 mm. dia., 10 cm. effective length with B14 socket, B19 Cone and fused sintered disc, filtering flask 100 ml. with B19 socket and tamping rod 40 cm. long. 1750-00 3 8 1 Chromatograph yyy Apparatus RPERFITS Consisting of dropping funnel 250 ml. with B-19 cone, reduction adapter B-19 socket and B-24 cone, column tube 2 cm. dia. and 20 cm. effective length with B-24 socket, B-19 cone and fused sintered disc,adapter with stopcock, B-19 socket and B-24 cone, filter- ing flask 250 ml. with B-24 socket and tamping rod 50 cm. long. 202020 50-50-50- 000000 3 8 2 Chromatography Columns RPERFITS With integral sintered disc, but without stopcock. 381 Catalogue Effective Length Disc Dia. PPP rice/Piece No. cm. m m . Rs. P ... 382/01 15 10 160-00 382/02 20 15 190-00 382/03 30 20 225-00 382/04 40 20 290-00 382/05 40 30 420-00 382/06 50 30 450-00 382/07 50 40 675-00 382/08 60 40 750-00 382/09 75 40 925-00 (Please Mention P orosity of Disc R equired in Column) 382 3 8 3 Chromatograph yyy Columns RPERFITS With integral sintered disc and stopcock. Catalogue Effective Length Disc Dia. PPP rice/Piece No. cm. m m . Rs. P ... 383/01 15 10 295-00 383/02 20 15 305-00 383/03 30 20 325-00 383/04 40 20 365-00 383/05 40 30 500-00 383/06 50 30 535-00 383/07 50 40 850-00 383/08 60 40 890-00 383 383/09 75 40 1075-00 1075-00 81 (Please Mention P orosity of Disc R equired in Column) CHROMATOGRAPHY 3 8 4 Chromatography Columns RPERFITS With integral sintered disc and screw type PTFE (Teflon) key rotaflow stopcock. Catalogue Effective Length Disc Dia. PPP rice/Piece No. cm. m m . Rs. P ... 384/01 15 10 275-00 384/02 20 15 305-00 384/03 30 20 330-00 384/04 40 20 400-00 384/05 40 30 525-00 384/06 50 30 600-00 384/07 50 40 870-00 384/08 60 40 900-00 384/09 75 40 1075-00 384 (Please Mention P orosity of Disc R equired in Column) 3 8 5 Chromatography Columns RPERFITS With integral sintered disc and PTFE (Teflon) key stopcock. Catalogue Effective Length Disc Dia. PPP rice/Piece No. cm. m m . Rs. P ... 385/01 15 10 545-00 385/02 20 15 565-00 385/03 30 20 635-00 385/04 40 20 675-00 385/05 40 30 1175-00 385/06 50 30 1300-00 1450-00 385 385/07 50 40 1450-00 385/08 60 40 1575-00 (Plea se Mention P orosity of Disc R equired in Column) 3 8 6 Chromatography Columns RPERFITS With integral sintered disc with cone and socket. CCC atalogue Bore EffEffEff . Length Socket Cone PPP rice/Piece No.No.No. mm. mm. Size Size Rs. P ... 386/01 10 100 B 14 B 19 300-00 386/02 10 200 B 14 B 19 350-00 386/03 10 300 B 14 B 19 375-00 386/04 18 200 B 14 B 19 395-00 386 386/05 18 300 B 14 B 19 410-00 386/06 18 300 B 24 B 19 415-00 386/07 18 400 B 24 B 19 440-00 386/08 18 400 B 24 B 24 450-00 82 (Please Mention P orosity of Disc R equired in Column) CHROMATOGRAPHY 3 8 7 Chromatography Columns RPERFITS With integral sintered disc, cone, socket and stopcock. Catalogue Bore EffEffEff . Length Socket Cone PPP rice/Piece No. m m . m m . Size Size Rs. P ... 387/01 10 100 B 14 B 19 500-00 387/02 10 200 B 14 B 19 510-00 387/03 10 300 B 14 B 19 525-00 387/04 18 200 B 14 B 19 550-00 387/05 18 300 B 14 B 19 575-00 387/06 18 300 B 24 B 19 595-00 387/07 18 400 B 24 B 19 650-00 387 387/08 18 400 B 24 B 24 660-00 (Please Mention P orosity of Disc R equired in Column) 3 8 8 Plain Chromatography Absorption Columns RPERFITS Without stopcock. Catalogue Effective Length Outer Dia. PPP rice/Piece No. cm. m m . Rs. P ... 388/01 20 10 4 5 - 0 0 388/02 30 15 8 0 - 0 0 388/03 50 20 150-00 388 388/04 60 25 185-00 388/05 60 40 430-00 388/06 100 50 975-00 388/07 115 100 3850-00 388/08 180 100 6250-00 (Please Mention P orosity of Disc R equired in Column) 3 8 9 Plain Chromatography Columns RPERFITS With stopcock. Catalogue Effective Length Outer Dia. PPP rice/Piece No. cm. m m . Rs. P ... 389/01 20 10 150-00 389/02 30 15 190-00 389/03 50 20 215-00 389/04 60 25 290-00 389 389/05 60 40 520-00 389/06 100 40 1075-00 83 CHROMATOGRAPHY Catalogue Effective Length Outer Dia. PPP rice/Piece No. cm. m m . Rs. P ... 389/07 100 50 1325-00 389/08 100 60 1950-00 389/09 115 100 4200-00 3 9 0 Chromatography Columns RPERFIT R Plain, with PTFE (Teflon) key stopcock. Catalogue Effective Length Outer Dia. PPP rice/Piece No. cm. m m . Rs. P ... 390/01 20 10 400-00 390/02 30 15 425-00 390/03 30 20 450-00 390/04 50 25 500-00 390 500-00 390/05 60 30 625-00 390/06 100 40 1425-00 390/07 100 20 675-00 3 9 1 Chromatography Columns RPERFITS Plain, with Screw Type PTFE (Teflon) key rotaflow stopcock. Catalogue Effective Length Outer Dia. PPP rice/Piece No. cm. m m . Rs. P ... 391/01 20 10 150-00 391/02 30 15 190-00 391/03 50 20 220-00 391/04 60 25 325-00 391/05 60 40 590-00 391/06 100 40 1325-00 391/07 100 50 1750-00 391/08 100 60 2500-00 391/09 115 100 4950-00 84 GAS ESTIMATION APPARATUS QPERFITR Gas Estimation Apparatus 4 0 1 Impinger RPERFITS Graduated for sampling small gas volumes as per standard specifications. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 401/01 35 260-00 401/02 50 290-00 401/03 80 325-00 401 401/04 150 500-00 401/05 275 650-00 4 0 2 Colourimetric T ubes RPERFITS Flat bottom with B-24 standard socket, total length 280 mm., O.D. 28 mm., with stopper. 275-00 4 0 3 Colourimetric T ubes RPERFITS Flat bottom with B-24 standard socket, total length 280 mm., O.D. 28 mm., without stopper. 250-00 4 0 4 Gas Measuring Burettes RPERFITS Graduated, with zero at closed end, with stopcock. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... No. m l ..ml Rs. P .. 404 404/01 25 215-00 404/02 50 240-00 404/03 100 305-00 4 0 5 BoyleSs Law Burettes RPERFITS Graduated, with zero at closed end, with stopcock. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 405/01 25 225-00 405/02 50 250-00 405/03 100 340-00 405 4 0 6 Gas Collecting T ubes RPERFITS With two, two way stopcocks, one on each side. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 406/01 100 400-00 406/02 250 490-00 406/03 500 665-00 406 85 GAS ESTIMATION APPARATUS 4 0 7 Gas Collecting T ubes RPERFITS With two, two way PTFE (Teflon) key stopcocks, one on each side. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 407/01 100 850-00 407/02 250 915-00 407/03 500 1045-00 4 0 8 Gas Collecting T ubes RPERFITS With two, three way double oblique bore stopcocks, one on each side. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 408/409 408/01 100 645-00 408/02 250 740-00 408/03 500 1025-00 444 0 9909 Gas Collecting T ubes RPERFITS With two, three way double oblique bore PTFE (Teflon) key stopcocks, one on each side. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 409/01 100 1550-00 409/02 250 1575-00 409/03 500 1700-00 410 Gas W ashing Bottles RPERFITS DreschleSs type interchangeable joints. 410 Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 410/01 125 475-00 410/02 250 600-00 410/03 500 750-00 4 1 1 Spare Head RPERFITS For above gas wash bottles. 245-00 4 1 2 Gas W ashing Bottles RPERFITS With sintered disc, interchangeable joints. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 411 412/01 125 700-00 412/02 250 815-00 86 412/03 500 900-00 GAS ESTIMATION APPARATUS 4 1 3 Spare Head RPERFITS With sintered disc for above wash bottles. 440-00 4 1 4 Carbon Dioxide Apparatus RPERFITS SchrotterSs. 925-00 4 1 5 Oxygen Determination Apparatus RPERFITS For the determination of oxygen as per I.S. Specification, fitted on wooden stand. 5500-00 4 1 6 Complete Glass P arts RPERFITS For above apparatus. 2575-00 4 1 7 Gas Burette Only RPERFITS For above apparatus. 995-00 4 1 8 Spare Levelling Bottle RPERFITS For above bulb type capacity 500 ml. 375-00 415 4 1 9 Spare Levelling Bottle RPERFITS For above aspirator type capacity 500 ml. 475-00 4 2 1 Gas Jar RPERFITS With ground glass flant flange. Catalogue Height OOO .D..D..D. PPP rice/Piece No. mm. (Approx.) mm. (Approx.) Rs. P ... 421/01 150 50 475-00 421/02 200 50 525-00 421/03 200 75 925-00 421/04 300 75 1075-00 87 ORSAT APPARATUS QPERFITR Orsat Apparatus with Glass Key Stopcocks 4 2 8 Orsat Gas Analysis Apparatus 3 T est RPERFITS For the determination of CO 2, CO and O 2 particularly in fuel and furnace gases, comprising of levelling bottle, 100 ml. gas burette with outer jacket, three absorption pipettes, manifold with glass key stopcocks in wooden case with sliding doors. 9900-00 4 2 9 Orsat Gas Analysis Apparatus 4 T est RPERFITS With manifold having glass key stopcock similar to Cat. No. 428 but with four absorption pipettes. 11200-00 428 4 3 0 Orsat Gas Analysis Apparatus 4 T est RPERFITS With manifold having glass key stopcock similar to Cat. No. 428 in design but with four absorption pipettes and a palladium /platinum asbestos tube. This is for the analysis of CO 2, CO, O 2, H 2 and Nitrogen (By Difference). Comprising of levelling bottle, 100 ml. gas burette with outer jacket, four absorption pipettes, palladium / platinum asbestos tube, adjustable spirit lamp, 4 test glass key stopcocks manifold in wooden case with sliding doors. 11950-00 4 3 1 Orsat Gas Analysis Apparatus Fischer T ype RPERFITS 431 With five absorption pipettes for determination of CO 2, CO, H2, O 2. Illuminants methane, ethane and nitrogen (By Difference). Comprising of four absorption pipettes, two of them plain type filled with glass tubes and two bubbling type pipettes with three way glass stopcocks. One platinum electrode combustion pipette with rehostat to use on 220 volts AC, two levelling bottles, 100 ml. gas burette with jacket and a manif old tube with glass stopcocks. All components in superior wooden cabinet with sliding doors. 15950-00 4 3 2 Spare for Orsat Apparatus with Glass Key Stopcocks Catalogue Item P rice/Piece No. Rs.P ... 432/05 432/01 100 ml. gas burette only for 428, 429 & 430 525-00 432/02 100 ml. gas burette with jacket for 428, 429 & 430 900-00 432/03 Three test manifold for 428 875-00 432/04 Four test manifold for 429 & 430 1050-00 432/05 Absorption pipette filled with glass tube for 428, 429, 430 650650650 -00-00-00 432/06 Levelling bottle 250 ml. for 428, 429, 430 & 431 325-00 432/10 432/07 Palladium/Platinum asbestos tube for 430 750-00 432/08 100 ml. burette only for 431 525-00 88 432/09 100 ml. burette only with jacket for 431 900-00 TEFLON KEY ORSAT APPARATUS Catalogue Item P rice/Piece No. Rs.P ... 432/10 Manifold tube for 431 925-00 432/11 Absorption pipette bubbling type for 431 825-00 432/12 Cumbustion pipette with platinum electrode for 431 2375-00 RPERFITS Orsat Apparatus with PTFE (T eflon) K ey Stopcocks 432/10 4 3 5 Orsat Gas Analysis Apparatus 3 T est RPERFITS For the determination of CO 2, CO, and O 2, particularly in fuel and furnace gases, comprising of levelling bottle, 100 ml. gas burette with outer jacket, three absorption pipettes, manifold with PTFE (teflon) key stopcocks in wooden case with sliding doors. 12250-00 4 3 6 Orsat Gas Analysis Apparatus 4 T est RPERFITS With manifold having four absorption pipettes, PTFE (Teflon) key stopcocks similar to Cat. No. 435. 13950-00 4 3 7 Orsat Gas Analysis Apparatus 4 T estestest RPERFITS With manifold having PTFE (Teflon) key stopcock similar to Cat. No. 435 in design but with four absorption pipettes and a Palladium/Platinum 432/11 asbestos tube. This is for the analysis of CO 2, CO, O 2, H 2 and Nitrogen (By Difference). Comprising of levelling bottle, 100 ml. gas burette with outer jacket, four absorption pipettes, Palladium / Platinum asbestos tube,adjustable spirit lamp,4 test PTFE (Teflon) key stopcock manifold in wooden case with sliding doors. 14750-00 4 3 8 Orsat Gas Analysis Apparatus Fischer T ype RPERFITS With five absorption pipettes for determinaction of CO 2, CO, H2, O 2, Illuminants methane, ethane and nitrogen (By Difference). Comprising of four absorption pipettes, two of them plain type filled with glass tubes and two bubbling type pipettes with 3 way PTFE (Teflon) key stopcocks. One platinum electrode combustion pipette, with rehostat to use on 220 volts AC, two levelling bottles, 100 ml. gas burette with jacket and a manifold tube with PTFE 432/12 (Teflon) key stopcocks. All components in superior wood case with sliding doors. 18750-00 4 3 9 Spares of Orsat Apparatus with PTFE (T eflon) K ey Stopcocks Catalogue Item P rice/Piece No. Rs.P ... 439/01 100 ml. gas burette only for 435, 436 & 437. 525-00 439/02 100 ml. gas burette with jacket for 435,436 & 437. 900-00 89 CALCIUM CHLORIDE TUBES Catalogue Item P rice/Piece P No. Rs.P. . 439/03 Three test manifold with PTFE (Teflon)ey Kstopcock for 435. 2750-00 439/03 Four test manifold with PTFE (Teflon)ey K stopcocks for 436 & 437. 2950-00 439/05 Absorption pipette filled with glass tubes for 435, 436,437 & 438. 650-00 439/06 Levelling bottle cap. 250 ml. for 435, 436,437 and 438. 325-00 439/07 Palladium/Platinum asbestos tubes for 437. 750-00 439/08 100 ml. burette only for 438. 525-00 439/09 100 ml. burette only with jacket for 438. 900-00 439/10 Manifold tube with PTFE (Teflon) Key stopcocks for 438. 3250-00 440 439/11 Absorption pipette bubbling type 3 way PTFE (Teflon) Key stopcocks for 438. 1750-00 439/12 Combustion pipette with platinum electrode fo r 438. 2375-00 4 4 0 Calcium Chloride T ube RPERFITS Straight or bent. Catalogue No. of P rice/Piece P No. Bulb Rs. P . . 440/01 1 32-00 440/02 2 38-00 441 4 4 1 Calcium Chloride T ube RPERFITS U-Shape. Catalogue Length X O .D..D..D. P Price/Piece No. m m . Rs. P . . 441/01 100 x 12 50-00 441/02 125 x 15 72-00 441/03 150 x 18 100-00 4 4 2 Calcium Chloride T ube RPERFITS U-Shape with side tube. Catalogue Length X O .D.D.D P Price/Piece No. m m . Rs. P . . 442 442/01 100 x 12 65-00 442/02 125 x 15 95-00 442/03 150 x 18 120-00 90 SEMI MICRO ANALYSIS APPARATUS 443 Calcium Chloride T ube RPERFITS U-Shape with side tube and stopper. Catalogue Length X O .D.D.D PPP rice/Piece No. m m . Rs. P ... 443/01 100 x 12 300-00 443/02 125 x 15 315-00 443/03 150 x 18 325-00 4 4 4 Calcium C hloride T ower RPERFITS Tubular at bottom and stopper at top. 443 Catalogue OOO .D. X Length PPP rice/Piece No. m m . Rs. P ... 444/01 38 x 250 725-00 444/02 50 x 300 925-00 444/03 60 x 300 1450-00 4 4 6 Semi Micro Kit Consisting of 20 P arts. 950-00 4 4 7 Kipps Apparatus RPERFITS With interchangeable joints. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 447/01 250 2250-00 447/02 500 2750-00 447/03 1000 3250-00 RPERFITS Semi Micro Analysis Apparatus 4 5 1 Beakers RPERFITS Low form with spout. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 451/01 5 35-00 451/02 10 38-00 451/03 20 40-00 451/04 25 40-00 451/05 50 45-00 451 91 SEMI MICRO ANALYSIS APPARATUS 4 5 2 Boiling Flasks RPERFITS Round bottom or flat bottom ... Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 452/01 5 40-00 452/02 10 45-00 452/03 20 55-00 452/04 25 55-00 452/05 50 68-00 452/06 100 85-00 452/07 250 95-00 452 4 5 3 Conical Flasks RPERFITS Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 453/01 5 3 4 - 0 0 453/02 10 3 5 - 0 0 453/03 20 5 5 - 0 0 453/04 25 5 5 - 0 0 453/05 50 6 2 - 0 0 453/06 100 6 5 - 0 0 453/07 150 8 5 - 0 0 453/08 250 100-00 453 4 5 4 Kjeldhal Flasks RPERFITS Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 454/01 5 50-00 454/02 10 60-00 454/03 25 80-00 454/04 30 80-00 454/05 50 120-00 454/06 100 150-00 454/07 300 225-00 454/08 500 350-00 454 454/09 800 450-00 92 SEMI MICRO ANALYSIS APPARATUS 4 5 5 Boiling T ubes RPERFITS With rim. Catalogue Length X O .D..D..D. PPP rice/Piece No. m m . Rs. P ... 455/01 75 x 10 5 - 5 0 455/02 75 x 12 6 - 0 0 455/03 100 x 12 7 - 2 5 455/04 60 x 25 1 7 - 0 0 455/05 100 x 25 19-00 455 4 5 6 Dropping Bottles RPERFITS Fitted with interchangeable stopper and rubber teat. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 456/01 30 180-00 456/02 60 200-00 456/03 125 285-00 456/04 250 350-00 456 4 5 8 Micro W ash Bottle RPERFITS Capacity 100 ml.with rubber fitting and rubber bellow. 250-00 4 5 9 Filter T ubeubeube RPERFITS Test Tube75 x 10mm with 55 x 7mm. filter tube. 28-00 4 6 0 Gas Absorption Pipette RPERFITS With rubber cock fitted in 75 x 10 mm. Test Tube. 30-00 4 6 1 Micro F unnel RPERFITS 20 mm. dia. 35-00 4 6 1 4462 6 2 Dropper 15 cm. Long, with rubber teat, neutral glass. 10-00 4463 6 3 Dropper 15 cm. Long, with rubber teat, borosil glass. 20-00 4 6 4 Semi Micro Burner RPERFITS . 175-00 4465 6 5 Semi Micro Spatula Stainless Stee l.l.l. 35-00 4466 6 6 Heating Block Aluminium, with 3 holes. 280-00 466 /467 4467 6 7 Heating Block Aluminium, with 5 holes. 325-00 4468 6 8 Hot Water Rack Aluminium, with beaker Cap. 250 ml ... 325-00 4 6 9 4469 6 9 Watch Glass 35 mm. or 50 mm. or 75 mm. dia. 15-00 93 SEMI MICRO ANALYSIS APPARATUS 4470 7 0 Semi Micro, Test tube holder with handle. 25-00 4471 7 1 Semi Micro, Test tube brush. 15-00 4472 7 2 Stirring Rod, 250 mm., neutral glass. 10-00 4473 7 3 Spot plate, Porcelain 6 Cavities ... 60-00 4 7 1 4475 7 5 Forceps, 10 cm. Long. 35-00 4476 7 6 Platinum Wire, Fused in glass rod and fitted in test tube. 275-00 4477 7 7 Semi Micro, Wooden stand to house tubes, filter tubes etc. 105-00 4478 7 8 Semi Micro, Porcelain crucible with lid Cap. 15 ml. 55-00 4479 7 9 Semi Micro, Nickel crucible with lid Cap. 25ml. 650-00 476 4480 8 0 Semi Micro Buchner funnel, porcelain, with fixed perforated plate ... 90-00 4481 8 1 Semi Micro, Sintered funnel. 160-00 482 Centrifuge Machine RPERFITS Hand driven, with two semi micro tubes. 1400-00 483 Centrifuge Machine RPERFITS Hand driven, with four semi micro tubes. 1500-00 4 8 4 Centrifuge Machine RPERFITS Hand driven, with two tubes of cap. 10 ml. or 15ml. 1400-00 4 8 5 Centrifuge Machine RPERFITS Hand driven, with four tubes 481 of cap. 10 ml. or 15 ml. 1500-00 482/484 94 CLINICAL LABORATORY APPARATUS RPERFITS Clinical Laborator y Apparatus 4 9 3 Blood Sugar T ubes QPERFITS Folin-w3 capacity 25 ml., marked at 4ml.,12.5ml. and 25ml. 130-00 4 9 4 TTT ubes Digestion RPERFITS Folin-w3, marked at 35ml. and 50ml., 494 25mm. O.D. and 200mm. length. 60-00 493 4 9 5 Wintrobe T ubeubeube RPERFITS 100 mm. graduated. 40-00 4 9 6 Wintrobe T ube RPERFITS 100 mm. graduated, neutral glass. 30-00 4497 9 7 E.S.R. Tube, 200 mm. graduated, 300 mm. long. 50-00 4498 9 8 Tube for Khan and Wasserman Test, 75x12 mm. 8 - 5 0 4 9 9 K ahnahnahn Ss Antigen Dillution T ubeubeube RPERFITS 55 x18 mm. , flat bottom. 15-00 5 0 0 WWW asserman T ube RPERFITS Rimless. 495/496 Catalogue Length X O .D..D..D. PPP rice/Piece No. m m . Rs. P ... 497 500/01 50x10 6 - 0 0 500/02 75x10 7 - 0 0 499 5 0 1 Dreyer Ss Agglutination T ubeubeube RPERFITS Conical bottom. 10-00 5 0 2 Durham T ube RPERFITS 500 Catalogue Length X O .D..D..D. PPP rice/Piece 501 No. m m . Rs. P ... 502/01 25x6 3 - 7 5 502/02 37x6 4 - 2 5 502 5 0 3 Murphy Drip RPERFITS 35-00 5 0 4 Widal T ube Conical Bottom RPERFITS 11-00 5 0 5 Thumberg T ube RPERFITS 503 Catalogue Length Dia. PPP rice/Piece No. mm. mm. R s. P ... 505/01 170 14 175-00 505/02 250 18 190-00 505 504 95 ELECTRODES / DAIRY AND MILK TESTING APPARATUS QPERFITS Electrodes 5 1 1 Conductivity Cell RPERFITS Dip type,with two rectangular electrodes parallel in a vertical plane,with 0.5 cell constant. 1575-00 5 1 2 Conductivity Cell RPERFITS Dip type, with two rectangular electrodes parallel in a vertical plane,with 0.5 cell constant,with platinic black coated 511/512 electrodes. 1775-00 5 1 3 Conductivity Cell RPERFITS Dip type, with two rectangular electrodes parallel in a vertical plane, with 1.0 cell constant. 1525-00 5 1 4 Conductivity Cell RPERFITS Dip type, with two rectangular electrodes parallel in a vertical plane, with 1.0 cell constant,with platinic black coated electrodes. 1675-00 513/514 5 1 5 TTT ransport Number Determination Apparatus QPERFITR Findly, U form with silver electrodes. PPP .O.O.O .R..R..R. 5 1 6 TTT ransport Number Determination Apparatus QPERFITR Loeb and Nernst, H form with silver electrodes. PPP .O.O.O .R..R..R. RPERFITS Dair y and Milk 521 TTT esting Apparatus 5 2 1 Butyrometer With plain neck with stem 10% Dr. GerberSs Design. 60-00 5 2 3 Butyrometer Butter Grade 0-70-90% With capacity 5 gm., flat scale,weighing type. 525-00 527 5 2 4 Butyrometer Cream 0-70% Weighing type 5 gm., flat scale, as per ISI specifications. 525-00 5 2 5 Buty rometer Skim Milk 0-4% Flat scale,as per I.S. specifications.525-00 5 2 6 Lock Stopper for Butyrometer ... 11-00 5 2 7 Mojonnier Flask As per I.S. specifications. 385-00 528/529 5 2 8 Milk PPP ipette RPERFITS Capacity 10.75 ml. or 11.04 ml., as per I.S. specifications. 85-00 5 2 9 Milk Pipette RPERFITS Capacity 10.75 ml. or 11.04, ml. class RAS, with works certificate. 130-00 5 3 0 Milk Pipette RPERFITS With mark at 0.5ml.,1 ml. and 1.1 ml. 105-00 530/531 5 3 1 MMM ilk Pipette RPERFITS With mark at 1ml., 2 ml., 2.1ml. and 2.2 ml ... 115-00 96 DAIRY AND MILK TESTING APPARATUS 5 3 3 Automatic Tilt Measure RPERFITS With interchangeable joint fitting, complete with conical flask with socket. Catalogue Capacity RRR eser voir Cap. PPP rice/Piece No. m l ..ml m l ..ml Rs. P ... 533/01 1 250 475-00 533/02 10 250 475-00 533/03 15 500 500-00 533/04 20 500 500-00 533 533/05 25 500 500-00 533/06 2 250 475-00 533/07 5 250 475-00 5 3 4 Centrifuge T ube Graduated RPERFITS Capacity 50ml. 115-00 5 3 5 Lactometer with P aper Scale. 25-00 534 535 5 3 6 PPP olenske Apparatus RPERFITS [R.M. Value Apparatus] for the determination of butter fat and analysis of oil, fats, waxes with rubber cork fitting with clamp, stand and burner. 1525-00 5 3 7 PPP olenske Apparatus RPERFITS [R.M. Value Apparatus] for the determination of butter fat and analysis of oil, fats, waxes with standard joint fitting with clamp, stand and burner. 1750-00 536 5 3 8 RRR eichert W ollny Ss Apparatus RPERFITS For the determination of volatile fatty acids in magarine and butter with rubber cork fitting with clamp, stand and burner. 1525-00 5 3 9 RRR eichert W ollny Ss Apparatus RPERFITS For the determination of volatile fatty acids in margarine and butter, with standard joint fitting with 538 clamp, stand and burner. 1750-00 5 4 0 Flask Flat Bottom Cap. 300 ml. for 536 and 538. 150-00 5 4 1 Flask Flat Bottom Cap. 300 ml. with B 24 socket for 537 and 539. 195-00 5 4 2 Standard Liebig Condenser For 536 and 538. 305-00 5 4 3 Standard Li eee big CondenseCondenser With B-24 socket for 537 and 539. 375-00 5 4 4 Still Head For 536 and 538. 130-00 5 4 5 Still Head With standard joints for 537 and 539. 210-00 5 4 6 Standard Flask 100 -110 ml. 175-00 97 STOPCOCKS RPERFITS Stopcocks 555 5 1151 Stopcock, Straight Bore RPERFITS Solid stopper plug, side tube. Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 551/552 551/01 2 90-00 551/02 3 125-00 551/03 4 155-00 5 5 2 Stopcock, Straight Bore RPERFITS Solid stopper plug, side capillary. Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 552/01 2 95-00 552/02 3 135-00 553 552/03 4 165-00 5 5 3 Stopcock for Burette RPERFITS With solid stopper plug. 80-00 5 5 4 Stopcock for Burette RPERFITS With hollow stopper plug. 250-00 554 5 5 5 Stopcock for Separating F unnels RPERFITS Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 555/01 2 125-00 555/02 4 165-00 555/03 6 425-00 555/04 8 550-00 555/05 10 675-00 5 5 6 Stopcock, Oblique Bore RPERFITS With solid stopper plug, side tube. 555 Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 556/01 2 115-00 556/02 4 170-00 556 98 STOPCOCKS 5 5 7 Stopcock, Three W ayayay , T Bore RPERFITS Solid stopper plug, side tube. Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 557 557/01 2 195-00 557/02 3-4 250-00 5 5 8 Stopcock, Three W ayayay , C Bore RPERFITS Solid stopper plug, side tube. Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 558/01 2 200-00 558/02 3-4 255-00 5 5 8 5 5 9 Stopcock, for Aspirators 4 mm. Bore RPERFITS Catalogue Description PPP rice/Piece No. Rs. P ... 559/01 Plain 130-00 559/02 With B 24 Cone 250-00 559/03 With B 29 Cone 285-00 559559559 RPERFITS High V acuum Stopcocks 5 6 5 Stopcock, Straight Bore RPERFITS With hollow plug. Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 565/01 2 250-00 565/02 3 295-00 565/03 4 345-00 565/04 6 525-00 565565565 565/05 8 675-00 565/06 10 800-00 99 HIGH VACUUM STOPCOCKS 5 6 6 Stopcock Single Oblique Bore RPERFITS With hollow plug, high vacuum. Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 566/01 2 275-00 566 566/02 3 325-00 566/03 4 375-00 566/04 6 575-00 566/05 8 750-00 5 6 7 Stopcock, Oblique Bore RPERFITS Vacuum cup hollow plug, high vacuum Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 567/01 2 425-00 567/02 3 450-00 567/03 4 460-00 567/04 6 550-00 5 6 8 Stopcock RPERFITS Three way double oblique bore, hollow plug, high vacuum. Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 569 568/01 2 335-00 568/02 3 450-00 568/03 4 525-00 5 6 9 Stopcock RPERFITS Three way T bore, hollow plug, high vacuum. Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 569/01 2 495-00 569/02 3 725-00 569/03 4 825-00 5 7 0 Stopcock, Right Angle RPERFITS Lower limb vertical, hollow plug, high vacuum. 570 Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 570/01 2 250-00 570/02 3 275-00 100 HIGH VACUUM STOPCOCKS Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 570/03 4 325-00 570/04 6 425-00 5 7 1 Stopcock, Right Angle RPERFITS Lower limb horizontal, hollow plug, high vacuum. 571 Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 571/01 2 225-00 571/02 3 250-00 571/03 4 285-00 571/04 6 375-00 5 7 2 Stopcock, Right Angle RPERFITS Three limb, lower limb vertical, hollow plug, high vacuum. Catalogue Plug Bore PPP rice/Piece No. m m . Rs. P ... 572/01 2 500-00 572/02 3 625-00 572 572/03 4 825-00 572/04 6 975-00 5 7 3 Stopcock for KippSs Apparatus Bent RPERFITS ... 175-00 RPERFITS R otaflow Screw T ype, PTFE (T eflon) K ey Stopcocks 5 8 0 RRR otaflow Stopcock, Screw T ypeypeype RPERFITS with PTFE (Teflon) key, with two limbs, plain. Catalogue Limbs O .D..D..D. PPP rice/Piece No. m m . Rs. P ... 580/01 8 75-00 580/02 10 175-00 580/03 12 250-00 580/581 5 8 1 RRR otaflow Stopcock Screw T ype RPERFITS with PTFE (Teflon) key, with two limbs, capillary bore 2 mm ... 99-00 101 TEFLON KEY STOPCOCKS 5 8 2 RRR otaflow Stopcock Screw T ype RPERFITS with PTFE (Teflon) key, with two plain limbs, at right angle. Catalogue Limbs O .D..D..D. PPP rice/Piece No. m m . Rs. P ... 582/01 8 99-00 582/02 10 195-00 5 8 3 RRR otaflow Stopcock Screw T ypeypeype RPERFITS PTFE (Teflon) key with two limbs at right angle, capillary bore 2 mm ... 125-00 5 8 4 RRR otaflow Stopcock Screw T ypeypeype RPERFITS PTFE (Teflon) key for burettes. 80-00 5 8 5 RRR otaflow Stopcock Screw T ypeypeype RPERFITS with PTFE (Teflon) key for separating funnels. Catalogue Bore PPP rice/Piece No. m m . Rs. P ... 585/01 0-2 125-00 585/02 0-4 165-00 585/03 0-6 425-00 585/04 0-8 550-00 RPERFITS PTFE (T eflon) K ey Stopcocks 5 9 0 Stopcock Straight Bore RPERFITS With PTFE (Teflon) key and glass barrel. Catalogue Bore PPP rice/Piece No. m m . Rs. P ... 590/01 1 350-00 590/02 2 350-00 590/03 3 425-00 590/04 4 575-00 590/05 6 825-00 5 9 1 Stopcock RPERFITS With PTFE (Teflon) key and glass barrel for burettes ... 345-00 5 9 2 Stopcock RPERFITS With PTFE (Teflon) key and glass barrel for separating funnels. Catalogue Bore PPP rice/Piece No. m m . Rs. P ... 592/01 2 450-00 102 592/02 4 595-00 TEFLON KEY STOPCOCKS Catalogue Bore PPP rice/Piece No. m m . Rs. P ... 592/03 6 895-00 592/04 8 1395-00 594 5 9 3 Stopcock Oblique Bore RPERFITS With PTFE (Teflon) key and glass barrel. Catalogue Bore PPP rice/Piece 595 No. m m . Rs. P ... 593/01 2 750-00 593/02 4 1225-00 5 9 4 Stopcock Double Oblique Bore RPERFITS Three way, Y bore with PTFE (Teflon) key and glass barrel. Catalogue Bore PPP rice/Piece No. m m . Rs. P ... 594/01 2 750-00 594/02 3 950-00 594/03 4 1250-00 5 9 5 Stopcock RPERFITS Three way, T Bore with PTFE (Teflon) key and glass 598 barrel. Catalogue Bore PPP rice/Piece No. m m . Rs. P ... 595/01 2 750-00 595/02 3 950-00 595/03 4 1250-00 RPERFITS Arsenic Apparatus 598 Arsenic Apparatus RPERFITS (Silver Diethyldithio carbonate method) according to I.S. specifications with interchangeable fitting. 900-00 599 Arsenic Apparatus RPERFITS Gutzeit modified form as per I.S. 599 specifications with interchangeable fitting. 995-00 600 Arsenic Apparatus RPERFITS As per B.P. specifications. 450-00 600 103 CONWAY DIFFUSION UNIT/ DEWAR FLASK RPERFITS Conway Diffusion Unit 6 0 5 Conway T ype Diffusion Unit RPERFITS With cover. Catalogue Outer Dish Inner Dish PPP rice/Piece No. O .D. x Ht. O .D. x Ht. Rs. P ... 605 mm. mm. 605/01 50 x 17 25 x 5 375-00 605/02 80 x 17 35 x 5 425-00 RPERFITS Dewar Flask 6 0 8 Dewar V acuum Flask RPERFITS Cylindrical, double walled, unsilvered. Catalogue Approx. Cap. PPP rice/Piece No. ml. Rs. P ... 608/01 300 1500-00 608/02 475 1800-00 608/03 600 2000-00 608/04 950 3200-00 608/05 2000 5200-00 6 0 9 Dewar V acuum Flask RPERFIT R Cylindrical, double walled, silvered. Catalogue Approx. Cap. PPP rice/Piece No. ml. Rs. P ... 609/01 300 2750-00 609/02 475 3500-00 609/03 600 3895-00 609/04 950 6650-00 609/05 2000 9950-00 6 1 0 Bottles B.O .D. with Interchangeable Stopper RPERFITS 608/609 Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 610/01 125 310-00 610/02 300 400-00 104 MAMOMETERS 6 1 1 TTT rrr ypsinising Flasks RPERFITS For culture. Catalogue Flask Cap. PPP rice/Piece No. m l ..ml Rs. P ... 611/01 25 175-00 611/02 50 225-00 611/03 100 275-00 611/04 250 375-00 611/05 500 495-00 611/06 1000 825-00 RPERFITS Manometers 6 1 2 Manometer RUS T ube RPERFITS Mounted on wooden stand with scale 120 - 0 -120mm., without mercury... 450-00 6 1 2 A Spare glass tube for above. 195-00 6 1 3 Manometer RUS T ube RPERFITS Mounted on wooden stand with scale 500-0-500 mm., without mercury... 1250-00 613 6 1 3 A Spare glass tube for above. 625-00 6 1 5 Manometer Bennert T ype, AnschotzSs RPERFITS With 120-0-120 mm. sliding scale, fitted with stopcock and two connection tubes mounted on polished wooden stand, without mercury. 1750-00 6 1 6 VVV acustat (M cLcLcL eod) RPERFITS With stand, distilled mercury for one filling, 616 range 10 mm. to 0.01 mm. Hg. pressure. 9500-00 6 1 7 Mercur y Diffusion P ump RPERFITS Tripple stage with electric heater, without mercury. 7500-00 105 BOTTLES RPERFITS Bottles 6 2 0 WWW eighing Bottles RPERFITS Tall form, Cap Type. Catalogue O .D. x Ht. Approx. Cap. PPP rice/Piece No. m m . m l ..ml Rs. P ... 620/01 18 x 40 7 145-00 620/02 28 x 50 25 165-00 620/03 38 x 60 55 250-00 620/04 45 x 80 100 285-00 6 2 1 WWW eighing Bottles RPERFITS Squat form, Cap Type. Catalogue OOO .D. x Ht. Approx. Cap. PPP rice/Piece 622 No. m m . m l ..ml Rs. P ... 621/01 38 x 30 25 250-00 621/02 45 x 30 45 285-00 6 2 2 WWW eighing Bottles RPERFITS With interchangeable stopper, tall form. Catalogue OOO .D. x Ht. Approx. Cap. PPP rice/Piece No. m m . m l ..ml Rs. P ... 622/01 20 x 40 5 100-00 622/02 25 x 50 15 110-00 622/03 30 x 60 25 140-00 622/04 40 x 80 60 205-00 623 6 2 3 WWW eighing Bottles RPERFITS With interchangeable stopper, squat form. Catalogue O .D. x Ht. Approx.Cap. PPP rice/Piece No. mm. ml. Rs. P ... 623/01 40 x 30 20 185-00 623/02 50 x 25 15 230-00 623/03 50 x 35 35 235-00 623/04 50 x 50 50 255-00 623/05 60 x 40 40 325-00 6 2 4 Specific Gravity Bottles RPERFITS Ground in capillary stopper. Catalogue Capacity PPP rice/Piece No. ml. Rs. P ... 624/625 624/01 5 75-00 624/02 10 80-00 624/03 25 90-00 624/04 50 100-00 106 624/05 100 200-00 BOTTLES 6 2 5 Specific Gravity Bottles QPERFITS With PTFE (Teflon) interchangeable stopper, class RAS, with works certificate. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 625/01 10 255-00 625/02 25 265-00 625/03 50 285-00 625/04 100 450-00 6 2 6 Specific Gravity Bottles RPERFITS With ground in thermometer 0 0 to 50 0 C. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 626/01 25 450-00 626/02 50 475-00 626/626A 6 2 6 A Specific Gravity Bottles RPERFITS With ground in thermometer 0 0 to 50 0 C, class RAS, with works certificate. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 626A/01 25 600-00 626A/02 50 625-00 6 2 7 Reagent Bottles RPERFITS Narrow mouth, with interchangeable hexagonal flat head, hollow stopper. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 627/01 30 135-00 627/02 60 165-00 627/03 125 250-00 627/04 250 275-00 627/05 500 365-00 627/06 1000 525-00 627/07 2000 950-00 627 627/08 5000 5950-00 627/09 10000 9150-00 107 BOTTLES 6 2 8 Reagent Bottles RPERFITS Wide mouth, with interchangeable hollow stopper. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 628/01 30 155-00 628/02 60 190-00 628/03 125 300-00 628/04 250 435-00 628/05 500 565-00 628/06 1000 795-00 6 2 8 A RRR eagent Bottles RPERFITS Clear, wide mouth with polypropylene blue screw cap and pouring ring,repeatedly autoclaveable, graduated. 628 Catalogue Capacity DINDINDIN PPP rice/Piece No. ml. Thread Rs. P ... 628A/00 50 GL32 225-00 628A/01 100 GL45 250-00 628A/02 250 GL45 270-00 628A/03 500 GL45 310-00 628A/04 1000 GL45 510-00 628A/05 2000 GL45 765-00 628A/06 3000 GL45 3200-00 628A/07 5000 GL45 4275-00 628A/08 10000 GL45 6950-00 6292929 Reagent Bottles RPERFITS Narrow mouth, with screw cap and PTFE (teflon) liner. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 629/01 30 140-00 629/02 60 180-00 629/03 125 275-00 629 629/04 250 325-00 629/05 500 475-00 629/06 1000 625-00 629/07 2000 1025-0 000 108 PETRI DISHES 6 3 0 Dropping Bottles RPERFITS Fitted with ground in interchangeable stopper and rubber teat. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 630/01 30 175-00 630/02 60 200-00 630/03 125 285-00 630/04 250 350-00 6 3 1 WWW oulf Bottles RPERFITS With three standard joint necks. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 630 631/01 250 400-00 631/02 500 475-00 6 3 3 PPP etri Dishes Imported Glass. Catalogue OOO .D. X Ht. PPP rice/Piece No. m m . Rs. P ... 633/01 50 x 12 90-00 633/02 80 x 15 105-00 633/03 90 x 17 125-00 631 633/04 100 x 15 135-00 633/05 150 x 25 345-00 6634 3 4 Petri Dishes Borosilicate Glass RPERFITS . Catalogue OOO .D. x Ht. PPP rice/Piece No. m m . Rs. P ... 634/01 50 x 17 100-00 634/02 62 x 17 115-00 634/03 80 x 17 125-00 634/04 100 x 17 150-00 634/05 150 x 20 500-00 109 BEAKERS / FLASKS 6353535 Beakers Low Form ,,, Graduated ,,, Accuracy of graduation / 5% QPERFITR Catalogue Capacity Graduation Inter valvalval PPP rice/Piece No. m l ..ml m l ..ml Rs. P ... 635/01 50 10 45-00 635/02 100 25 50-00 635/02A 150 50 60-00 635/03 250 50 65-00 635/04 500 100 100-00 635 635/05 1000 200 215-00 635/06 2000 400 550-00 6 3 6 Flask Erlenmeyer (Conical), Narrow Mouth, Graduated QPERFITR Catalogue Capacity Graduation Inter valvalval PPP rice/Piece No. m l ..ml m l ..ml Rs. P ... 636/01 50 10 63-00 636/02 100 25 65-00 636/02A 150 50 85-00 636/03 250 50 100-00 636/04 500 100 140-00 636/05 1000 200 285-00 636/06 2000 500 625-00 636/07 3000 500 1295-00 636 636/08 5000 500 2050-00 6 3 7 Flask Filtering, Heavy W all, Boltneck with T ubulation QPERFITR Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 637/01 100 190-00 637/02 250 325-00 637/03 500 425-00 637/04 1000 650-00 637/05 2000 1250-00 637/06 5000 4150-00 6 3 8 Flasks Boiling, Round Bottom QPERFITR Catalogue Capacity P rice/Piece No. m l ..ml Rs. P ... 638/00 50 70-00 638/01 100 85-00 638/02 150 90-00 638/03 250 95-00 638/04 500 160-00 638/05 1000 275-00 110 638/06 2000 725-00 TEFLON WARE Catalogue Capacity P rice/Piece No. m l ..ml Rs. P ... 638/07 3000 1350-00 638/08 5000 2100-00 638/09 10000 4275-00 6 3 9 Flask Boiling, Flat Bottom QPERFITR Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 639/00 50 70-00 639/01 100 85-00 639/02 150 90-00 639/03 250 95-00 639/04 500 160-00 639/05 1000 275-00 639/06 2000 725-00 639/07 3000 1350-00 639/08 5000 2100-00 639/09 10000 4275-00 PTFE (Teflon) Laboratory Ware 6 4 0 TTT eflon P estle Tissue Homogenisers (Grinders) RPERFITS Consisting of piston type teflon pestle with serrated tip to a stainless steel rod, grinding vessel of Borosilicate Glass is provided for the preparation of Tissue Homogenates. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 640/00 2 450-00 640/01 5 550-00 640/02 10 650-00 640/03 30 750-00 640 640/04 55 950-00 640/05 100 1375-00 6 4 1 TTT eflon Interchangeable Stopper RPERFITS Hexagonal head. Catalogue Cone Size PPP rice/Piece No. Rs. P ... 641/01 B 10 325-00 111 TEFLON WARE Catalogue Cone Size PPP rice/Piece No. Rs. P ... 641/02 B 14 425-00 641/03 B 19 495-00 641/04 B 24 650-00 641/05 B 29 750-00 641/06 B 34 850-00 6 4 2 TTT eflon/PTFE Coated Magnetic R otors/Needles RPERFITS Catalogue Size Shape PPP rice/Piece No. Length x Dia. Rs. P ... 641 m m . 642/01 12 x 6 Straight 180-00 642/02 20 x 8 Straight 260-00 642/03 25 x 8 Straight 275-00 642/04 30 x 8 Straight 295-00 642/05 35 x 8 Straight 325-00 642/06 50 x 9.5 Straight 395-00 642/07 20 x 10 Oval 325-00 642/08 25 x 10 Oval 375-00 642/09 30 x 10 Oval 400-00 642/10 35 x 13 Oval 525-00 642/11 50 x 17 Oval 725-00 642/12 18 x 9 Centre Ring 200-00 642/13 25 x 9 Centre Ring 225-00 642/14 30 x 9 Centre Ring 275-00 642/15 37 x 9 Centre Ring 300-00 642/16 50 x 9 Centre Ring 325-00 6 4 3 TTT eflon P oliceman with sealed end for removal or magnetic rotors immerse in solution. Catalogue Length PPP rice/Piece No. m m . Rs.P ... 643/01 150 675-00 643/02 250 775-00 643/03 300 925-00 6 4 4 TTT eflon Beakers with Spout R PERFIT SSS 643 Catalogue Capacity TTT ypeypeype PPP rice/Piece No. m l ..ml Rs. P ... 644/01 50 Without Lid 975-00 644/02 100 Without Lid 1850-00 112 644/03 250 Without Lid 3500-00 TEFLON WARE Catalogue Capacity TTT ypeypeype PPP rice/Piece No. m l ..ml Rs. P ... 644/04 400 Without Lid 4200-00 644/05 500 Without Lid 4950-00 644/06 1000 Without Lid 7950-00 644/07 50 With Loose Lid 1175-00 644/08 100 With Loose Lid 2100-00 644/09 250 With Loose Lid 3750-00 644/10 400 With Loose Lid 4750-00 644/11 500 With Loose Lid 5500-00 644/12 1000 With Loose Lid 8450-00 6 4 5 Adjustable T eflon Cone for Holding Thermometers QPERFITR Catalogue Cone PPP rice/Piece No. Size Rs. P ... 645/01 B 14 425-00 645/02 B 19 475-00 644 645/03 B 24 660-00 6 4 6 TTT eflon Mercur y Seal RPERFITS Catalogue Cone PPP rice/Piece No. Size Rs. P ... 646/01 B 24 2800-00 646/02 B 34 3500-00 6 4 7 TTT eflon W .M. Bottle with Screw Cap RPERFITS Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 647/01 100 2500-00 647/02 125 2800-00 647/03 250 3600-00 647/04 500 6200-00 647/05 1000 11100-00 6 4 8 TTT eflon Thermometer P ocket QPERFITR Catalogue Cone PPP rice/Piece No. Size Rs.P ... 648/01 B14 PPP .O.O.O .R.R.R 648/02 B19 PPP .O.O.O .R.R.R 648/03 B24 PPP .O.O.O .R.R.R 648/04 B34 PPP .O.O.O .R.R.R 113 MOLECULAR WEIGHT APPARATUS QPERFITR Molecular W eight Apparatus 6 5 1 Molecular W eight Determination Apparatus RPERFITS 651 Land BergerSs, boiling point method. 850-00 6 5 2 Molecular W eight Determination Apparatus RPERFITS McCoySs, boiling point method. 825-00 6 5 3 Victor Meyer Ss Apparatus RPERFITS Complete with inner tube. 650-00 6 5 4 Spare Inner T ubeubeube Only for victor meyerSs apparatus. 195-00 6 5 5 Victor Meyer Ss Apparatus RPERFITS With outer copper jacket and inner glass tube. 3250-00 6 5 6 Spare Hoffman Ss Bottle Soda glass for victor meyerSs apparatus. 28-00 652 6 5 8 FFF reezing P oint Apparatus Beckmann Ss RPERFITS Comprising of glass parts, metal cover, stirrer and 2 litre borosil glass cooling jar, without thermometer. 3475-00 6 5 9 Boiling P oint Apparatus Beckmann SsSsSs RPERFITS 653 Comprising of boiling tube with platinum wire fused in bottom, steam jacket of glass, spiral condenser, liebig condenser, filling pipette, stand and copper parts without thermometer, burner and calorimeter. 3950-00 6 6 0 PPP article Size Determination Apparatus RPERFITS (Sedimentation Pipette Anderson) Consisting of 500 ml. graduated cylinder, graduation from 0 to 20 cm. and fitted with 10 ml. pipette with three way stopcock,the tip of the pipette at the level of 0 mark at the cylinder scale. 1725-00 6 6 1 Spare Beckmann's Thermometer for 658 and 659. P .O.O.O .R..R..R. 658 114 SUPPLEMENTARY GLASSWARES QPERFITR Supplementar y Glasswares 6 7 1 Absorption Bulb MidvaleSs Stester RPERFITS With interchangeable stopper, total height is less than 140 mm. and weight less than 70 gms. 450-00 6 7 2 Adapter RPERFITS For liebig condenser straight or bent. 50-00 671 6 7 3 Adapter RPERFITS For gooch crucible. 672 Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 673/01 15 68-00 673/02 30 74-00 673/03 50 102-00 6 7 4 Distillation Flask with Side Arm RPERFITS 673 Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 674/01 25 95-00 674 674/02 50 125-00 674/03 100 150-00 674/04 250 190-00 674/05 500 260-00 674/06 1000 385-00 674/07 2000 725-00 674/08 150 170-00 677 (Distillation Flask Above 500 ml. will be of Short Neck) 6 7 5 Dirt Correction Apparatus RPERFITS With stopcock, cap. 1000 ml. 1625-00 6 7 6 Dirt Correction Apparatus RPERFITS With stopcock, 676 graduated, cap. 1000 ml. 1895-00 6 7 7 DumaSs Bulb RPERFITS 225-00 6 7 8 Filter Pump RPERFITS University pattern. 105-00 6 7 9 Filter P ump RPERFITS University pattern, superior quality. 165-00 678/679 115 SUPPLEMENTARY GLASSWARES 6 8 0 Filter P ump Edward T ype RPERFITS Heavy pattern, brass. 725-00 6 8 1 Filter T ubes RPERFITS With side tube. Catalogue TTT ube Size PPP rice/Piece No. m m . Rs. P ... 681/01 100 x 12 25-00 681/02 125 x 15 28-00 681/03 150 x 18 30-00 681/04 150 x 25 40-00 680 681 6 8 2 FFF unnel Filtering RPERFITS 60 0 angle with stem. Catalogue Diameter PPP rice/Piece No. m m . Rs. P ... 682/01 25 35-00 682/02 38 38-00 682/03 50 40-00 682/04 65 52-00 682/05 75 60-00 682/06 100 90-00 682/07 125 225-00 682/08 150 275-00 6 8 3 PPP owder F unnel RPERFITS With B 24 cone. 682 Catalogue Diameter PPP rice/Piece No. m m . Rs. P ... 683/00 75 165-00 683/01 100 175-00 683/02 125 270-00 683/03 150 410-00 683/04 200 725-00 683 6 8 4 Thistle F unnel RPERFITS 30 cm. stem. 50-00 6 8 4 A PPP orcelain Buchner F unnel Catalogue OOO .D..D..D. PPP rice/Piece No. m m . Rs. P ... 684A/01 50 95-00 684A/02 75 150-00 684A/03 100 200-00 684A/04 125 275-00 684 684A/05 150 475-00 684A/06 200 1250-00 116 SUPPLEMENTARY GLASSWARES 6 8 5 Connection T ube RPERFITS T shape. Catalogue TTT ube Dia. PPP rice/Piece No. m m . Rs. P ... 685 685/01 7 44-00 685/02 10 47-00 685/03 12 52-00 6 8 6 Connection T ubeSs RPERFITS Y shape. Catalogue TTT ube Dia. PPP rice/Piece 686 No. m m . Rs. P ... 686/01 7 44-00 686/02 10 47-00 686/03 12 52-00 6 8 7 Connection T ube's RPERFITS U shape. Catalogue TTT ube Dia. PPP rice/Piece No. m m . Rs. P ... 687/01 7 40-00 687/02 10 45-00 687/03 12 54-00 689 688 ThieleSs Melting P oint T ubes RPERFITS Catalogue Size PPP rice/Piece No. m m . Rs. P ... 688/01 150 x 18 65-00 688/02 150 x 25 80-00 6 8 9 Melting P oint Apparatus (JungeSs) RPERFITS As per I.S . specifications. 550-00 6 9 0 Melting P oint Capillaries Soda glass.(100 pcs. pack) 50-00 6 9 1 Melting P oint Capillaries Superior quality. (100 pcs. pack) 225-00 6 9 2 Viscometer College P attern RPERFITS Ostwald. 135-00 694A 694B 692/01692/01As per Cat. No. 692 with delivery period 80-100 seconds. 150-00 692/0 2 As per Cat. No. 692 with delivery period 100-120 seconds. 150-00 6 9 4 A Stalganometer Straight Graduated RPERFITS ... 85-00 6 9 4 B Stalganometer Bent Graduated RPERFITS ... 100-00 695 695 Stalganometer RPERFITS Set of three tubes one straight,two bent. 575-00 117 SUPPLEMENTARY GLASSWARES 6 9 6 Dilatometer RPERFITS Designed for measuring the expansion of edible oil and fats over the temperature range during melting. The ratio of solid to liquid present can be obtained. 333 777 5-00 6 9 7 WWW eight Thermometers RPERFITS Catalogue Capacity PPP rice/Piece 696 No. m l ..ml Rs. P ... 697/01 5 45-00 697/02 10 50-00 697/03 25 75-00 6 9 8 Pyknometers RPERFITS Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 698/01 5 55-00 698/02 5 With Two Marks 65-00 697 698/03 10 65-00 698/04 10 With Two Marks 75-00 698/05 25 95-00 698/06 25 With Two Marks 105-00 6 9 9 PPP olarimeter T ubes RPERFITS With centre bulb, metallic screw caps and cover glasses. Catalogue Length PPP rice/Piece 698 No. m m . Rs. P ... 699/01 100 925-00 699/02 200 950-00 699/04 400 1050-00 7 0 0 PPP olarimeter T ubes RPERFITS With centre cup, metallic screw cups and cover glasses . Catalogue Length PPP rice/Piece No. m m . Rs. P ... 700/01 100 950-00 700/02 200 975-00 700/04 400 1075-00 699 118 SUPPLEMENTARY GLASSWARES 7 0 1 Retorts Stoppered RPERFITS . Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 701/01 100 265-00 701 701/02 150 280-00 701/03 250 300-00 701/04 500 400-00 7 0 2 Acetylation Unit RPERFITS With air condenser 1 meter long with B 24 standard joint. Catalogue Flask Cap. PPP rice/Piece No. m l ..ml Rs. P ... 702/01 250 450-00 702/02 500 540-00 7 0 3 Kjeldahl Bulb RPERFITS Connecting, sloping, single bulb. 125-00 702 7 0 4 Kjeldahl Bulb RPERFITS Connecting, vertical, single bulb. 185-00 7 0 5 Kjeldahl Bulb RPERFITS Connecting, with two bulbs. 275-00 7 0 6 Jolly Air Bulb RPERFITS With three way stopcock. 425-00 7 0 7 WWW ashing Flasks RPERFITS With interchangeable joints. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 707/01 250 365-00 707/02 500 435-00 707/03 1000 650-00 7 0 8 Kjeldahl Digestion T ubes RPERFITS With constriction on top ... Catalogue OOO .D x Length PPP rice/Piece No. m m . Rs. P ... 708/01 24 x 250 140-00 708/02 26 x 250 155-00 708/03 40 x 300 265-00 708 119 SUPPLEMENTARY GLASSWARES 7 0 9 Chromatography Sprayer Ss RPERFITS With rubber bellow. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 709/00 50 340-00 709/01 100 375-00 709/02 250 410-00 709 7 0 9 A Chromatography Sprayer's RPERFITS Bottle type with interchangeable joints and rubber bellow. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 709A/01 25 410-00 709A/02 50 425-00 709A/03 100 440-00 7 1 0 Dessicator ,Plain, Neutral Glass RPERFITS With suitable porcelain plate. Catalogue Size PPP rice/Piece No. m m . Rs. P ... 710/02 160 1325-00 710/03 210 2325-00 710/04 240 3625-00 710 710/05 300 6925-00 7 1 1 Dessicator , VV, acuum, Neutral Glass RPERFITS With glass stopcock and suitable porcelain plate. Catalogue Size PPP rice/Piece No. m m . Rs. P ... 711/01 160 1995-00 711/02 210 3495-00 711 711/03 240 4995-00 711/04 300 9995-00 120 SUPPLEMENTARY GLASSWARES 7 1 5 Jars, R ectangular , Museum, Neutral Glass with Cover ... Catalogue Size PPP rice/Piece No. m m . Rs. P ... 715/01 250 x 250 x 150 2995-00 715/02 225 x 225 x 125 2795-00 715/03 220 x 140 x 140 1795-00 715/04 210 x 170 x 130 1650-00 715/05 140 x 215 x 100 1350-00 716 Dip T ube 1 Mtr . Long Dia 20 mm. 450-00 7 1 7 Dishes Cr ystallizing QPERFITR Catalogue Size PPP rice/Piece No. m m . Rs. P ... 717/01 70 x 40 165-00 718/02 80 x 45 225-00 718/03 100 x 50 350-00 718/04 150 x 75 625-00 718/05 190 x 100 1275-00 7 1 8 Dishes Evaporating, Flat Bottom, With Spout QPERFITR Catalogue Size PPP rice/Piece No. m m . Rs. P ... 718/01 80 x 45 195-00 718/02 105 x 55 275-00 718/03 150 x 80 625-00 718/04 200 x 100 1425-00 121 122 CARBON & SULPHUR DETERMINATION GLASS PARTS ‘PERFIT’ Carbon & Sulphur Determination Glass P arts 720A Absorption V essel RPERFITS With 3 valves for, KOH. 2075-00 7 2 1 Carbon Burette Double W alled RPERFITS Inner tube permanently graduated, with one valve at the top of the burette. 720 A Catalogue Size Price/Piece No. %%% Rs. P ... 721/01 0.25 2525-00 721/02 0.50 2525-00 721/03 1.50 2525-00 721/04 4.50 2625-00 7 2 2 Stopcock RPERFITS C bore, T shape. 575-00 721 7 2 3 Stopcock RPERFITS L shaped, long glass tube, twin bore stopper. 575-00 7 2 4 Oxygen Purifying Assembly RPERFITS 410-00 722 7 2 5 View Bulb RPERFITS For combustion tube. 40-00 7 2 6 Spiral Cooling Condenser RPERFITS 340-00 7 2 7 Aspirator Bottle [Levelling Bottle] RPERFITS For carbon 723 burette,capacity 1000 ml. 625-00 7 2 8 Thermometer Stem T ypeypeype 50 0 C alcohol filled. 45-00 7 2 9 Sulphur Burette RPERFITS 4ml. with automatic zero, three way double oblique bore stopcock at the bottom. 675-00 724 7 3 0 Titration V essel RPERFITS 100 ml. 725-00 725 726 727 123 FUSED SILICA LABORATORY WARE PERFIT’ Fused Silica Laboratory Ware 7 3 1 Silica Crucible RPERFITS To withstand temperature upto 800 0C, without lid. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 731/01 15 240-00 731/02 25 260-00 731 731/03 50 500-00 731/04 80 800-00 731/05 100 950-00 731/06 150 1250-00 7 3 2 Silica Crucible RPERFITS To withstand temperature upto 800 0C, with lid. Catalogue Capacity Price/Piece No. m l ..ml Rs. P ... 732/01 15 480-00 732/02 25 525-00 732/03 50 925-00 732/04 80 1475-00 732 732/05 100 1825-00 732/06 150 2275-00 7 3 3 Silica Basin (Dish) RPERFITS With spout, to withstand temprature upto 800 0C. Catalogue Capacity Diameter Price/Piece No.No.No. ml.ml.ml. mm. Rs. P ... 733/01 20 48-52 380-00 733/02 35 55-60 525-00 733/03 70 70-75 900-00 733/04 100 80-85 1375-00 733/05 150 90-95 1525-00 733 733/06 200 98-103 1950-00 733/07 250 107-110 2225-00 124 CRUCIBLES 7 3 5 Nickel Crucible RPERFITS with lid. Catalogue Capacity P rice/Piece No. m l ..ml Rs. P ... 735/02 25 775-00 735/03 50 1075-00 7 3 6 Platinum Crucible RPERFITS with lid. 735 Catalogue Capacity P rice/Piece No. m l ..ml Rs. P ... 736/01 15 PPP .O.O.O .R.R.R 736/02 25 PPP .O.O.O .R.R.R 736/03 50 PPP .O.O.O .R.R.R 7 3 7 PPP orcelain Crucible without lid. Catalogue Capacity P rice/Piece No. m l ..ml Rs. P ... 737/01 15 30-00 737/02 25 40-00 737/03 50 65-00 737/04 100 95-00 737/05 250 150-00 7 3 8 PPP orcelain Crucible with lid. Catalogue Capacity P rice/Piece No. m l ..ml Rs. P ... 738/01 15 40-00 738/02 25 50-00 738/03 50 80-00 738/04 100 115-00 738/05 250 175-00 7 3 9 PPP orcelain Mortar & P estle Catalogue Size O .D..D..D. P rice/Piece No. m m . Rs. P ... 739/01 60 65-00 739/02 75 90-00 739/03 100 175-00 739/04 125 275-00 738/05 150 375-00 738/06 200 750-00 125 PHOTOCHEMICAL REACTOR QPERFITR Photochemical Reactor Catalogue P rice/Piece No. Rs. P ... 7 4 0 Photochemical R eactor (Srinivasan- Griffin R ayonet) T ype RPERFITS This instrument comprises of eight ultra violet tubes of wave length 2537 A fitted in a heavy metal enclosure. Two clamping rods for holding the glass reactor to be suspended in the metal body, cooling fan and control panel with two switches and two indicator lights to operate ultra violet tubes and 740 cooling fan. A magnetic stirrer is also provided at the bottom of the reactor for continuous stirring during radiation of ultra violet rays. The apparatus is supplied without glass reactor. 31950-00 7 4 1 Quartz T ube with B -19 Socket RPERFITS Length 55 cm., 22 mm. dia., for use with reactor. 3950-00 7 4 2 Borosil Glass T ube with B -19 Socket RPERFITS Length 741/742 55 cm., 22 mm. dia., for use with reactor. 650-00 7 4 3 Photochemical Glass Reactor Assembly RPERFITS Comprising of a quartz glass probe with B-45 cone, with outer ground glass jacket of borosil glass having B-45 socket and a B-75 cone fitted with inlet and outlet tubes. Acooling jacket of borosil glass with B-75 socket and inlet and outlet tube is also provided, capacity 100 ml. or 200 ml. 17500-00 743/744 7 4 4 Photochemical Glass Reactor Assembly RPERFITS Same as 743 but all parts made of borosil glass. 5500-00 7 4 5 Photochemical Glass Reactor Assembly RPERFITS Comprising of a quartz probe with B-45 cone and outer jacket of borosil glass with B-45 socket with inlet and outlet tubes. 15500-00 7 4 6 Lamp with Choke 125 watt. for photo-chemical glass reactor assembly 743,744 and 745. 2550-00 745 7 4 7 Lamp Only 125 watt. for 743,744 and 745. 975-00 126 THERMOMETERS 'PERFITR Thermometers 7 8 0 Chemical Thermometer s Mercur y Filled RPERFITS Packed in case. Catalogue Range Division PPP rice/Piece No. Rs. P ... 780/01 0-50 0 C 1/1 120-00 780/02 0-50 0 C 1/2 120-00 780/03 -10-110 0 C 1/1 120-00 780/04 -10-110 0 C 1/2 120-00 780/05 0-150 0 C 1/1 120-00 780/06 0-200 0 C 1/1 120-00 780/07 0-250 0 C 1/1 120-00 780/08 0-300 0 C 2/1 120-00 0 780/09 0-360 C 2/1 120-00 780 7 8 1 PPP recision Thermometers Mercur y Filled RPERFITS Packed in case. Catalogue Range Division PPP rice/Piece No. Rs. P ... 781/01 -10-50 0 C 1/5 175-00 781/02 -10-50 0 C 1/10 225-00 781/03 -10-110 0 C 1/5 250-00 781/04 -10-110 0 C 1/10 300-00 7 8 2 Thermometers with Cone Enclosed T ype RPERFITS Catalogue Range Cone PPP rice/Piece 781 No. Size Rs. P ... 782/01 -10-50 0 C B 10 350-00 782/02 -10-110 0 C B 10 395-00 782/03 0-250 0 C B 10 395-00 782/04 0-360 0 C B 10 395-00 782/05 -10-110 0 C B 14 425-00 782/06 0-250 0 C B 14 425-00 782/07 0-360 0 C B 14 425-00 782/08 -10-110 0 C B 19 495-00 782/09 0-250 0 C B 19 495-00 0 782/10 0-360 C B 19 495-00 782 127 THERMOMETERS 7 8 3 Long Imm ersion Thermometers Mercur y Filled RPERFITS Packed in case. Catalogue Range Immersion TTT otal PPP rice/Piece No. Length Length Rs. P ... cms. cms. 783/01 0-110 0 C 15 45 225-00 783/02 0-250 0 C 15 45 225-00 783/03 0-360 0 C 15 45 225-00 783/04 0-110 0 C 30 60 325-00 783/05 0-250 0 C 30 60 325-00 784 783/06 0-360 0 C 30 60 325-00 783/08 0-250 0 C 45 75 450-00 783/09 0-360 0 C 45 75 450-00 785 783/10 0-110 0 C 60 90 525-00 783/11 0-250 0 C 60 90 525-00 783/12 0-360 0 C 60 90 525-00 7 8 5 Oven/Incubator Thermometers RPERFITS L shaped size 200 mm. x 200 mm., mercury filled. Catalogue Range Division PPP rice/Piece No. Rs. P ... 785/01 0-110 0 C 10 C 250-00 786 785/02 0-250 0 C 20 C 250-00 785/03 0-360 0 C 20 C 250-00 7 8 6 Maximum and Minimum Thermometer RPERFIT R 625-00 7 8 7 WWW et and Dr y Thermometer RPERFITS 625-00 7 8 8 WWW all Thermometer RPERFITS To show room temperature 0 0 787 with scale in C and F on wooden board ... 400-00 7 8 9 WWW all ThermometeThermometer RPERFITS Half meter long ... 795-00 7 9 1 Soil Thermometers RPERFITS Scale 0-60 0 C fitted on wooden body, with metal cone at bottom. Catalogue Length of Cone PPP rice/Piece No. cms. Rs. P ... 791/01 7.5 650-00 791/03 15 750-00 788 791/04 30 950-00 128 HYDROMETERS 7 9 2 Low T emperature Thermometers RPERFITS (Alcohol filled) 30cms. long. Accuracy / 1 C division. Catalogue Range Division PPP rice/Piece No. Rs. P ... 792/01 -30 to 30 C 1 C 195-00 792/02 -50 to 50 C 1 C 245-00 792/03 -50 to100 C 1 C 245-00 792/04 -100 to 50 C 1 C 300-00 7 9 6 Thermometers With certificate of A NABL Approved Laboratory. Catalogue Range PPP rice/Piece No. Rs. P ... 796/01 -10 to110 C 1950-00 796/02 0 to 250 C 1950-00 796/03 0 to 360 C 1950-00 HYDROMETERS 8 0 1 Specific Gravity Hydrometers In 100 degree range, shot weighted with paper scale. Catalogue Range Price/Piece No.No.No. Rs. P ... 801/01 600-700 200-00 801/02 700-800 200-00 801/03 800-900 200-00 801/04 900-1000 200-00 801/05 1000-1100 200-00 801/06 1100-1200 200-00 801/07 1200-1300 200-00 801/08 1300-1400 210-00 801/09 1400-1500 210-00 801/10 1500-1600 225-00 801/11 1600-1700 225-00 801/12 1700-1800 225-00 801/13 1800-1900 450-00 801/802 801/14 1900-2000 450-00 129 HYDROMETERS 8 0 2 Specific Gravity Hydrometer In 200 degree range, shot weighted with paper scale. Catalogue Range PPP rice/Piece No. Rs. P ... 802/01 600-800 200-00 802/02 800-1000 200-00 802/03 1000-1200 200-00 802/04 1200-1400 200-00 802/05 1400-1600 225-00 802/06 1600-1800 225-00 802/07 1800-2000 225-00 8 0 3 Universal Hydrometer Range 700-2000 Sp. Gr. 175-00 8 0 4 Beaume Hydrometer In 10 degree range, shot weighted with paper scale. Catalogue Range PPP rice/Piece No. Rs. P ... 804/01 0-10 Be 200-00 804/02 10-20 Be 200-00 804/03 20-30 Be 200-00 804/04 30-40 Be 200-00 804/05 40-50 Be 210-00 804/06 50-60 Be 210-00 804/07 60-70 Be 210-00 8 0 5 Beaume Hydrometer In 20 degree range, shot weighted with paper scale. 804/805 Catalogue Range Price/Piece No.No.No. Rs. P ... 805/01 0 - 20 Be 200-00 805/02 20 - 40 Be 200-00 805/03 40 - 60 Be 210-00 8 0 6 Beaume Hydrometer Shot weighted, with paper scale, light liquid range 10 -70 Be, 700-1000 Sp. Gr. 98-00 8 0 7 Beaume Hydrometer Shot weighted, with paper scale, heavy liquid range 0-70 Be, 1000-2000 Sp. Gr. 98-00 130 HYDROMETERS 8 0 8 Brix Hydrometer SShot weighted, with paper scale, without thermometer. Catalogue Range PPP rice/Piece No. Rs. P ... 808/01 0 - 10 Bx, 10 - 20 Bx, 20- 30Bx, 30 - 40 Bx, 40 - 50 Bx, 50 - 60 Bx, 60 - 70 Bx, 70 - 80 Bx, 80 - 90 Bx. 325-00 808/02 0 - 20 Bx, 20 - 40 Bx, 40 - 60 Bx, 60 - 80 Bx. 325-00 8 0 9 Brix Hydrometer Shot weighted, with paper scale, with built in thermometer. Catalogue Range PPP rice/Piece No. Rs. P ... 809/01 0 - 10 Bx, 10 - 20 Bx, 20 - 30 Bx, 30 - 40 Bx, 40 - 50 Bx, 50 - 60 Bx. 725-00 8 1 0 SikeSs Hydrometer Shot weighted, with paper scale. Catalogue Range PPP rice/Piece No. Rs. P ... 810/01 0 - 20, 20 - 40, 40 - 60, 60 - 80, 80 -100 335-00 8 1 1 TTT waddle Hydrometer Catalogue Size Range PPP rice/Piece 808 /810 No. Rs. P ... 811/01 1 0 - 26 200-00 811/02 2 24 - 50 200-00 811/03 3 48 - 74 200-00 811/04 4 72 - 104 225-00 811/05 5 102 - 138 225-00 811/06 6 136 - 174 225-00 131 AMBER COLOUR GLASSWARE RPERFITS Borosilicate Glassware in Amber Colour 8 3 1 Amber Colour Burettes RPERFITS With straight bore PTFE (Teflon) key stopcock. Accuracy as per Class RAS of I.S. 1197 : 2008, ISO385:2005, with works certificate. Catalogue Capacity Sub-division TTT olerance PPP rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 831/01 1 0.01 0.006 1075-00 831/02 2 0.01 0.010 1075-00 831/03 5 0.02 0.010 1075-00 831/04 10 0.05 0.020 1075-00 831/05 25 0.10 0.050 1095-00 831/06 50 0.10 0.050 1150-00 831/07 100 0.20 0.100 1275-00 831 8 3 4 Amber Colour Burettes, Automatic Zero RPERFITS With PTFE (Teflon) key stopcock, mounted on reservoir. Accuracy as per class RAS of I.S. 1197 : 2008, ISO 385:2005, with works certificate. Catalogue Capacity Sub-division TTT olerance PPP rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 834/01 10 0.05 0.02 4500-00 834/02 25 0.10 0.05 5400-00 834/03 50 0.10 0.05 5675-00 834/04 100 0.20 0.10 5875-00 8 3 5 Amber Colour Separating F unnels RPERFITS With PTFE (Teflon) key stopcock and interchangeable glass stopper, pear shape or globe shape. 834 Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 835/01 25 650-00 835/02 50 700-00 835/03 100 825-00 835/04 125 825-00 835/05 250 1025-00 835/06 500 1375-00 835/07 1000 1975-00 835/08 2000 3925-00 835 132 AMBER COLOUR GLASSWARE 8 3 7 Amber Colour Burettes RPERFITS With straight bore glass key stopcock. Accuracy as per class RAS of I.S. 1197: 2008, ISO 385:2005, with works certificate. Catalogue Capacity Sub-division TTT olerance PPP rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 837/01 1 0.01 0.006 850-00 837/02 2 0.02 0.010 850-00 837/03 5 0.05 0.010 850-00 837/04 10 0.05 0.020 850-00 837/05 25 0.10 0.050 875-00 837 837/06 50 0.10 0.050 925-00 837/07 100 0.20 0.100 975-00 8 4 1 Amber Colour Burettes RPERFITS Automatic zero,with glass key stopcock, mounted on reservoir. Accuracy as per class RAS of I.S. 1197:2008,ISO 385:2005, with works certificate.Complete with rubber bellow. Catalogue Capacity Sub-division TTT olerance PPP rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 841/01 10 0.05 0.02 4475-00 841/02 25 0.10 0.05 5375-00 841/03 50 0.10 0.05 5625-00 841/04 100 0.20 0.10 5825-00 8 4 2 Amber Colour Cylinders, Graduated RPERFITS With pour out, Hexagonal base. Accuracy as per class RAS of I. S. 878:2008,ISO 4788:2005, with works certificate. Catalogue Capacity Sub-division TTT olerance PPP rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 842/01 5 0.1 0.05 340-00 842/02 10 0.2 0.10 370-00 842/03 25 0.5 0.25 425-00 842/04 50 1.0 0.50 495-00 842/05 100 1.0 0.50 600-00 842/06 250 2.0 1.00 900-00 842/07 500 5.0 2.50 1300-00 842 842/08 1000 10.0 5.00 1800-00 8 4 3 Ambers Colour Cylinders, Gradua ted RPERFITS With interchangeable stopper, Hexagonal base. Accuracy as per class RAS of I.S. 878 : 2008 , ISO 4788 : 2005, with works certificate. Catalogue Capacity Sub-division TTT olerance Stopper PPP rice/Piece No. m l ..ml m l ..ml / ml. S i z e Rs. P ... 843/01 5 0.1 0.05 10/15 425-00 843/02 10 0.2 0.10 10/15 450-00 843/03 25 0.5 0.25 14/15 495-00 133 AMBER COLOUR GLASSWARE Catalogue Capacity Sub-division T olerance Stopper PPP rice/Piece No. m l ..ml m l ..ml / ml. SizeSizeSize Rs. P ... 843/04 50 1.0 0.50 14/15 625-00 843/05 100 1.0 0.50 19/20 750-00 843/06 250 2.0 1.00 24/25 1150-00 843/07 500 5.0 2.50 24/25 1795-00 843/08 1000 10.0 5.00 34/25 2425-00 8 4 4 Amber Colour Flasks, V olumetric RPERFITS With interchangeable stopper. Accuracy as per class RAS of I.S. 915 : 2012,ISO 1042:1998, with works certificate. Catalogue Capacity TTT olerance PPP rice/Piece No. m l ..ml / ml. Rs. P ... 843 844/01 1 0.025 275-00 844/02 2 0.025 275-00 844/03 5 0.025 285-00 844/04 10 0.025 295-00 844/05 20 0.040 315-00 844/06 25 0.040 315-00 844/07 50 0.060 325-00 844/08 100 0.100 370-00 844/09 200 0.150 535-00 844/10 250 0.150 535-00 844/11 500 0.250 910-00 844/12 1000 0.400 1350-00 844/13 2000 0.600 2525-00 (1 ml. and 2 ml. sizes are of T est T ube shape). 844 8 4 5 Amber Colour Pipettes RPERFITS Transfer, Volumetric. Accuracy as per class RAS of I.S. 1117 : 1975, with works certificate. Catalogue Capacity TTT olerance PPP rice/Piece No. m l ..ml / ml. Rs. P ... 845/01 1 0.006 190-00 845/02 2 0.010 190-00 845/03 3 0.015 190-00 845/04 4 0.015 190-00 845/05 5 0.015 195-00 845/06 10 0.020 210-00 845/07 15 0.020 220-00 845/08 20 0.030 240-00 845/09 25 0.050 240-00 845/10 50 0.050 315-00 845 845/11 100 0.080 450-00 134 AMBER COLOUR GLASSWARE 8 4 6 Amber Col our Pipettes RPERFITS Graduated, mohr/serological type. Accuracy as per class RAS of I.S. 4162 : 1967, with works certificate. Catalogue Capacity Sub-division TTT olerance PPP rice/Piece No. m l ..ml m l ..ml / ml. Rs. P ... 846/01 0.1 0.01 0.006 240-00 846/02 0.2 0.01 0.006 240-00 846/03 0.5 0.02 0.006 240-00 846/04 1.0 0.10 0.006 240-00 846/05 1.0 0.01 0.006 240-00 846/06 2.0 0.02 0.010 240-00 846/07 2.0 0.10 0.010 240-00 846/08 5.0 0.05 0.030 240-00 846/09 10.0 0.10 0.050 245-00 846/10 25.0 0.20 0.100 290-00 846 8 4 7 Amber Colour Separating F unnels RPERFITS With glass key stopcock and interchangeable stopper, pear/globe shape. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 847/01 25 345-00 847/02 50 440-00 847/03 125 575-00 847/04 250 725-00 847/05 500 975-00 847/06 1000 1450-00 847/07 2000 2875-00 8 4 8 Amber Colour P etri Dishes, Culture RPERFITS Catalogue OOO .D. x Height PPP rice/Piece No. m m . Rs. P ... 847 848/01 50 x 17 260-00 848/02 80 x 17 310-00 848/03 100 x 17 370-00 848/04 150 x 20 775-00 848/05 200 x 20 1325-00 RPERFITS Amber Colour Reagent Bottles 848 8 4 9 Amber Colour Reagent Bottles N. M. RPERFITS With interchangeable stopper ... Catalogue Capacity PPP rice/Piece No.No.No. ml.ml.ml. Rs. P ... 849/01 30 250-00 849/02 60 350-00 849/03 125 385-00 849/04 250 485-00 849/05 500 650-00 849 849/06 1000 950-00 849/07 2000 1625-00 849/08 5000 8500-00 135 AMBER COLOUR GLASSWARE 8 4 9 A Amber Colour R eagent Bottles W . M. RPERFITS With Polypropylene blue screw cap and pouring ring, repeatedly autoclaveable, graduated. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 849A/00 50 325-00 849A/01 100 400-00 849A/02 250 475-00 849A/03 500 575-00 849A/04 1000 925-00 849A/05 2000 1425-00 849A/06 3000 6475-00 849A/07 5000 6925-00 849A/08 10000 9975-00 8 5 1 Amber Colour Flask Conical / F .B. / R.B. RPERFITS With Interchangeable stopper. Catalogue Capacity PPP rice/Piece No. m l ..ml Rs. P ... 851/01 25 295-00 851/02 50 325-00 851/03 100 450-00 851/04 150 515-00 851/05 250 575-00 851/06 500 825-00 851/07 1000 995-00 851/08 2000 1750-00 136