SGCG MaxPab rabbit polyclonal . The dystrophin-glycoprotein complex (DGC) antibody (D01) spans the and is comprised of dystrophin, , alpha- and beta- and Catalog Number: H00006445-D01 . The DGC provides a structural link between the subsarcolemmal and the Regulatory Status: For research use only (RUO) of muscle cells. Defects in the encoded can lead to early onset autosomal Product Description: Rabbit polyclonal antibody raised recessive muscular dystrophy, in particular limb-girdle against a full-length human SGCG protein. muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq] Immunogen: SGCG (NP_000222.1, 1 a.a. ~ 291 a.a) full-length human protein. References: 1. Efficient exon skipping of SGCG mediated Sequence: by phosphorodiamidate morpholino oligomers. Wyatt EJ, MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYL Demonbreun AR, Kim EY, Puckelwartz MJ, Vo AH, FVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDG Dellefave-Castillo LM, Gao QQ, Vainzof M, Pavanello LRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNA RCM, Zatz M, McNally EM. JCI Insight. 2018 May 3;3(9). RNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLF pii: 99357. [Epub ahead of print] TVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADP FQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDI LFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYE ICVCPDGKLYLSVAGVSTTCQEHSHICL

Host: Rabbit

Reactivity: Human

Applications: IP, WB-Ti, WB-Tr (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Storage Buffer: No additive

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 6445

Gene Symbol: SGCG

Gene Alias: A4, DAGA4, DMDA, DMDA1, LGMD2C, MAM, MGC130048, SCARMD2, SCG3, TYPE

Gene Summary: This gene encodes gamma-, one of several sarcolemmal transmembrane glycoproteins that interact with

Page 1/1

Powered by TCPDF (www.tcpdf.org)