SGCG MaxPab rabbit polyclonal dystrophin. The dystrophin-glycoprotein complex (DGC) antibody (D01) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and Catalog Number: H00006445-D01 sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the Regulatory Status: For research use only (RUO) extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal Product Description: Rabbit polyclonal antibody raised recessive muscular dystrophy, in particular limb-girdle against a full-length human SGCG protein. muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq] Immunogen: SGCG (NP_000222.1, 1 a.a. ~ 291 a.a) full-length human protein. References: 1. Efficient exon skipping of SGCG mutations mediated Sequence: by phosphorodiamidate morpholino oligomers. Wyatt EJ, MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYL Demonbreun AR, Kim EY, Puckelwartz MJ, Vo AH, FVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDG Dellefave-Castillo LM, Gao QQ, Vainzof M, Pavanello LRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNA RCM, Zatz M, McNally EM. JCI Insight. 2018 May 3;3(9). RNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLF pii: 99357. [Epub ahead of print] TVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADP FQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDI LFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYE ICVCPDGKLYLSVAGVSTTCQEHSHICL Host: Rabbit Reactivity: Human Applications: IP, WB-Ti, WB-Tr (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: No additive Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 6445 Gene Symbol: SGCG Gene Alias: A4, DAGA4, DMDA, DMDA1, LGMD2C, MAM, MGC130048, SCARMD2, SCG3, TYPE Gene Summary: This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages1 Page
-
File Size-