DOCSLIB.ORG

Impedes Transport of GRK1 and PDE6 Catalytic Subunits to Photoreceptor Outer Segments

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Impedes Transport of GRK1 and PDE6 Catalytic Subunits to Photoreceptor Outer Segments Deletion of PrBP/␦ impedes transport of GRK1 and PDE6 catalytic subunits to photoreceptor outer segments H. Zhang*, S. Li*, T. Doan†, F. Rieke†‡, P. B. Detwiler†, J. M. Frederick*, and W. Baehr*§¶ʈ *John A. Moran Eye Center, University of Utah Health Science Center, Salt Lake City, UT 84132; †Department of Physiology and Biophysics and ‡Howard Hughes Medical Institute, University of Washington, Seattle, WA 98195; and Departments of §Neurobiology and Anatomy and ¶Biology, University of Utah, Salt Lake City, UT 84112 Edited by Jeremy Nathans, Johns Hopkins University School of Medicine, Baltimore, MD, and approved April 11, 2007 (received for review February 23, 2007) The mouse Pde6d gene encodes a ubiquitous prenyl binding chains (5, 7). Posttranslational sorting and targeting of proteins protein, termed PrBP/␦, of largely unknown physiological function. occurs in all cells and is of particular importance in photore- PrBP/␦ was originally identified as a putative rod cGMP phospho- ceptors, which renew their entire outer segments roughly every diesterase (PDE6) subunit in the retina, where it is relatively 10 days (8). Because of compartmentalization of inner and outer abundant. To investigate the consequences of Pde6d deletion in segments and very active metabolism, photoreceptors are re- .retina, we generated a Pde6d؊/؊ mouse by targeted recombina- garded as model cells to study protein trafficking tion. Although manifesting reduced body weight, the Pde6d؊/؊ PrBP/␦, originally thought to be a subunit of PDE6 and termed mouse was viable and fertile and its retina developed normally. PDE␦ (9), was shown recently to be a prenyl binding protein (10, Immunocytochemistry showed that farnesylated rhodopsin kinase 11) and subsequently named PrBP/␦ to reflect this fact (12). ␦ (GRK1) and prenylated rod PDE6 catalytic subunits partially mis- PrBP/ orthologs are present in the eyeless Caenorhabditis localized in Pde6d؊/؊ rods, whereas rhodopsin was unaffected. In elegans that does not express PDE6 (13), essentially excluding a ؊/؊ role of PrBP/␦ as PDE6 subunit (see also ref. 12). Genetic and Pde6d rod single-cell recordings, sensitivity to single photons ␦ was increased and saturating flash responses were prolonged. biochemical interaction screens showed that PrBP/ can interact Pde6d؊/؊ scotopic paired-flash electroretinograms indicated a de- with prenylated as well as nonprenylated proteins. Interactions lay in recovery of the dark state, likely due to reduced levels of with prenylated small GTPases of the Ras superfamily (12, -؊ ؊ 14–16), with a prenylated prostacyclin receptor, a G protein GRK1 in rod outer segments. In Pde6d / cone outer segments, coupled receptor located on blood vessels (17), as well as with GRK1 and cone PDE6␣؅ were present at very low levels and the nonprenylated small GTPases (Arl2 and Arl3) (18) are well photopic b-wave amplitudes were reduced by 70%. Thus the ␦ established, but the physiological significance of these interac- absence of PrBP/ in retina impairs transport of prenylated pro- tions is largely undefined. In the retina, PrBP/␦ was shown to teins, particularly GRK1 and cone PDE, to rod and cone outer interact in vitro with the RCC1-like domain of the retinitis segments, resulting in altered photoreceptor physiology and a pigmentosa G protein regulator (RPGR) (19, 20), the prenyl phenotype of a slowly progressing rod/cone dystrophy. chains of rhodopsin kinase (GRK1) (10), and PDE6␣ and PDE6␤ subunits (10, 13). prenyl binding protein ͉ rod/cone dystrophy ͉ vesicular transport ͉ Here, we investigated the consequences of PrBP/␦ deficiency on isoprenylation ͉ membrane association rod and cone photoreceptor function by targeted deletion of its gene in mouse. We show that loss of PrBP/␦ does not affect mouse he phototransduction cascade converts light into an electrical embryogenesis or viability, suggesting that other prenyl binding Tsignal, thereby initiating vision in photoreceptors of the proteins may substitute for the loss of PrBP/␦. In retina, we found retina (1, 2). The cascade relies on membrane association of its that the expression levels of farnesylated GRK1 and geranylgera- key components transducin (T␣,-␤, and -␥), cGMP phospho- nylated cone PDE6 subunits were down-regulated and that these proteins do not transport effectively to the outer segments, thereby diesterase (PDE6␣,-␤, and -␥2), and rhodopsin kinase (GRK1). Membrane association of these proteins is mediated by post- affecting photoreceptor physiology and stability. translational N-terminal acylation or C-terminal prenylation (3). Results The T␣ subunits are acylated heterogeneously, the T␥ subunit, Generation of Pde6d؊/؊ Mice. A Pde6dflox/flox mouse line was PDE6␣ subunit, and GRK1 are farnesylated (C15 side chain), and PDE6␤ and cone PDE6␣Ј subunits are geranylgeranylated established by inserting loxP sites flanking exons 2 and 4 of the CELL BIOLOGY (C20 side chain) (for references, see ref. 1). Prenyl side chains are synthesized in all living organisms via the mevalonate pathway Author contributions: H.Z., F.R., P.B.D., J.M.F., and W.B. designed research; H.Z., S.L., T.D., and attached to newly synthesized cytosolic proteins carrying a and J.M.F. performed research; H.Z., S.L., F.R., P.B.D., J.M.F., and W.B. analyzed data; and C-terminal CaaX box motif (C, cysteine; a, aliphatic amino acid; W.B. wrote the paper. X, any amino acid) (4, 5). The prenyl chain is attached to the The authors declare no conflict of interest. cysteine of the CaaX motif via a thioether bond by cytosolic This article is a PNAS Direct Submission. prenyl transferases (6). Prenylated proteins dock to the endo- Abbreviations: T␣, transducin ␣-subunit; T␥, transducin ␥-subunit; COS, cone outer seg- plasmic reticulum (ER) and are further processed by ER- ments; ER, endoplasmic reticulum; GC1, guanylate cyclase-1 (Gucy2f); GRK1, G protein- associated proteins (7). coupled receptor kinase 1 or rhodopsin kinase; ONL, outer nuclear layer containing photoreceptor nuclei; PDE, phosphodiesterase; ERG, electroretinogram; ROS, rod outer Transport of membrane-associated proteins from the ER to segments. the photoreceptor outer segments is inadequately understood. ʈTo whom correspondence should be addressed at: Department of Ophthalmology, Transport likely involves protein transfer to vesicular carriers University of Utah Health Science Center, 65 N. Medical Drive, Salt Lake City, UT 84132. and intraflagellar transport mechanisms through the cilium E-mail: [email protected]. connecting inner and outer segments. Transfer between mem- This article contains supporting information online at www.pnas.org/cgi/content/full/ branes is thought to be mediated by cytosolic prenyl binding 0701681104/DC1. proteins, with a hydrophobic groove accommodating prenyl side © 2007 by The National Academy of Sciences of the USA www.pnas.org͞cgi͞doi͞10.1073͞pnas.0701681104 PNAS ͉ May 22, 2007 ͉ vol. 104 ͉ no. 21 ͉ 8857–8862 Downloaded by guest on October 5, 2021 A B C D EF Fig. 2. Confocal immunolocalizations of GRK1, rod PDE6, and T␥ in WT (A, C, and E) and Pde6dϪ/Ϫ (B, D, and F) retina cryosections. (A and B) Immuno- reactivity for GRK1 is prominent over rod and cone outer segments (OS) in WT retina although nearly undetectable in Pde6dϪ/Ϫ rod and cone OS. (C and D) Localizations of rod PDE6 in WT and Pde6dϪ/Ϫ retinas, respectively (MOE antibody; Cytosignal). Rod PDE6 labeling is typically restricted to rod OS in WT retina. Aberrant distribution of rod PDE6 was observed in inner segments and synaptic terminals of Pde6dϪ/Ϫ rods. (E and F) Distributions of rod T␥ in WT and Pde6dϪ/Ϫ retinas, respectively. T␥ mislocalizes, in part, to the inner segment, Ϫ/Ϫ Fig. 1. Knockout strategy and phenotype of Pde6d mice. (A) Generation perinuclear, and synaptic regions (white arrows) of Pde6dϪ/Ϫ photoreceptors. Ϫ/Ϫ of Pde6d mice. Structure of the WT Pde6d gene (a), the targeting vector (b), In each image, propidium iodide (red) demonstrates the extent of the ONL by and the disrupted Pde6d gene (c) are shown schematically. Blue triangles binding nucleic acids (both DNA and RNA). (Scale bars: 10 ␮m.) IS, inner denote loxP, and black rectangles denote exons; F1, F2, and R are primers used segments; OPL, outer plexiform layer. for genotyping. TK, thymidine kinase. (B) Genotyping of Pde6dϪ/Ϫ mice by PCR. Amplification with primers PDE6D-F2 and PDE6D-R verified the deletion of sequence between loxP sites. Amplification with primers PDE6D-F1 and in GRK1 expression in rods, whereas cone arrestin levels were PDE6D-R confirmed the WT Pde6d allele. (C) Immunoblots of 1- to 2-month- old WT and Pde6dϪ/Ϫ retina lysates. PDE, rod PDE6 catalytic subunits; cPDE, unaffected (data not shown). cone PDE6 catalytic subunit; RK, GRK1; T␥, rod T␥ subunit; Arr, rod arrestin; ؊/؊ Rho, rhodopsin; T␣, rod T␣ subunit; ␤-T, ␤-tubulin as an internal control. Mislocalization of Prenylated Proteins in Pde6d Rods. The distri- Prenylated PDE6 subunits, farnesylated GRK1, and T␥ appear down- bution of farnesylated GRK1, known to interact with PrBP/␦ regulated, whereas rod arrestin is up-regulated. Acylated T␣ and Rho protein strongly (10), was examined in frozen sections of mouse retina. levels appear unaffected by deletion of the Pde6d gene. (D) Labeling of WT Anti-GRK1 antibody G8 labeled WT photoreceptor outer seg- and Pde6dϪ/Ϫ frozen sections with polyclonal anti-PrBP/␦ antibody. Sections ments, particularly those of cones (Fig. 2A), but surprisingly, were subjected to antigen retrieval (see Methods) before blocking and incu- immunolabeling was absent in Pde6dϪ/Ϫ rod and cone outer bating with primary antibody. PrBP/␦ (red) is most prominent in the inner segments (COS) (Fig. 2B). The observed posttranslational segments of rods and cones. (Scale bar: 10 ␮m.) (E) Pde6dϪ/Ϫ mice (2 months ␦ Ϫ Ϫ ϩ ϩ down-regulation of GRK1 in the absence of PrBP/ (Fig. 1C) old) were consistently smaller. (Upper) Female ( / ) and ( / ) littermates. may be due to failed transport and consequent instability. To test (Lower) Male (ϩ/ϩ) and (Ϫ/Ϫ) littermates. this hypothesis, we monitored the stability of GRK1 in retina extracts over a period of5hinthepresence and absence of ␦ Ϫ Ϫ recombinant PrBP/ (supporting information (SI) Fig.
Load more

Recommended publications
  • Reprogramming Metabolism by Targeting Sirtuin 6 Attenuates Retinal Degeneration
    The Journal of Clinical Investigation RESEARCH ARTICLE Reprogramming metabolism by targeting sirtuin 6 attenuates retinal degeneration Lijuan Zhang,1,2,3 Jianhai Du,4 Sally Justus,1,2 Chun-Wei Hsu,1,2 Luis Bonet-Ponce,5 Wen-Hsuan Wu,1,2 Yi-Ting Tsai,1,2 Wei-Pu Wu,1,2 Yading Jia,2 Jimmy K. Duong,6 Vinit B. Mahajan,7 Chyuan-Sheng Lin,8 Shuang Wang,6 James B. Hurley,4 and Stephen H. Tsang1,2,9 1The Jonas Children’s Vision Care and Bernard & Shirlee Brown Glaucoma Laboratory, Department of Ophthalmology, Columbia University, New York, New York, USA. 2Edward S. Harkness Eye Institute, New York-Presbyterian Hospital, New York, New York, USA. 3Shanxi Eye Hospital, affiliated with Shanxi Medical University, Xinghualing, Taiyuan, China. 4Department of Biochemistry and Ophthalmology, University of Washington, Seattle, Washington, USA. 5Section on Retinal Ganglion Cell Biology, Laboratory of Retinal Cell and Molecular Biology, NIH, Bethesda, Maryland, USA. 6Department of Biostatistics, Mailman School of Public Health, Columbia University Medical Center, New York, New York, USA. 7Omics Lab, University of Iowa, Iowa City, Iowa, USA. 8Department of Pathology and Cell Biology, Herbert Irving Comprehensive Cancer Center, College of Physicians and Surgeons of Columbia University, New York, New York, USA. 9Departments of Pathology and Cell Biology, Institute of Human Nutrition, College of Physicians and Surgeons, Columbia University, New York, New York, USA. Retinitis pigmentosa (RP) encompasses a diverse group of Mendelian disorders leading to progressive degeneration of rods and then cones. For reasons that remain unclear, diseased RP photoreceptors begin to deteriorate, eventually leading to cell death and, consequently, loss of vision.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Arp73034 P050
    Aviva Systems Biology PDE6D Antibody - N-terminal region (ARP73034_P050) Product Number ARP73034_P050 Product Page http://www.avivasysbio.com/pde6d-antibody-n-terminal-region-arp73034-p050.html Product Name PDE6D Antibody - N-terminal region (ARP73034_P050) Size 100 ul Gene Symbol PDE6D Alias Symbols PDE6D, PDED, Protein Size (# AA) 150 amino acids Molecular Weight 16kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 5147 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Description This is a rabbit polyclonal antibody against PDE6D. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: NLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ Description of PDE6D acts as a GTP specific dissociation inhibitor (GDI). It increases the affinity of Target ARL3 for GTP by several orders of magnitude and does so by decreasing the nucleotide dissociation rate. It stabilizes ARL3-GTP by decreasing the nucleotide dissociation. Protein Interactions ARL16; ARL2; UBC; PTGIR; COPS5; CUL1; FAM219A; ARL15; RND1; GRK7; RAD23A; ARL3; CETN3; RAB13; RAB18; RHEB; RPGR; HRAS; GRK1; RAP2B; RAP1A; RHOA; RHOB; RAB8A; GNAI1; RASA1; CDC42; Reconstitution and For short term use, store at 2-8C up to 1 week.
    [Show full text]
  • It Takes Two Transducins to Activate the Cgmp-Phosphodiesterase 6 in Retinal Rods Rsob.Royalsocietypublishing.Org Bilal M
    It takes two transducins to activate the cGMP-phosphodiesterase 6 in retinal rods rsob.royalsocietypublishing.org Bilal M. Qureshi1,†,‡, Elmar Behrmann1,†,}, Johannes Scho¨neberg2,jj, Justus Loerke1,Jo¨rg Bu¨rger1, Thorsten Mielke1,3, Jan Giesebrecht1,§, Frank Noe´2, Trevor D. Lamb4, Klaus Peter Hofmann1,5, Christian M. T. Spahn1 and Martin Heck1 Research 1Institut fu¨r Medizinische Physik und Biophysik, Charite´ – Universita¨tsmedizin Berlin, corporate member Cite this article: Qureshi BM et al. 2018 It of Freie Universita¨t Berlin, Humboldt-Universita¨t zu Berlin, and Berlin Institute of Health, Berlin, Germany 2Department of Mathematics, Computer Science and Bioinformatics, Freie Universita¨t Berlin, Berlin, Germany takes two transducins to activate the cGMP- 3Microscopy and Cryo Electron Microscopy Group, Max-Planck Institut fu¨r Molekulare Genetik, Berlin, Germany phosphodiesterase 6 in retinal rods. Open Biol. 4Eccles Institute of Neuroscience, John Curtin School of Medical Research, Australian National University, 8: 180075. Canberra, Australian Capital Territory 2600, Australia 5 http://dx.doi.org/10.1098/rsob.180075 Zentrum fu¨r Biophysik und Bioinformatik, Humboldt-Universita¨t zu Berlin, Berlin, Germany BMQ, 0000-0002-0153-7729; TDL, 0000-0003-0299-6115; MH, 0000-0003-0847-5038 Received: 28 April 2018 Accepted: 6 July 2018 Among cyclic nucleotide phosphodiesterases (PDEs), PDE6 is unique in serving as an effector enzyme in G protein-coupled signal transduction. In Subject Area: retinal rods and cones, PDE6 is membrane-bound and activated to hydrolyse biochemistry/biophysics/structural biology its substrate, cGMP, by binding of two active G protein a-subunits (Ga*). To investigate the activation mechanism of mammalian rod PDE6, we Keywords: have collected functional and structural data, and analysed them by reac- PDE6, visual signal transduction, coincidence tion–diffusion simulations.
    [Show full text]
  • Genetic Variation in Phosphodiesterase (PDE) 7B in Chronic Lymphocytic Leukemia: Overview of Genetic Variants of Cyclic Nucleotide Pdes in Human Disease
    Journal of Human Genetics (2011) 56, 676–681 & 2011 The Japan Society of Human Genetics All rights reserved 1434-5161/11 $32.00 www.nature.com/jhg ORIGINAL ARTICLE Genetic variation in phosphodiesterase (PDE) 7B in chronic lymphocytic leukemia: overview of genetic variants of cyclic nucleotide PDEs in human disease Ana M Peiro´ 1,2, Chih-Min Tang1, Fiona Murray1,3, Lingzhi Zhang1, Loren M Brown1, Daisy Chou1, Laura Rassenti4, Thomas A Kipps3,4 and Paul A Insel1,3,4 Expression of cyclic adenosine monophosphate-specific phosphodiesterase 7B (PDE7B) mRNA is increased in patients with chronic lymphocytic leukemia (CLL), thus suggesting that variation may occur in the PDE7B gene in CLL. As genetic variation in other PDE family members has been shown to associate with numerous clinical disorders (reviewed in this manuscript), we sought to identify single-nucleotide polymorphisms (SNPs) in the PDE7B gene promoter and coding region of 93 control subjects and 154 CLL patients. We found that the PDE7B gene has a 5¢ non-coding region SNP À347C4T that occurs with similar frequency in CLL patients (1.9%) and controls (2.7%). Tested in vitro, À347C4T has less promoter activity than a wild-type construct. The low frequency of this 5¢ untranslated region variant indicates that it does not explain the higher PDE7B expression in patients with CLL but it has the potential to influence other settings that involve a role for PDE7B. Journal of Human Genetics (2011) 56, 676–681; doi:10.1038/jhg.2011.80; published online 28 July 2011 Keywords: cAMP; chronic lymphocytic
    [Show full text]
  • G Protein-Coupled Receptors
    www.aladdin-e.com Address:800 S Wineville Avenue, Ontario, CA 91761,USA Website:www.aladdin-e.com Email USA: [email protected] Email EU: [email protected] Email Asia Pacific: [email protected] G PROTEIN-COUPLED RECEPTORS Overview: The completion of the Human Genome Project allowed the identification of a large family of proteins with a common motif of seven groups of 20–24 hydrophobic amino acids arranged as a-helices. Approximately 800 of these seven transmembrane (7TM) receptors have been identified of which over 300 are non-olfactory receptors (see Fredriksson et al., 2003; Lagerstrom and Schioth, 2008). Subdivision on the basis of sequence homology allows the definition of rhodopsin, secretin, adhesion, glutamate and Frizzled receptor families. NC-IUPHAR recognizes Classes A, B, and C, which equate to the rhodopsin, secretin, and glutamate receptor families. The nomenclature of 7TM receptors is commonly used interchangeably with G protein-coupled receptors (GPCR), although the former nomenclature recognises signalling of 7TM receptors through pathways not involving G proteins. For example, adiponectin and membrane progestin receptors have some sequence homology to 7TM receptors but signal independently of G proteins and appear to reside in membranes in an inverted fashion compared to conventional GPCR. Additionally, the NPR-C natriuretic peptide receptor (see Page S195) has a single transmembrane domain structure, but appears to couple to G proteins to generate cellular responses. The 300+ non-olfactory GPCR are the targets for the majority of drugs in clinical usage (Overington et al., 2006), although only a minority of these receptors are exploited therapeutically.
    [Show full text]
  • G Protein-Coupled Receptors
    G PROTEIN-COUPLED RECEPTORS Overview:- The completion of the Human Genome Project allowed the identification of a large family of proteins with a common motif of seven groups of 20-24 hydrophobic amino acids arranged as α-helices. Approximately 800 of these seven transmembrane (7TM) receptors have been identified of which over 300 are non-olfactory receptors (see Frederikson et al., 2003; Lagerstrom and Schioth, 2008). Subdivision on the basis of sequence homology allows the definition of rhodopsin, secretin, adhesion, glutamate and Frizzled receptor families. NC-IUPHAR recognizes Classes A, B, and C, which equate to the rhodopsin, secretin, and glutamate receptor families. The nomenclature of 7TM receptors is commonly used interchangeably with G protein-coupled receptors (GPCR), although the former nomenclature recognises signalling of 7TM receptors through pathways not involving G proteins. For example, adiponectin and membrane progestin receptors have some sequence homology to 7TM receptors but signal independently of G-proteins and appear to reside in membranes in an inverted fashion compared to conventional GPCR. Additionally, the NPR-C natriuretic peptide receptor has a single transmembrane domain structure, but appears to couple to G proteins to generate cellular responses. The 300+ non-olfactory GPCR are the targets for the majority of drugs in clinical usage (Overington et al., 2006), although only a minority of these receptors are exploited therapeutically. Signalling through GPCR is enacted by the activation of heterotrimeric GTP-binding proteins (G proteins), made up of α, β and γ subunits, where the α and βγ subunits are responsible for signalling. The α subunit (tabulated below) allows definition of one series of signalling cascades and allows grouping of GPCRs to suggest common cellular, tissue and behavioural responses.
    [Show full text]
  • PDE6) by the Glutamic Acid- Rich Protein-2 (GARP2)
    University of New Hampshire University of New Hampshire Scholars' Repository Doctoral Dissertations Student Scholarship Fall 2013 Regulation of the catalytic and allosteric properties of photoreceptor phosphodiesterase (PDE6) by the glutamic acid- rich protein-2 (GARP2) Wei Yao Follow this and additional works at: https://scholars.unh.edu/dissertation Recommended Citation Yao, Wei, "Regulation of the catalytic and allosteric properties of photoreceptor phosphodiesterase (PDE6) by the glutamic acid-rich protein-2 (GARP2)" (2013). Doctoral Dissertations. 747. https://scholars.unh.edu/dissertation/747 This Dissertation is brought to you for free and open access by the Student Scholarship at University of New Hampshire Scholars' Repository. It has been accepted for inclusion in Doctoral Dissertations by an authorized administrator of University of New Hampshire Scholars' Repository. For more information, please contact [email protected]. REGULATION OF THE CATALYTIC AND ALLOSTERIC PROPERTIES OF PHOTORECEPTOR PHOSPHODIESTERASE (PDE6) BY THE GLUTAMIC ACID-RICH PROTEIN-2 (GARP2) BY WEI YAO B.S., Jinan University, 2007 DISSERTATION Submitted to the University of New Hampshire in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy in Biochemistry September, 2013 UMI Number: 3575987 All rights reserved INFORMATION TO ALL USERS The quality of this reproduction is dependent upon the quality of the copy submitted. In the unlikely event that the author did not send a complete manuscript and there are missing pages, these will be noted. Also, if material had to be removed, a note will indicate the deletion. Di!ss0?t&iori Piiblist’Mlg UMI 3575987 Published by ProQuest LLC 2013. Copyright in the Dissertation held by the Author.
    [Show full text]
  • Novel Candidate Genes of Thyroid Tumourigenesis Identified in Trk-T1 Transgenic Mice
    Endocrine-Related Cancer (2012) 19 409–421 Novel candidate genes of thyroid tumourigenesis identified in Trk-T1 transgenic mice Katrin-Janine Heiliger*, Julia Hess*, Donata Vitagliano1, Paolo Salerno1, Herbert Braselmann, Giuliana Salvatore 2, Clara Ugolini 3, Isolde Summerer 4, Tatjana Bogdanova5, Kristian Unger 6, Gerry Thomas6, Massimo Santoro1 and Horst Zitzelsberger Research Unit of Radiation Cytogenetics, Helmholtz Zentrum Mu¨nchen, Ingolsta¨dter Landstr. 1, 85764 Neuherberg, Germany 1Istituto di Endocrinologia ed Oncologia Sperimentale del CNR, c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare, Universita` Federico II, Naples 80131, Italy 2Dipartimento di Studi delle Istituzioni e dei Sistemi Territoriali, Universita` ‘Parthenope’, Naples 80133, Italy 3Division of Pathology, Department of Surgery, University of Pisa, 56100 Pisa, Italy 4Institute of Radiation Biology, Helmholtz Zentrum Mu¨nchen, 85764 Neuherberg, Germany 5Institute of Endocrinology and Metabolism, Academy of Medical Sciences of the Ukraine, 254114 Kiev, Ukraine 6Department of Surgery and Cancer, Imperial College London, Hammersmith Hospital, London W12 0HS, UK (Correspondence should be addressed to H Zitzelsberger; Email: [email protected]) *(K-J Heiliger and J Hess contributed equally to this work) Abstract For an identification of novel candidate genes in thyroid tumourigenesis, we have investigated gene copy number changes in a Trk-T1 transgenic mouse model of thyroid neoplasia. For this aim, 30 thyroid tumours from Trk-T1 transgenics were investigated by comparative genomic hybridisation. Recurrent gene copy number alterations were identified and genes located in the altered chromosomal regions were analysed by Gene Ontology term enrichment analysis in order to reveal gene functions potentially associated with thyroid tumourigenesis. In thyroid neoplasms from Trk-T1 mice, a recurrent gain on chromosomal bands 1C4–E2.3 (10.0% of cases), and losses on 3H1–H3 (13.3%), 4D2.3–E2 (43.3%) and 14E4–E5 (6.7%) were identified.
    [Show full text]
  • Balancing the Photoreceptor Proteome: Proteostasis Network Therapeutics for Inherited Retinal Disease
    G C A T T A C G G C A T genes Review Balancing the Photoreceptor Proteome: Proteostasis Network Therapeutics for Inherited Retinal Disease Siebren Faber and Ronald Roepman * Department of Human Genetics and Radboud Institute for Molecular Life Sciences, Radboud University Medical Center, Geert Grooteplein Zuid 10, 6525 GA Nijmegen, The Netherlands * Correspondence: [email protected] Received: 10 June 2019; Accepted: 16 July 2019; Published: 24 July 2019 Abstract: The light sensing outer segments of photoreceptors (PRs) are renewed every ten days due to their high photoactivity, especially of the cones during daytime vision. This demands a tremendous amount of energy, as well as a high turnover of their main biosynthetic compounds, membranes, and proteins. Therefore, a refined proteostasis network (PN), regulating the protein balance, is crucial for PR viability. In many inherited retinal diseases (IRDs) this balance is disrupted leading to protein accumulation in the inner segment and eventually the death of PRs. Various studies have been focusing on therapeutically targeting the different branches of the PR PN to restore the protein balance and ultimately to treat inherited blindness. This review first describes the different branches of the PN in detail. Subsequently, insights are provided on how therapeutic compounds directed against the different PN branches might slow down or even arrest the appalling, progressive blinding conditions. These insights are supported by findings of PN modulators in other research disciplines. Keywords: protein trafficking; protein folding; protein degradation; chaperones; chaperonins; heat shock response; unfolded protein response; autophagy; therapy 1. Introduction The rod and cone photoreceptor (PR) cells are the most abundant cell types in the human retina, with ~6.4 million cones and up to 125 million rods per adult retina [1].
    [Show full text]
  • Development of Novel Drugs Targeting Chaperones of Oncogenic K-Ras
    Farid Ahmad Siddiqui Farid Ahmad Siddiqui // Development of Novel Drugs Development of Novel Drugs Targeting Chaperones of Oncogenic K-Ras of Oncogenic Chaperones K-Ras Drugs Targeting of Novel Development Targeting Chaperones of Oncogenic K-Ras // 2021 9 789521 240317 ISBN 978-952-12-4031-7 Development of Novel Drugs Targeting Chaperones of Oncogenic K-Ras Farid Ahmad Siddiqui Cell Biology Faculty of Science and Engineering, Åbo Akademi University Turku Bioscience Centre University of Turku & Åbo Akademi University Turku, Finland, 2021 From the Turku Bioscience Centre, University of Turku and Åbo Akademi University, Faculty of Science and Engineering, Åbo Akademi University, Turku, Finland Supervised by Prof. Daniel Abankwa, PhD Department of Life Sciences and Medicine University of Luxembourg, Belval campus Luxembourg Reviewed by Prof. Olli Mikael Carpen, PhD Faculty of Medicine University of Helsinki Helsinki, Finland and Prof. Klaus Elenius, PhD Faculty of Medicine University of Turku Turku, Finland Opponent Prof. Krishnaraj Rajalingam, PhD Head, Cell Biology Unit, UMC-Mainz, Germany Author’s address Turku Bioscience Centre Åbo Akademi University Tykistökatu 6 20520 Turku Finland Email: [email protected] ISBN 978-952-12-4031-7 (printed) ISBN 978-952-12-4032-4 (digital) Painosalama Oy, Turku, Finland 2021 TABLE OF CONTENTS ABSTRACT .......................................................................................................... 6 ABSTRAKT (Swedish Abstract) .........................................................................
    [Show full text]
  • Phosphodiesterase Inhibitors: Their Role and Implications
    International Journal of PharmTech Research CODEN (USA): IJPRIF ISSN : 0974-4304 Vol.1, No.4, pp 1148-1160, Oct-Dec 2009 PHOSPHODIESTERASE INHIBITORS: THEIR ROLE AND IMPLICATIONS Rumi Ghosh*1, Onkar Sawant 1, Priya Ganpathy1, Shweta Pitre1 and V.J.Kadam1 1Dept. of Pharmacology ,Bharati Vidyapeeth’s College of Pharmacy, University of Mumbai, Sector 8, CBD Belapur, Navi Mumbai -400614, India. *Corres.author: rumi 1968@ hotmail.com ABSTRACT: Phosphodiesterase (PDE) isoenzymes catalyze the inactivation of intracellular mediators of signal transduction such as cAMP and cGMP and thus have pivotal roles in cellular functions. PDE inhibitors such as theophylline have been employed as anti-asthmatics since decades and numerous novel selective PDE inhibitors are currently being investigated for the treatment of diseases such as Alzheimer’s disease, erectile dysfunction and many others. This review attempts to elucidate the pharmacology, applications and recent developments in research on PDE inhibitors as pharmacological agents. Keywords: Phosphodiesterases, Phosphodiesterase inhibitors. INTRODUCTION Alzheimer’s disease, COPD and other aliments. By cAMP and cGMP are intracellular second messengers inhibiting specifically the up-regulated PDE isozyme(s) involved in the transduction of various physiologic with newly synthesized potent and isoezyme selective stimuli and regulation of multiple physiological PDE inhibitors, it may possible to restore normal processes, including vascular resistance, cardiac output, intracellular signaling selectively, providing therapy with visceral motility, immune response (1), inflammation (2), reduced adverse effects (9). neuroplasticity, vision (3), and reproduction (4). Intracellular levels of these cyclic nucleotide second AN OVERVIEW OF THE PHOSPHODIESTERASE messengers are regulated predominantly by the complex SUPER FAMILY superfamily of cyclic nucleotide phosphodiesterase The PDE super family is large, complex and represents (PDE) enzymes.
    [Show full text]