ACD Monoclonal Antibody (M02), Clone 1D8-1B6

Total Page：16

File Type：pdf, Size：1020Kb

ACD Monoclonal Antibody (M02), Clone 1D8-1B6

ACD monoclonal antibody (M02), Storage Instruction: Store at -20°C or lower. Aliquot to clone 1D8-1B6 avoid repeated freezing and thawing. Catalog Number: H00065057-M02 Entrez GeneID: 65057 Regulatory Status: For research use only (RUO) Gene Symbol: ACD Product Description: Mouse monoclonal antibody Gene Alias: PIP1, PTOP, TINT1, TPP1 raised against a full length recombinant ACD. Gene Summary: This gene encodes a protein that is Clone Name: 1D8-1B6 involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric Immunogen: ACD (AAH16904, 1 a.a. ~ 544 a.a) complex, which functions to maintain telomere length full-length recombinant protein with GST tag. MW of the and to protect telomere ends. Through its interaction GST tag alone is 26 KDa. with other components, this protein plays a key role in the assembly and stabilization of this complex, and it Sequence: mediates the access of telomerase to the telomere. MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRA Multiple transcript variants encoding different isoforms GRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAP have been found for this gene. This gene, which is also AGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSET referred to as TPP1, is distinct from the unrelated TPP1 PSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLL gene on chromosome 11, which encodes VSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLL tripeptidyl-peptidase I. [provided by RefSeq] LLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRL RVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLSQ References: LLDEMREDQEHQGALVCLAESCLTLEGPCTAPPVTHW 1. An N-terminal Flag-tag impairs TPP1 regulation of AASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQR telomerase function. Sandhu R, Wei D, Sharma M, Xu L. TQGPELPPPDPALQDLSLTLIASPPSSPSSSGTPALPG Biochem Biophys Res Commun. 2019 Apr HMSSEESGTSISLLPALSLAAPDPGQRSSSQPSPAICS 30;512(2):230-235. doi: 10.1016/j.bbrc.2019.03.050. APATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPH Epub 2019 Mar 15. QALVTRPQKPSLEFKEFVGLPCKNRPPFPRTGATRGA 2. Human Cactin interacts with DHX8 and SRRM2 to QEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQA assure efficient pre-mRNA splicing and sister chromatid ARLPPQLMAWALHFLMDAQPGSEPTPM cohesion. Zanini IM, Soneson C, Lorenzi LE, Azzalin CM. J Cell Sci. 2017 Feb 15;130(4):767-778. Epub 2017 Host: Mouse Jan 6. 3. The Shelterin TIN2 Subunit Mediates Recruitment of Reactivity: Human Telomerase to Telomeres. Frank AK, Tran DC, Qu RW, Stohr BA, Segal DJ, Xu L. PLoS Genet. 2015 Jul Applications: ELISA, IF, IHC-P, IP, S-ELISA, WB-Re 31;11(7):e1005410. (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG1 Kappa Storage Buffer: In 1x PBS, pH 7.4 Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Parallel Molecular Evolution in Pathways, Genes, and Sites in High-Elevation Hummingbirds Revealed by Comparative Transcriptomics
GBE Parallel Molecular Evolution in Pathways, Genes, and Sites in High-Elevation Hummingbirds Revealed by Comparative Transcriptomics Marisa C.W. Lim1,*, Christopher C. Witt2, Catherine H. Graham1,3,andLilianaM.Davalos 1,4 1Department of Ecology and Evolution, Stony Brook University 2 Museum of Southwestern Biology and Department of Biology, University of New Mexico Downloaded from https://academic.oup.com/gbe/article-abstract/11/6/1552/5494706 by guest on 08 June 2019 3Swiss Federal Research Institute (WSL), Birmensdorf, Switzerland 4Consortium for Inter-Disciplinary Environmental Research, Stony Brook University *Corresponding author: E-mail: [email protected]. Accepted: May 12, 2019 Data deposition: The raw read data have been deposited in the NCBI Sequence Read Archive under BioProject: PRJNA543673, BioSample: SAMN11774663-SAMN11774674, SRA Study: SRP198856. All scripts used for analyses are available on Dryad: doi:10.5061/dryad.v961mb4. Abstract High-elevation organisms experience shared environmental challenges that include low oxygen availability, cold temperatures, and intense ultraviolet radiation. Consequently, repeated evolution of the same genetic mechanisms may occur across high-elevation taxa. To test this prediction, we investigated the extent to which the same biochemical pathways, genes, or sites were subject to parallel molecular evolution for 12 Andean hummingbird species (family: Trochilidae) representing several independent transitions to high elevation across the phylogeny. Across high-elevation species, we discovered parallel evolution for several pathways and genes with evidence of positive selection. In particular, positively selected genes were frequently part of cellular respiration, metabolism, or cell death pathways. To further examine the role of elevation in our analyses, we compared results for low- and high-elevation species and tested different thresholds for deﬁning elevation categories.
[Show full text]
PDF Datasheet
Product Datasheet Cactin Overexpression Lysate NBP2-06542 Unit Size: 0.1 mg Store at -80C. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/NBP2-06542 Updated 3/17/2020 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/NBP2-06542 Page 1 of 2 v.20.1 Updated 3/17/2020 NBP2-06542 Cactin Overexpression Lysate Product Information Unit Size 0.1 mg Concentration The exact concentration of the protein of interest cannot be determined for overexpression lysates. Please contact technical support for more information. Storage Store at -80C. Avoid freeze-thaw cycles. Buffer RIPA buffer Target Molecular Weight 88.5 kDa Product Description Description Transient overexpression lysate of chromosome 19 open reading frame 29 (C19orf29), transcript variant 2 The lysate was created in HEK293T cells, using Plasmid ID RC213573 and based on accession number NM_021231. The protein contains a C-MYC/DDK Tag. Gene ID 58509 Gene Symbol CACTIN Species Human Notes HEK293T cells in 10-cm dishes were transiently transfected with a non-lipid polymer transfection reagent specially designed and manufactured for large volume DNA transfection. Transfected cells were cultured for 48hrs before collection. The cells were lysed in modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4, and then centrifuged to clarify the lysate. Protein concentration was measured by BCA protein assay kit.This product is manufactured by and sold under license from OriGene Technologies and its use is limited solely for research purposes.
[Show full text]
Characterisation of Expression Patterns and Functional Role of Cactin in Early Zebrafish Development
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by MURAL - Maynooth University Research Archive Library Gene Expression Patterns 10 (2010) 199–206 Contents lists available at ScienceDirect Gene Expression Patterns journal homepage: www.elsevier.com/locate/gep Characterisation of expression patterns and functional role of Cactin in early zebrafish development Paola Atzei a, Fan Yang b, Ross Collery b, Breandan N. Kennedy b,1, Paul N. Moynagh a,*,1 a Institute of Immunology, National University of Ireland Maynooth, Maynooth, Co. Kildare, Ireland b UCD School of Biomolecular and Biomedical Sciences, UCD Conway Institute, University College Dublin, Dublin 4, Ireland article info abstract Article history: The immune system of teleost zebrafish (Danio rerio) shows high similarity to mammalian counterparts Received 21 December 2009 sharing many innate immune components including Toll-Like Receptors (TLRs), cytokines, chemokines Received in revised form 12 March 2010 and complement molecules. As in mammals, zebrafish also contains the transcription factor NF-jB that Accepted 19 March 2010 plays dualist roles in innate immunity and early development. Indeed NF-jB members are expressed in Available online 27 March 2010 different temporal patterns during the early stages of zebrafish embryogenesis indicating that each mol- ecule is involved in specific developmental events. In the present study we employ zebrafish as a model Keywords: to characterise the expression pattern and role of a novel NF-jB regulator, termed Cactin, in early devel- Toll-like receptors opment. Cactin was first characterised in Drosophila as a new member of the Rel pathway that could NF-jB Cactin affect the generation of dorsal–ventral polarity.
[Show full text]
Downloaded the “Top Edge” Version
bioRxiv preprint doi: https://doi.org/10.1101/855338; this version posted December 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 Drosophila models of pathogenic copy-number variant genes show global and 2 non-neuronal defects during development 3 Short title: Non-neuronal defects of fly homologs of CNV genes 4 Tanzeen Yusuff1,4, Matthew Jensen1,4, Sneha Yennawar1,4, Lucilla Pizzo1, Siddharth 5 Karthikeyan1, Dagny J. Gould1, Avik Sarker1, Yurika Matsui1,2, Janani Iyer1, Zhi-Chun Lai1,2, 6 and Santhosh Girirajan1,3* 7 8 1. Department of Biochemistry and Molecular Biology, Pennsylvania State University, 9 University Park, PA 16802 10 2. Department of Biology, Pennsylvania State University, University Park, PA 16802 11 3. Department of Anthropology, Pennsylvania State University, University Park, PA 16802 12 4 contributed equally to work 13 14 *Correspondence: 15 Santhosh Girirajan, MBBS, PhD 16 205A Life Sciences Building 17 Pennsylvania State University 18 University Park, PA 16802 19 E-mail: [email protected] 20 Phone: 814-865-0674 21 1 bioRxiv preprint doi: https://doi.org/10.1101/855338; this version posted December 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 22 ABSTRACT 23 While rare pathogenic copy-number variants (CNVs) are associated with both neuronal and non- 24 neuronal phenotypes, functional studies evaluating these regions have focused on the molecular 25 basis of neuronal defects.
[Show full text]
A Genome-Wide Rnai Screen for Modifiers of Polyglutamine-Induced Neurotoxicity in Drosophila
A Genome-Wide RNAi Screen for Modifiers of Polyglutamine-Induced Neurotoxicity in Drosophila Doctoral Thesis In partial fulfilment of the requirements for the degree “Doctor rerum naturalium (Dr. rer. nat.)” in the Molecular Medicine Study Programme at the Georg-August University Göttingen submitted by Hannes Voßfeldt born in Zerbst/Anhalt, Germany Göttingen, January 2012 FÜR MEINE FAMILIE - IM GEDENKEN AN NADINE DU FEHLST. … IT MATTERS NOT HOW STRAIT THE GATE, HOW CHARGED WITH PUNISHMENTS THE SCROLL, I AM THE MASTER OF MY FATE: I AM THE CAPTAIN OF MY SOUL. … Invictus – William Ernest Henley Members of the Thesis Committee: Supervisor Prof. Dr. med. Jörg B. Schulz Head of Department of Neurology University Medical Centre RWTH Aachen University Pauwelsstrasse 30 52074 Aachen Second member of the Thesis Committee Prof. Dr. rer. nat. Ernst A. Wimmer Head of Department of Developmental Biology Johann Friedrich Blumenbach Institute of Zoology and Anthropology Georg-August University Göttingen Justus-von-Liebig-Weg 11 37077 Göttingen Third member of the Thesis Committee Dr. rer. nat. Till Marquardt Research Group Developmental Neurobiology European Neuroscience Institute Göttingen Grisebachstrasse 5 37077 Göttingen Date of Disputation: 2 April 2012 Affidavit I hereby declare that my doctoral thesis entitled “A Genome-Wide RNAi Screen for Modifiers of Polyglutamine-Induced Neurotoxicity in Drosophila” has been written independently with no other sources and aids than quoted. Göttingen, January 2012 Hannes Voßfeldt LIST OF PUBLICATIONS IV List of Publications Parts of this work have already been published with authorisation of Prof. Jörg B. Schulz, Head of the Department of Neurology, University Medical Centre of the RWTH Aachen University, on behalf of the thesis committee.
[Show full text]
Mrna Editing, Processing and Quality Control in Caenorhabditis Elegans
| WORMBOOK mRNA Editing, Processing and Quality Control in Caenorhabditis elegans Joshua A. Arribere,*,1 Hidehito Kuroyanagi,†,1 and Heather A. Hundley‡,1 *Department of MCD Biology, UC Santa Cruz, California 95064, †Laboratory of Gene Expression, Medical Research Institute, Tokyo Medical and Dental University, Tokyo 113-8510, Japan, and ‡Medical Sciences Program, Indiana University School of Medicine-Bloomington, Indiana 47405 ABSTRACT While DNA serves as the blueprint of life, the distinct functions of each cell are determined by the dynamic expression of genes from the static genome. The amount and specific sequences of RNAs expressed in a given cell involves a number of regulated processes including RNA synthesis (transcription), processing, splicing, modification, polyadenylation, stability, translation, and degradation. As errors during mRNA production can create gene products that are deleterious to the organism, quality control mechanisms exist to survey and remove errors in mRNA expression and processing. Here, we will provide an overview of mRNA processing and quality control mechanisms that occur in Caenorhabditis elegans, with a focus on those that occur on protein-coding genes after transcription initiation. In addition, we will describe the genetic and technical approaches that have allowed studies in C. elegans to reveal important mechanistic insight into these processes. KEYWORDS Caenorhabditis elegans; splicing; RNA editing; RNA modification; polyadenylation; quality control; WormBook TABLE OF CONTENTS Abstract 531 RNA Editing and Modification 533 Adenosine-to-inosine RNA editing 533 The C. elegans A-to-I editing machinery 534 RNA editing in space and time 535 ADARs regulate the levels and fates of endogenous dsRNA 537 Are other modifications present in C.
[Show full text]
Human Social Genomics in the Multi-Ethnic Study of Atherosclerosis
Getting “Under the Skin”: Human Social Genomics in the Multi-Ethnic Study of Atherosclerosis by Kristen Monét Brown A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Epidemiological Science) in the University of Michigan 2017 Doctoral Committee: Professor Ana V. Diez-Roux, Co-Chair, Drexel University Professor Sharon R. Kardia, Co-Chair Professor Bhramar Mukherjee Assistant Professor Belinda Needham Assistant Professor Jennifer A. Smith © Kristen Monét Brown, 2017 [email protected] ORCID iD: 0000-0002-9955-0568 Dedication I dedicate this dissertation to my grandmother, Gertrude Delores Hampton. Nanny, no one wanted to see me become “Dr. Brown” more than you. I know that you are standing over the bannister of heaven smiling and beaming with pride. I love you more than my words could ever fully express. ii Acknowledgements First, I give honor to God, who is the head of my life. Truly, without Him, none of this would be possible. Countless times throughout this doctoral journey I have relied my favorite scripture, “And we know that all things work together for good, to them that love God, to them who are called according to His purpose (Romans 8:28).” Secondly, I acknowledge my parents, James and Marilyn Brown. From an early age, you two instilled in me the value of education and have been my biggest cheerleaders throughout my entire life. I thank you for your unconditional love, encouragement, sacrifices, and support. I would not be here today without you. I truly thank God that out of the all of the people in the world that He could have chosen to be my parents, that He chose the two of you.
[Show full text]
CD4+ T Cells from Children with Active Juvenile Idiopathic Arthritis Show
www.nature.com/scientificreports OPEN CD4+ T cells from children with active juvenile idiopathic arthritis show altered chromatin features associated with transcriptional abnormalities Evan Tarbell1,3,5,7, Kaiyu Jiang2,7, Teresa R. Hennon2, Lucy Holmes2, Sonja Williams2, Yao Fu4, Patrick M. Gafney4, Tao Liu1,3,6 & James N. Jarvis2,3* Juvenile idiopathic arthritis (JIA) is one of the most common chronic diseases in children. While clinical outcomes for patients with juvenile JIA have improved, the underlying biology of the disease and mechanisms underlying therapeutic response/non-response are poorly understood. We have shown that active JIA is associated with distinct transcriptional abnormalities, and that the attainment of remission is associated with reorganization of transcriptional networks. In this study, we used a multi- omics approach to identify mechanisms driving the transcriptional abnormalities in peripheral blood CD4+ T cells of children with active JIA. We demonstrate that active JIA is associated with alterations in CD4+ T cell chromatin, as assessed by ATACseq studies. However, 3D chromatin architecture, assessed by HiChIP and simultaneous mapping of CTCF anchors of chromatin loops, reveals that normal 3D chromatin architecture is largely preserved. Overlapping CTCF binding, ATACseq, and RNAseq data with known JIA genetic risk loci demonstrated the presence of genetic infuences on the observed transcriptional abnormalities and identifed candidate target genes. These studies demonstrate the utility of multi-omics approaches for unraveling important questions regarding the pathobiology of autoimmune diseases. Juvenile idiopathic arthritis (JIA) is a broad term that describes a clinically heterogeneous group of diseases characterized by chronic synovial hypertrophy and infammation, with onset before 16 years of age 1.
[Show full text]
Integrative Prediction of Functionally Relevant Sumoylated Proteins
bioRxiv preprint doi: https://doi.org/10.1101/056564; this version posted December 21, 2016. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. iSUMO - integrative prediction of functionally relevant SUMOylated proteins Xiaotong Yao1,2, Shashank Gandhi1, 3, Rebecca Bish1, Christine Vogel1* 1 Center for Genomics and Systems Biology, New York University, New York, USA 2 Tri-Institutional Program in Computational Biology and Medicine, New York, USA 3 Division of Biology and Biological Engineering, California Institute of Technology, Pasadena, California, USA * Corresponding author: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/056564; this version posted December 21, 2016. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract Post-translational modifications by the Small Ubiquitin-like Modifier (SUMO) are essential for many eukaryotic cellular functions. Several large-scale experimental datasets and sequence-based predictions exist that identify SUMOylated proteins. However, the overlap between these datasets is small, suggesting many false positives with low functional relevance. Therefore, we applied machine learning techniques to a diverse set of large-scale SUMOylation studies combined with protein characteristics such as cellular function and protein-protein interactions, to provide integrated SUMO predictions for human and yeast cells (iSUMO).
[Show full text]
Characterization of Long Non-Coding Rnas in Systemic Sclerosis Monocytes: a Potential Role for PSMB8-AS1 in Altered Cytokine Secretion
International Journal of Molecular Sciences Article Characterization of Long Non-Coding RNAs in Systemic Sclerosis Monocytes: A Potential Role for PSMB8-AS1 in Altered Cytokine Secretion Nila H. Servaas 1,2,†, Barbara Mariotti 3,† , Maarten van der Kroef 1,2, Catharina G. K. Wichers 1,2, Aridaman Pandit 1,2 , Flavia Bazzoni 3, Timothy R. D. J. Radstake 1,2 and Marzia Rossato 4,* 1 Center for Translational Immunology, University Medical Center Utrecht, Utrecht University, 3584 CX Utrecht, The Netherlands; [email protected] (N.H.S.); [email protected] (M.v.d.K.); [email protected] (C.G.K.W.); [email protected] (A.P.); [email protected] (T.R.D.J.R.) 2 University Medical Center Utrecht, Department of Rheumatology and Clinical Immunology, Utrecht University, 3584 CX Utrecht, The Netherlands 3 Division of General Pathology, Department of Medicine, University of Verona, 37134 Verona, Italy; [email protected] (B.M.); fl[email protected] (F.B.) 4 Department of Biotechnology, University of Verona, 37134 Verona, Italy * Correspondence: [email protected] † These authors contributed equally. Abstract: Systemic sclerosis (SSc) is a chronic autoimmune disease mainly affecting the connective tissue. In SSc patients, monocytes are increased in circulation, infiltrate affected tissues, and show a Citation: Servaas, N.H.; Mariotti, B.; pro-inflammatory activation status, including the so-called interferon (IFN) signature. We previously van der Kroef, M.; Wichers, C.G.K.; demonstrated that the dysregulation of the IFN response in SSc monocytes is sustained by altered Pandit, A.; Bazzoni, F.; Radstake, epigenetic factors as well as by upregulation of the long non-coding RNA (lncRNA) NRIR.
[Show full text]
Genome-Wide Association Study Implicates Novel Loci and Reveals Candidate Effector
medRxiv preprint doi: https://doi.org/10.1101/2020.02.17.20024133; this version posted February 20, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted medRxiv a license to display the preprint in perpetuity. It is made available under a CC-BY-NC-ND 4.0 International license . Genome-wide association study implicates novel loci and reveals candidate effector genes for longitudinal pediatric bone accrual through variant-to-gene mapping Diana L. Cousminer#*1,2,3, Yadav Wagley#4, James A. Pippin#3, Ahmed Elhakeem5, Gregory P. Way6,7, Shana E. McCormack8, Alessandra Chesi3, Jonathan A. Mitchell9,10, Joseph M. Kindler10, Denis Baird5, April Hartley5, Laura Howe5, Heidi J. Kalkwarf11, Joan M. Lappe12, Sumei Lu3, Michelle Leonard3, Matthew E. Johnson3, Hakon Hakonarson1,3,9,13, Vicente Gilsanz14, John A. Shepherd15, Sharon E. Oberfield16, Casey S. Greene17,18, Andrea Kelly8,9, Deborah Lawlor5, Benjamin F. Voight2,17,19, Andrew D. Wells3,20, Babette S. Zemel9,10, Kurt Hankenson#4 and Struan F. A. Grant#*1,2,3,8,9 1Division of Human Genetics, Children’s Hospital of Philadelphia, Philadelphia, PA 2Department of Genetics, University of Pennsylvania, Philadelphia, PA 3Center for Spatial and Functional Genomics, Children’s Hospital of Philadelphia, Philadelphia, PA 4Department of Orthopedic Surgery, University of Michigan Medical School, Ann Arbor, MI 5MRC Integrative Epidemiology Unit, Population Health Science, Bristol Medical School, University of Bristol, Bristol, UK 6Genomics
[Show full text]
A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression
Supplementary Materials A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression Table S1. Statistically significant DEGs (Adj. p-value < 0.01) derived from meta-analysis for samples irradiated with high doses of HZE particles, collected 6-24 h post-IR not common with any other meta- analysis group. This meta-analysis group consists of 3 DEG lists obtained from DGEA, using a total of 11 control and 11 irradiated samples [Data Series: E-MTAB-5761 and E-MTAB-5754]. Ensembl ID Gene Symbol Gene Description Up-Regulated Genes ↑ (2425) ENSG00000000938 FGR FGR proto-oncogene, Src family tyrosine kinase ENSG00000001036 FUCA2 alpha-L-fucosidase 2 ENSG00000001084 GCLC glutamate-cysteine ligase catalytic subunit ENSG00000001631 KRIT1 KRIT1 ankyrin repeat containing ENSG00000002079 MYH16 myosin heavy chain 16 pseudogene ENSG00000002587 HS3ST1 heparan sulfate-glucosamine 3-sulfotransferase 1 ENSG00000003056 M6PR mannose-6-phosphate receptor, cation dependent ENSG00000004059 ARF5 ADP ribosylation factor 5 ENSG00000004777 ARHGAP33 Rho GTPase activating protein 33 ENSG00000004799 PDK4 pyruvate dehydrogenase kinase 4 ENSG00000004848 ARX aristaless related homeobox ENSG00000005022 SLC25A5 solute carrier family 25 member 5 ENSG00000005108 THSD7A thrombospondin type 1 domain containing 7A ENSG00000005194 CIAPIN1 cytokine induced apoptosis inhibitor 1 ENSG00000005381 MPO myeloperoxidase ENSG00000005486 RHBDD2 rhomboid domain containing 2 ENSG00000005884 ITGA3 integrin subunit alpha 3 ENSG00000006016 CRLF1 cytokine receptor like
[Show full text]