
ACD monoclonal antibody (M02), Storage Instruction: Store at -20°C or lower. Aliquot to clone 1D8-1B6 avoid repeated freezing and thawing. Catalog Number: H00065057-M02 Entrez GeneID: 65057 Regulatory Status: For research use only (RUO) Gene Symbol: ACD Product Description: Mouse monoclonal antibody Gene Alias: PIP1, PTOP, TINT1, TPP1 raised against a full length recombinant ACD. Gene Summary: This gene encodes a protein that is Clone Name: 1D8-1B6 involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric Immunogen: ACD (AAH16904, 1 a.a. ~ 544 a.a) complex, which functions to maintain telomere length full-length recombinant protein with GST tag. MW of the and to protect telomere ends. Through its interaction GST tag alone is 26 KDa. with other components, this protein plays a key role in the assembly and stabilization of this complex, and it Sequence: mediates the access of telomerase to the telomere. MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRA Multiple transcript variants encoding different isoforms GRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAP have been found for this gene. This gene, which is also AGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSET referred to as TPP1, is distinct from the unrelated TPP1 PSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLL gene on chromosome 11, which encodes VSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLL tripeptidyl-peptidase I. [provided by RefSeq] LLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRL RVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLSQ References: LLDEMREDQEHQGALVCLAESCLTLEGPCTAPPVTHW 1. An N-terminal Flag-tag impairs TPP1 regulation of AASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQR telomerase function. Sandhu R, Wei D, Sharma M, Xu L. TQGPELPPPDPALQDLSLTLIASPPSSPSSSGTPALPG Biochem Biophys Res Commun. 2019 Apr HMSSEESGTSISLLPALSLAAPDPGQRSSSQPSPAICS 30;512(2):230-235. doi: 10.1016/j.bbrc.2019.03.050. APATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPH Epub 2019 Mar 15. QALVTRPQKPSLEFKEFVGLPCKNRPPFPRTGATRGA 2. Human Cactin interacts with DHX8 and SRRM2 to QEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQA assure efficient pre-mRNA splicing and sister chromatid ARLPPQLMAWALHFLMDAQPGSEPTPM cohesion. Zanini IM, Soneson C, Lorenzi LE, Azzalin CM. J Cell Sci. 2017 Feb 15;130(4):767-778. Epub 2017 Host: Mouse Jan 6. 3. The Shelterin TIN2 Subunit Mediates Recruitment of Reactivity: Human Telomerase to Telomeres. Frank AK, Tran DC, Qu RW, Stohr BA, Segal DJ, Xu L. PLoS Genet. 2015 Jul Applications: ELISA, IF, IHC-P, IP, S-ELISA, WB-Re 31;11(7):e1005410. (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG1 Kappa Storage Buffer: In 1x PBS, pH 7.4 Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages1 Page
-
File Size-