Développement D'outils Et De Ressources Moléculaires Pour L'utilisation De L'espèce Hebeloma Cylindrosporum Comme Modèle D'étude De La Symbiose Ectomycorhizienne

Home , Orellani

Développement d’outils et de ressources moléculaires pour l’utilisation de l’espèce Hebeloma cylindrosporum comme modèle d’étude de la symbiose ectomycorhizienne Raphaël Lambilliotte

To cite this version:

Raphaël Lambilliotte. Développement d’outils et de ressources moléculaires pour l’utilisation de l’espèce Hebeloma cylindrosporum comme modèle d’étude de la symbiose ectomycorhizienne. Biochimie, Biologie Moléculaire. Université de montpellier 2, 2004. Français. tel-02551724

HAL Id: tel-02551724 https://tel.archives-ouvertes.fr/tel-02551724 Submitted on 23 Apr 2020

HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. UNIVERSITE MONTPELLIER II SCIENCES ET TECHNIQUES DU LANGUEDOC

THESE

pour obtenir le grade de

DOCTEUR DE L'UNIVERSITE MONTPELLIER II

Discipline : Physiologie Formation doctorale : Développement et adaptation des plantes Ecole Doctorale : Biologie intégrative

présentée et soutenue publiquement

par

Raphaël Lambilliotte

Le 21 décembre 2004

Titre :

Développement d'outils et de ressources moléculaires pour l'utilisation de l'espèce Hebeloma cylindrosporum comme modèle d'étude de la symbiose ectomycorhizienne

Travail réalisé dans le laboratoire de Biochimie et Physiologie Moléculaire des Plantes UMR 5004 Agro-M/CNRS/INRA/Université Montpellier II 2, Place Viala 34060 Montpellier cedex 1

JURY :

M. Richard Cooke, Directeur de Recherche, CNRS Perpignan Rapporteur M. Francis Martin, Directeur de Recherche, INRA Nancy Rapporteur M. Roland Marmeisse, Chargé de Recherche, CNRS Lyon Examinateur M. Bruno Touraine, Professeur, Université Montpellier II Président du jury Mme Sabine Zimmermann, Chargé de recherche, CNRS Montpellier Co-directrice de thèse M. Hervé Sentenac, Directeur de Recherche, INRA Montpellier Directeur de thèse Six années déjà, beaucoup d'eau a coulé sous le pont depuis mon arrivée au Laboratoire de Biochimie et Physiologie Moléculaires des Plantes. Ces années ont été difficiles pour moi et j'ai vécu cette période comme une épreuve que je n'ai guère savourée. Pourtant, cela m'a permis d'acquérir des bases solides pour appréhender le présent et le futur sereinement avec dorénavant une démarche qui m'est propre. C'est en quoi cette expérience a été essentielle et j'exprime ici toute ma gratitude aux nombreux Êtres que j'ai côtoyés et rencontrés. La richesse de ces contacts et échanges de par leur large diversité ont été pour moi une source de réflexion et de prise de conscience extraordinaire. J'éprouve un profond respect et une grande reconnaissance à ces Êtres qui de façon brève ou prolongée, ponctuelle ou soutenue ont été présents et ont contribué à ce travail de thèse. Merci Abréviations

ADN: acide désoxyribonucléique ADNc: ADN complémentaire ADNg: ADN génomique ARN: acide ribonucléique ARNm: ARN messager BEt: bromure d'éthydium BSA: albumine de sérum de bœuf CI: mélange chloroforme/alcool isoamylique (48/2) DEPC: diéthylpyrocarbonate dNTP: désoxyribonucléotide triphosphate DTT: dithiothréitol EDTA: acide ethylènediaminetétraacétique GUS: ß-glucuronidase kb: kilopaire de bases LB: milieu de Luria et Bertani -1 LBM: milieu LB additioné 0,2% de maltose et 10 mmol.L de MgSO4 nt: nucléotide pb: paire de bases PCI: mélange phénol/chloroforme/alcool isoamylique (50/48/2) PCR: réaction en chaine à la polymérase PEG: polyéthylène glycol p/v: rapport poids/volume RACE: amplification rapide des extrémités d'ADNc RLM-RACE: amplification rapide des extrémités d'ADNc médiatisé par l'ARN ligase rpm: rotation par minute SDS: dodécylsulfate de sodium SSC: solution de chlorure de sodium 3M et de citrate trisodique 0,03 M TE: tampon tris-EDTA TEA: tétraéthyl ammonium Tris: tris-(hydroxyméthyl)aminométhane v/v: rapport volume/volume Table des matières

Table des matières...... 1

Introduction générale ...... 4

Chapitre 1 Données bibliographiques: Mycorhization, nutrition minérale de la plante et transports membranaires...... 5 1.1. Les différents types de mycorhize...... 5 1.2. Effets favorables de l'ectomycorhization sur la nutrition minérale de l'arbre...... 6 1.3. Exploration du sol et coût énergétique de la fonction de nutrition minérale ...... 7

Annexe 1 du chapitre 1 An update on nutrient transport processes in ectomycorrhizas...... 8

Annexe 2 du chapitre 1 Hebeloma cylindrosporum – a model species to study ectomycorrhizal symbiosis from gene to ecosystem ...... 9

Chapitre 2 Matériel et Méthodes...... 10 2.1. Matériel fongique et conditions de culture ...... 10 2.1.1. Souches utilisées ...... 10 2.1.2. Milieux de culture ...... 10 2.1.3. Conditions de culture...... 11 2.2. Méthodes de biologie moléculaire...... 12 2.2.1. Les banques utilisées...... 12 2.2.1.1. La banque d’ADNc...... 12 2.2.1.2. La banque génomique ...... 12 2.2.2. Criblage de la banque d'ADN génomique...... 12 2.2.3. Extraction d’ADN de phages ...... 13 2.2.4. Complémentation fonctionnelle de mutants de levure par la banque d'ADNc...... 14 2.2.5. Purification de l'ADN génomique d'Hebeloma ...... 14 2.2.6. Purification des ARN d’H. cylindrosporum ...... 15

1 2.2.7. Hybridations moléculaires: Southern et northern blots ...... 15 2.2.8. Amplification des acides nucléiques par PCR ...... 16 2.2.9. Amplification des régions manquantes des ADNc par RACE-PCR...... 17 2.2.9.1. RACE-PCR classique ...... 17 2.2.9.2. Utilisation du kit "FirstChoice® RLM RACE" d'Ambion...... 18 2.2.10. Production et ordonnancement d'une banque d'ADNc ...... 18

2.3. Analyses bioinformatiques...... 19 2.3.1. Matériel et logiciels...... 19 2.3.2. Traitement des séquences et analyse de la ressource d'étiquettes ...... 20

Chapitre 3 Participation au développement d'Hebeloma cylindrosporum en tant qu'espèce modèle: construction d'une banque d'ADNc et d'une ressource d'étiquettes...... 22

Chapitre 4 Identification d'un canal potassique de la famille Shaker chez Hebeloma cylindrosporum...... 23 4.1. Eléments bibliographiques...... 23 4.1.1. Rôles du potassium dans la cellule...... 23 4.1.2. Les systèmes de transport de K+ chez les plantes et chez les champignons: données cinétiques et électrophysiologiques ...... 24 4.1.2.1. Données chez les plantes...... 24 4.1.2.2. Données chez les levures et champignons filamenteux...... 25 4.1.3. Les systèmes de transport de K+ chez les plantes et chez les champignons: données moléculaires ...... 26 4.1.3.1. Les canaux potassiques ...... 26 4.1.3.2. Les transporteurs ...... 28

4.2. Résultats ...... 30 4.2.1. Identification d'une étiquette codant un canal potassique de la famille Shaker...... 30 4.2.2. Relations phylogénétiques du canal au sein de la superfamille Shaker...... 31 4.2.3. Le génome de la souche h1 d'Hebeloma présente plusieurs copies du gène HcSKC...... 31 4.2.4. Identification de clones génomiques présentant une copie du gène HcSKC ...... 32 4.2.5. Analyse phylogénétique des copies du gène HcSKC identifiées chez la souche h1 ...... 34 4.2.6. Analyse du gène HcSKC1...... 35 4.2.7. Recherche d'un ADNc HcSKC1 complet ...... 35 4.2.8. Expression du gène HcSKC chez le champignon cultivé in vitro: effet de la disponibilité de K+ sur l'accumulation du transcrit...... 40

2 4.2.9. Essais d'expression fonctionnelle de HcSKC1 en système hétérologue...... 40

4.3. Discussion ...... 41 4.3.1. HcSKC code une sous-unité de canal potassique proche de la sous-famille Shaker animale . 41 4.3.2. Des gènes orthologues d'HcSKC existent chez d'autres espèces fongiques basidiomycètes.. 41 4.3.3. Le gène HcSKC a été dupliqué plusieurs fois dans une souche ancestrale du monocaryon h1 ...... 42 4.3.4. Des incertitudes existent encore concernant la séquence 5' du transcrit et de la région N-terminale du polypeptide ...... 43 4.3.5. Conclusion et perspectives ...... 44

Chapitre 5 Conclusion générale et perspectives...... 45

Références bibliographiques...... 48

3 Introduction générale

La symbiose mycorhizienne* concerne 95% des espèces végétales et constitue un phénomène majeur dans les écosystèmes terrestres. La plante retire de cette symbiose une amélioration de sa nutrition minérale parce que le champignon lui rétrocède une partie des éléments nutritifs qu'il prélève dans le sol. En retour, la plante fournit au champignon les photosynthétats nécessaires à son développement. Les systèmes de transport de solutés présents sur la membrane plasmique du champignon et de la plante jouent ainsi un rôle central dans la relation symbiotique. Il est donc très important de développer les connaissances, au niveau moléculaire, relatives à la nature de ces systèmes, leurs caractéristiques fonctionnelles et leur régulation. Le travail présenté dans ce mémoire s'est inscrit dans ce cadre général, et a utilisé le champignon ectomycorhizien Hebeloma cylindrosporum comme modèle.

*Dans ce texte, sauf précision contraire, l'expression symbiose mycorhizienne est utilisée de façon générique pour désigner à la fois les symbioses ecto- et endo-mycorhizienne. La distinction entre champignon ecto- et endo-mycorhizien est expliquée dans le paragraphe 1.1. Dans les deux cas, la symbiose améliore la nutrition minérale de la plante hôte.

5 1. Chapitre 1

Données bibliographiques:

Mycorhization, nutrition minérale de la plante

et transports membranaires

Ce chapitre résume brièvement les données générales concernant la fonction de nutrition minérale de la plante et la symbiose mycorhizienne. Il présente en annexe un article de revue consacré aux mécanismes de transport membranaire chez les champignons ectomycorhiziens (Chalot et al., 2002), puis un article de revue sur les avantages que présente Hebeloma cylindrosporum en tant que modèle de champignon ectomycorhizien (Marmeisse et al., 2004). Notre contribution à ces deux articles traduit essentiellement le fait que nous avons produit et mis à la disposition de notre communauté une ressource d'étiquettes d'Hebeloma cylindrosporum (Cf. chapitre 3), identifiant de nombreux systèmes de transport membranaire.

1.1. Les différents types de mycorhize Les mycorhizes sont des organes symbiotiques associant les racines d'une plante au mycélium d'un champignon. Cette symbiose concerne 95% des espèces végétales. Elle se rencontre dans tous les écosystèmes, chez les plantes ligneuses comme chez les plantes de grande culture. Seules quelques familles végétales, comme les Crucifères, sont rarement mycorhizées en conditions naturelles (Le Tacon, 1985). La généralité de cette association "champignons-phanérogames" en fait un phénomène biologique majeur des écosystèmes terrestres. Les structures générées par l'association mycorhizienne peuvent être classées sur la base de critères anatomiques, morphologiques et physiologiques. Classiquement, on distingue (i) les endomycorhizes (le préfixe endo fait référence au fait que les hyphes franchissent les parois et "repoussent" le plasmalemme des cellules hôtes, sans pour autant pénétrer le protoplaste), (ii) les ectomycorhizes (les hyphes mycéliennes progressent entre les cellules du cortex racinaire, au niveau de la lamelle moyenne, sans

7 jamais traverser la paroi des cellules), et (iii) les ectendomycorhizes (qui combinent à la fois des caractères d'ecto- et d'endomycorhizes). Le présent projet de recherche concerne les champignons ectomycorhiziens. La plupart sont des homobasidiomycètes (c'est le cas du modèle retenu pour ce projet: Hebeloma cylindrosporum), mais certains ascomycètes et quelques rares zygomycètes sont également susceptibles de former des ectomycorhizes. Les ectomycorhizes ne se rencontrent pratiquement que sur des espèces ligneuses, qui représentent moins de 3% des taxons végétaux mais qui constituent l'essentiel des forêts des régions tempérées, montagneuses et boréales (Harley, 1984). Dans ces associations arbre-champignon, le mycélium forme un manchon continu autour de la racine. Les hyphes qui s'insinuent entre les cellules de l'épiderme et du cortex racinaire constituent le réseau de Hartig. A l'extérieur de ce réseau et du manchon périphérique, le champignon explore le sol par l'intermédiaire d'hyphes individuelles, de rhizomorphes et/ou de cordons mycéliens. La symbiose mycorhizienne favorise la croissance de l'espèce-hôte. Elle pourrait augmenter la résistance des racines à certains pathogènes du sol (Smith & Read, 1997). On considère cependant que le phénomène le plus important est une amélioration de la nutrition minérale de l'hôte (Smith & Read, 1997).

1.2. Effets favorables de l'ectomycorhization sur la nutrition minérale de l'arbre De nombreux travaux indiquent que la mycorhization favorise l'acquisition par la plante de la plupart des éléments nutritifs (N, P, K et micro-éléments) (Harley & Smith, 1983). L'augmentation (par rapport à un contrôle non mycorhizé) est particulièrement marquée pour les ions dont la disponibilité est la plus limitante dans le sol. La productivité des écosystèmes forestiers naturels des régions tempérées est très fréquemment limitée par la disponibilité de P. De ce fait, et aussi du fait de l'existence d'un traceur commode (32P), les études les plus détaillées ont concerné l'effet de la symbiose sur la nutrition phosphatée (Harley & Smith, 1983; Smith & Read, 1997). Les mécanismes impliqués dans l'amélioration de la nutrition minérale de la plante par le champignon n'ont pas encore été réellement élucidés, en particulier du fait de l'absence d'approches moléculaires et génétiques dans ce domaine. Deux hypothèses, non exclusives l'une de l'autre, sont cependant très généralement acceptées (Harley & Smith, 1983; Clarkson, 1985; Marschner & Dell, 1994). (1) Pour une même quantité de carbone allouée à la fonction d'acquisition des ions nutritifs (Cf. paragraphe 1.1.), la mycorhization permettrait d'augmenter le volume de sol exploré. (2) L'hyphe mycélienne aurait une aptitude plus grande que celle de la racine à mobiliser des éléments nutritifs peu disponibles (e.g. phosphore présent dans les composés organiques du sol, ions K+ liés au réseau cristallin des phyllosilicates) (Jongmans et al., 1997). En complément de cette seconde hypothèse, il est fréquemment suggéré que le champignon disposerait de

8 systèmes d'absorption plus performants que ceux de la plante (Jongmans et al., 1997; Selosse & Le Tacon, 1999). 1.3. Exploration du sol et coût énergétique de la fonction de nutrition minérale Dans les écosystèmes naturels, les ions nutritifs sont relativement peu abondants dans la solution du sol, et généralement peu mobiles car adsorbés sur les colloïdes de la phase solide. Les capacités d'absorption de la racine sont telles que les ions sont prélevés plus rapidement qu'ils ne diffusent dans le sol. Il en résulte une zone d'épuisement autour de la racine. La plante doit en permanence développer son système racinaire de façon à explorer de nouveaux volumes de sol. Lorsque la disponibilité des ions dans le milieu diminue, la quantité de photosynthétats alloués au développement du système racinaire augmente, et peut représenter plus de la moitié du carbone fixé: chez le blé, le rapport du poids de matière sèche des racines sur celui des parties aériennes peut augmenter de 0,3 à 4 lorsque la disponibilité du phosphate dans le sol diminue (Barrett-Lennard et al., 1982). La mycorhization, qui favorise la nutrition de la plante-hôte, a un coût. Chez les plantes ectomycorhizées, la quantité de substrats carbonés transférés au symbiote représente entre 10 et 40% du carbone fixé par la plante (Reid et al., 1983; Durall et al., 1994; Rygiewicz & Andersen, 1994). L'exudation racinaire (polysaccharides, acides organiques, chélats, etc.) peut représenter une dépense énergétique équivalente à celle consommée par la respiration racinaire de maintenance. L'énergisation de la membrane plasmique et des systèmes d'absorption sensu stricto ne correspondrait en moyenne qu'à 20% de cette respiration (Penning de Vries, 1975). En conclusion, le coût énergétique de la fonction d'exploration du sol, incluant la croissance du système racinaire et les sécrétions dans la rhizosphère, excède très largement celui de l'énergisation de la membrane plasmique et des transports membranaires sensu stricto (Clarkson, 1985). Ainsi, bien que la mycorhization puisse représenter un investissement en photosynthétats important, il est raisonnable de considérer cette symbiose comme un processus permettant à la plante d'optimiser la dépense énergétique qu'elle doit consentir pour assurer sa nutrition minérale.

9 10 Annexe 1 du chapitre 1

An update on nutrient transport processes in ectomycorrhizas

Michel Chalot, Arnaud Javelle, Damien Blaudez, Raphaël Lambilliotte, Richard Cooke, Hervé Sentenac, Daniel Wipf et Bernard Botton

Plant and Soil (2002) 244: 165-175

Transports membranaires et échanges de nutriments entre les deux partenaires sont des fonctions essentielles de la symbiose. Cet article présente une revue des connaissances sur les mécanismes de transport membranaire chez les champignons ectomycorhiziens. Mobilisation des ions nutritifs dans le sol, absorption et transport sont analysés et résumés aux niveaux physiologique et écophysiologique. Au niveau moléculaire, le clonage et la caractérisation de différents systèmes de transport fongiques permet de développer les connaissances sur la nature de ces systèmes, leurs propriétés fonctionnelles et leur régulation. Le développement des outils et ressources moléculaires (banques ADNc et ADNg, étiquettes) accélère les progrès dans ce domaine. Par exemple, ont été caractérisés depuis la publication de cet article un transporteur d'acides aminés (Wipf et al., 2002), un transporteur de nitrate (Jargeat et al., 2003), un transporteur d'ammonium (Javelle et al., 2003), deux transporteurs de phosphate (Tatry, 2003), un transporteur de potassium (Corratgé, 1999) et un canal potassique (ce mémoire, chapitre 4) chez Hebeloma cylindrosporum, et un transporteur d'ammonium chez Tuber borchii (Montanini et al., 2002).

An update on nutrient transport processes in ectomycorrhizas

Michel Chalot1,5, Arnaud Javelle1, Damien Blaudez1, Raphaël Lambilliote2, Richard Cooke3, HerveSentenac´ 2, Daniel Wipf4 & Bernard Botton1 1UMR 1136 INRA/UHP IaM, Faculté des Sciences, 54506 Vandoeuvre, France. 2 BPMP, UMR 5004 CNRS / ENSA-Montpellier / INRA / UM2, Montpellier, France. 3 LPBMP, UMR 5545 CNRS, Université de Perpignan, Perpignan, France. 4Zentrum für Molekularbiologie der Pflanzen, Universität Tübingen, Auf der Morgenstelle 1, D-72076 Tübingen, Germany. 5Corresponding author∗

Received 19 September 2001. Accepted in revised form 7 February 2002

Key words: ectomycorrhizas, Hebeloma cylindrosporum, hyphae translocation, nutrient mobilization, transport processes.

Abstract Nutrient transport, namely absorption from the soil solution as well as nutrient transfer from fungus to plant and carbon movement from plant to fungus are key features of mycorrhizal symbiosis. This review summarizes our current understanding of nutrient transport processes in ectomycorrhizal fungi and ectomycorrhizas. The identiﬁcation of nutrient uptake mechanisms is a key issue in understanding nutrition of ectomycorrhizal plants. With the ongoing functional analysis of nutrient transporters, identiﬁed during sequencing of fungal and tree genomes, a picture of individual transport systems should be soon available, with their molecular functions assessed by functional characterization in, e.g., yeast mutant strains or Xenopus oocytes. Beyond the molecular function, systematic searches for knockout mutants will allow us to obtain a full understanding of the role of the individual transporter genes in the physiology of the symbionts. The mechanisms by which fungal and plant cells obtain, process and integrate information regarding nutrient levels in the external environment and the plant demand will be analyzed.

Introduction forms from more complex substrates (Perez-Moreno and Read, 2000; Smith and Read, 1997), and to the The favourable effects of ectomycorrhizal (ECM) direct mobilization of nutrients from minerals (for fungi on plant nutrition have traditionally been at- review, see Landeweert et al., 2001). Although in- tributed to the quantitative effect of the extraradical teractions between mycorrhizal fungi and other soil mycelium on uptake of dissolved nutrients from the microbes will not be detailed in the present review, this soil solution (Smith and Read, 1997). This intercon- key feature may have a substantial role on the nutrient nected network of hyphae (or specialized aggregates, economy of ectomycorrhizal trees, with respect to hy- i.e. rhizomorphs) forms a supracellular compartment drolysis of complex organic compounds (Koide and for the transport of nutrients from sites of nutrient Kabir, 2001) or organic acid excretion (Landeweert capture to sites of nutrient utilization and transfer. It et al., 2001). Translocation through the hyphal net- has been estimated that the external mycelium made work and further transfer of nutrients from fungus to by far the greatest contribution to the overall potential host root has also been discussed in detail (Smith and absorbing surface area of pine seedlings inoculated Read, 1997), but the intimate anatomical connections with Pisolithus tinctorius or Cenococcum geophilum between fungal and root cells presents considerable (Rousseau et al., 1994). Attention has been also paid technical difﬁculties for unambiguous experimental to the utilization of organic nitrogen and phosphorus investigations of nutrient transfer between fungus and ∗ host. Biochemical studies using detached mycorrhizal FAXNo:+333-83912243. E-mail: [email protected] roots or mycelia revealed the kinetic complexity of

13 166 nutrient transport. The interpretation of these studies et al., 1999; Van Tichelen and Colpaert, 2000). The was mainly hampered by the multiplicity of cell types intact extraradical mycelium greatly increased the ab- in symbiotic tissues and the uncertainty of whether sorption surface area of the roots (Van Tichelen and the different transport activities derived from one or Colpaert, 2000). P. involutus was found to be the more cell types (Javelle et al., 1999; Kreuzwieser et most efficient mycobiont with regard to P influx, with al., 2000; Van Tichelen and Colpaert, 2000). It is alowerKm value than the other pine-fungus asso- therefore essential to isolate individual carriers and to ciations tested in this study (Colpaert et al. 1999, study their properties, function and regulation before Figure 1). Comparing the effects of arbuscular mycor- relating them back to the whole plant/fungus level. rhizal (AM) and ectomycorrhizal fungi on P uptake This review will cover recent studies that have led us by Eucalyptus coccifera, Jones et al. (1998) found to consider the transport processes occurring in the that P inflow rates of ECM and AM seedlings were ectomycorrhizal network as a key determinant in the 3.8 times, and 2.0–2.7 times those of non-mycorrhizal nutrient economy of ectomycorrhizal plants. Recent seedlings. They also found that ECM and AM plants papers have reviewed the actual knowledge in plant- are more efficient than NM plants at acquiring P per fungus interactions on the basis of C and N availability unit of C allocated below-ground. Although numer- as investigated on selected laboratory models (Buscot ous data clearly indicate that ECM fungi can improve et al., 2000; Hampp et al., 1999; Nehls et al., 2001), Pi uptake, determination of P fluxes under various and therefore this aspect will not be detailed in the conditions also clearly demonstrate the heterogeneity present paper, except at the molecular level. of P uptake capacities among different mycobionts (Cairney and Smith, 1993). The identification of the P uptake mechanisms is therefore a key issue in Mobilization, absorption, translocation and understanding P nutrition of ectomycorrhizal plants. transfer of nutrients In a recent experiment, Jentschke et al. (2001a) demonstrated that P. involutus hyphae were able to Phosphorus take up and translocate significant amounts of P to their P-deficient host plant and therefore strongly im- Although the total amount of P in the soil may be proved host P status that in turn stimulated seedling high, it is a very immobile and unavailable element for growth. There is increasing evidence that P trans- plant uptake because of its adsorption, its precipitation location through hyphae occurs by active processes or its conversion to recalcitrant organic forms. It has (Ashford, 1998; Timonen et al., 1996). A role of tu- been suggested that ECM fungi stimulate the uptake bular vacuole system in longitudinal transport of P of P from poorly soluble sources in soil. Using mycor- in P. tinctorius hyphae has been hypothesized (Cole rhizal birch seedlings grown in observation chambers et al., 1998; see Ashford and Alloway, 2002). Using with the ECM fungus Paxillus involutus, losses of P X-ray spectroscopy, Bücking and Heyser (2000a) con- from a range of different fermentation horizons could cluded that the translocation of P from fungus to host be measured (Perez-Moreno and Read, 2000). This plant across the mycorrhizal interface is driven by P ability to forage P from litter horizons was related to concentration in the cytoplasm of the Hartig net and the capacity of the fungus to produce the necessary by efflux rate into the interfacial apoplast. However, enzymes (Bending and Read, 1995). Wallander et al. the detailed mechanism of P transfer at the symbiotic (1997) showed that some ECM fungi were able to interface remains obscure. improve the uptake of apatite-P by ECM pine seedlings. However, weathering capacities clearly varied among ECM fungi and it has been recently found that Nitrogen apatite-weathering ability of ECM fungi were some- + how related to their ability to produce oxalic acid In forest soils, N is present either as NH4 and/or − (Wallander, 2000a). as NO3 and organic compounds such as amino Furthermore, uptake of P by mycorrhizal fungi is acids, peptides and proteins (Chalot and Brun, 1998; a key determinant of the improved P nutrition of ecto- Marschner, 1995). The significance of mycorrhization mycorrhizal plants. Kinetics of net phosphate uptake for improved uptake of ammonium and organic N has by mycorrhizal versus non-mycorrhizal pine seed- been shown in several studies (Javelle et al., 1999; − lings has been recently studied in details (Colpaert Plassard et al., 2000), whereas its influence on NO3

14 167

Figure 1. Michaelis–Menten plot showing the net Pi uptake in intact mycorrhizal and non-mycorrhizal Pinus sylvestris seedlings as a function of solution Pi concentration. The inset figure shows the relationship at the lower Pi concentrations, most representative for soil solution Pi . Measurements were performed 9 weeks after inoculation and data points were fitted to a two-phase Michaelis–Menten equation. Data obtained with excised Fagus sylvatica – Lactarius subdulcis mycorrhiza are also plotted (Colpaert et al., 1999; with permission). uptake is still a controversial issue (Kreuzwieser et al., (Chalot and Brun, 1998; Näsholm and Persson, 2001; 2000; Plassard et al., 2000). Wallenda and Read, 1999). All of the major hydro- Ammonium mobilization by hyphae from soil lytic enzymes involved in mobilization of nitrogen sources is directly linked to hyphae uptake capacities. from organic compounds have been detected in eric- The kinetics and energetics of ammonium/methyl- oid and some in ectomycorrhizal fungi (Chalot and ammonium transport in ectomycorrhizal fungi have Brun, 1998). Transport of amino acids was investig- been characterized (Javelle et al., 1999; Jongbloed et ated in the mycorrhizal fungi P. involutus (Chalot et al., 1991). Comparing the ammonium uptake capa- al., 1996) and Amanita muscaria (Nehls et al., 1999), city of the two partners separately or in symbiosis, which demonstrated their ability to take up a variety it was found that mycelia have much higher capa- of amino acids. Recent data indicate that birch root cities for ammonium uptake than non-mycorrhizal colonization by Paxillus involutus increased glutamate roots and ectomycorrhizal fungi increase ammonium uptake and that mycorrhiza formation induced a pro- uptake capacities of their host roots (Javelle et al., found alteration of the metabolic fate of exogenously 1999; Plassard et al., 1997). On the contrary, recent supplied glutamate (Blaudez et al., 2001). Plassard et investigations indicated that mycorrhization leads to al. (2000) further demonstrated that Hebeloma cylin- − reduced rates of NO3 net uptake in Laccaria laccata drosporum/Pinus pinaster ectomycorrhizas had higher mycorrhizal beech (Kreuzwieser et al., 1997, 2000). capacities for taking up glutamate compared with non- The authors attributed this effect to a reduced influx mycorrhizal pine roots. However, the critical question − plus an enhanced efflux of NO3 as compared with is to what extent this potential to use organic N oc- non-mycorrhizal beech roots. The molecular mechan- curs under natural conditions (Näsholm and Persson, isms involved in inorganic N uptake will be further 2001). The potential utilization of isotopic signatures discussed in the last section. for the determination of resource acquisition patterns A number of observations support the view that by mycorrhizal plants has been discussed in detail ectomycorrhizal fungi have the ability to degrade (Evans, 2001; Hobbie et al., 1999). However, recent macromolecular nitrogen and furthermore to take up data indicates that this must be considered with cau- and assimilate the products of hydrolytic degradation tion, given the large isotopic fractionation patterns

15 168 during uptake and metabolism in mycorrhizal fungi (Emmerton et al., 2001). Based on both 15N labelling and mass balance data, it was demonstrated that hyphal ammonium acquisition contribute 45% to total plant N uptake under N deficiency (Jentschke et al., 2001b). In similar experiment using P deficient seedlings, they found that hyphal contribution to total plant N uptake amoun- ted to 12% (Jentschke et al., 2001a). Disrupting the external mycelium from ectomycorrhizas greatly decreased [15N]ammonium uptake by birch seedlings (Javelle et al., 1999). Therefore, external hyphae can be considered as the ammonium absorbing structure of ectomycorrhizal roots. These results confirmed the function of the extraradical mycelium in translocating N from sources to roots. The physiological processes involved in the further transfer of N within the symbiotic tissues are still poorly understood. The exchange of nutrients between the fungus and the plant requires passage across the fungal plasmalemma, the interfacial matrix and plasmalemma of the plant. A number of hypotheses, which Figure 2. Concentration of the 25Mg label (expressed as percentage are derived from experiments on higher plants or bac- 25 teria, have been drawn in a previous review (Chalot Mg of total Mg) in tissues of non-mycorrhizal and mycorrhizal Norway spruce seedlings after labeling the hyphal compartment in 15 and Brun, 1998). Indirect evidence from N labeling the culture system with 25Mg for 6 weeks. Broken line indicates experiments supports the view of amino acid transfer natural abundance of 25Mg (10.0%). Values are mean values of 4 from the fungus to the host (Smith and Read, 1997). replicate pots. Small bars indicate standard error. Significance levels + for differences between mycorrhizal and non-mycorrhizal seedlings: ∗ ∗∗ ∗∗∗ However a direct transfer of NH4 , as hypothesized , P ≤ 0.01; , P ≤ 0.001; , P ≤ 0.0001 (Jentschke et al., 2000, for AM symbiosis (Bago et al., 2001), cannot be ruled with permission). out. The answer to whether amino acids or ammonium are preferentially transferred from the fungus to the host through the apoplast will probably arise from non-mycorrhizal seedlings (Wallander and Wickman, molecular approaches coupled with biochemical tech- 1999). niques. Direct analysis of apoplast fluid (Solomon and Further translocation of K and Mg (Figure 2) Oliver, 2001) together with tracer experiments for in- through mycorrhizal hyphae has been recently ex- stance, will be necessary to elucidate transfer between amined (Jentschke et al., 2000; Jentschke et al., fungal and root cells. Also detailed analysis of indi- 2001a). Hyphal K and Mg acquisition by mycor- vidual compounds using specific isotope analysis may rhizal spruce roots was significant and contributed to be a key to further address these important questions a minimum of 5–6% of total plant uptake (Jentschke (Evans, 2001). et al., 2001a). These data demonstrate the potential role of the ectomycorrhizal mycelium in K and Mg Potassium, magnesium and calcium acquisition. Nutrient entry in root cells colonized by mycor- Silicate minerals may provide calcium, magnesium rhizal fungi has been recently examined using isotopic and potassium, after chemical or biological dissolu- tracers (44Ca, 25Mg and 41K) and LAMMA (laser- tion (Landeweert et al., 2001). Potassium mobilization microprobe-mass-analyser) (Kuhn et al., 2000). Based from apatite by mycorrhizal plants has been observed on entry kinetics and temperature dependence, it was in long-term pot experiments (Wallander and Wick- concluded that Ca and Mg may enter the cortex via man, 1999; Wallander, 2000b). It was found that a free apoplastic path and that the endodermis is a Pinus sylvestris seedlings colonized by Suillus varie- major barrier for the further passage of these divalent gatus enhanced K release from biotite as compared to cations into the xylem. For K, although kinetics were

16 169 not shown, the authors found a temperature depend- systems), 2 Pi transporters (homologous to yeast and + ence of K entry, which suggests that one component Glomus versiforme Pi uptake systems), one NH4 in K uptake mechanism may be carried out by an carrier, one peptide carrier, several hexose carriers, active process. This will be further discussed in the organic acid transporters, a large set of ATP binding last section. However, depending on the fungal part- cassette (ABC) transporters, or metal (Fe, Cu, Zn) ner, variations in the intensity of apoplastic movement transporters. Also, several enzymes that could play of nutrients could be observed (Bücking and Hey- crucial roles in improving P (phosphatases) and N ser, 2000b). For instance X-ray microanalyses indicate (aminotransferases, glutamine synthetase, glutamate that in mycorrhizas of Pinus sylvestris/Suillus bovinus synthase, urease, asparagine synthetase) nutrition have the apoplastic movement of cations across the fungal been identified. sheath is strongly reduced. In eucalypt mycorrhizas, the exodermal Casparian bands have a low permeab- Ammonium transporters ility to apoplasmic tracers, suggesting that an isolated Ammonium transporters were first cloned from yeast shared apoplasmic compartment exists at the interface between the partners, also not tightly sealed (Vesk et (Mep1) and higher plant (Amt1) (Marini et al., 1994; Ninnemann et al., 1994). Heterologous expression of al., 2000). the yeast triple mep mutant (Marini et al., 1997) Interdependence of nutrient translocation has enabled the characterization of HcAmt2 and HcAmt3 from H. cylindrosporum, the first members P deficiency in spruce triggers hyphal foraging and of the ammonium transporter protein family (Amt) translocation not only of P from P-rich sites, but in basidiomycetes (Figure 3). HcAmt2 expressed in also of N, K and Mg, which indicates poten- yeast had a higher affinity but a lower capacity than tial co-translocation of a limiting element (P) with HcAmt3. Northern blot analyses in H. cylindrosporum non-limiting nutrients (N, K, Mg) by P. involutus showed that HcAMT2 and HcAMT3 were up-regulated (Jentschke et al., 2001a). In this experiment, K translo- upon nitrogen deprivation and down-regulated by am- cation was of the same order of magnitude as P trans- monium (Javelle et al., 2001). A third member of location whereas N translocation exceeded P translo- this family showing a high homology to HcAmt2 was cation five-fold. Mg fluxes through hyphae were the recently isolated by direct complementation from a lowest of all nutrient fluxes determined. In agree- cDNA library (Javelle, unpublished results). Results ment with these studies, Cole et al. (1998), using also indicate that the HcAmts could play a role in am- X-ray mapping demonstrated that vacuoles in growing monium retention in H. cylindrosporum, as already hyphae retain high levels of P and K. demonstrated for the Mep proteins in S. cerevisiae (Marini et al., 1997). An immunological approach is currently being developed in our laboratory to elu- Transport processes at the molecular level cidate the intriguing questions concerning the post- translational regulation of this protein family and its Fungal transporters: a Hebeloma cylindrosporum cytolocalisation in ectomycorrhizas. database Amino acid transporters Genomic and cDNA libraries have been prepared, and an EST (expressed sequence tags) resource of ca. 3000 Amino acid transporters have been characterized sequences has been produced (Table 1). Preliminary physiologically in detail in animals, plants and yeasts analysis of the library reveals that ca. 60% of the (for review see Fischer et al., 1998; van Belle and tags correspond to genes that have counterparts in André, 2001; Williams and Miller, 2001; Wipf et other organisms, and 50% of known function. Among al., 2002). On the basis of physiological studies, the them, 38 tags correspond to genes encoding carriers existence of a large number of transporters has been or channels that could play a role in nutrient uptake postulated differing in their substrate spectrum, in from the soil solution or from the host plant apo- their transport mechanism, i.e. the ions used in co- plast, or in nutrient secretion towards the host plant transport, and in tissue specificity. Three transporter (Table 1). Of particular interest are several K+ chan- superfamilies are found in plants and yeast (the APC, nels (homologous to Shaker/Shab channels identified amino acid-polyamine-choline transporter superfam- in animals), one K+ carrier (homologous to yeast TRK ily, the ATF, amino acid transporter superfamily, the

17 170

Table 1. Hebeloma cylindrosporum EST resource

Protein function prediction Number of clones (Percentage Number of putative of the matching ESTs) different proteins

Metabolism 367 (34,04) 172 Protein synthesis 256 (23,74) 131 Postranscriptional modiﬁcation and proteolysis 215 (19,94) 76 Cytoskeleton 56 (5,19) 22 Signal transduction 61 (5,65) 48 Nuclear proteins 28 (2,59) 23 Transporters 38 (3,52) 29 Probable membrane proteins 28 (2,59) 19 Cell wall proteins 29 (2,69) 15 Unclassiﬁed 855 655

aProtein function prediction from ESTs was made with BlastX program (Altschul et al., 1990). Around 1000 sequences were absent from this table because they did not match with any protein of database (expect − − > e 2). ESTs matching known proteins with BlastX expect < e 15 have been classified into functional − categories, ESTs with expect > e 15 were placed into unclassified category together with ESTs which can not be classified into functional categories. The percentage of each individual functional class (calculated from the total number of classified proteins) is given in parenthesis. Third column indicates number of different accession numbers obtained in the first line of BlastX program.

Figure 3. Topology of the ammonium transporters from Hebeloma cylindrosporum. (A) Hydropathy proﬁle of the HcAmt proteins. Hydropathy analyses were performed using the Kyte and Doolittle algorithm. The upper boxes represent the relative positions of the membrane-spanning segments predicted by the algorithm TMpred, HMMTOP and TMHMM. The hatched boxes correspond to the ammonium-signature containing-TM. (B) Schematic model of the two HcAmt proteins. The predicted glycosylation sites (Asn3 for HcAmt2, Asn450 for HcAmt3) are indicated. The hatched boxes correspond to ammonium-signature containing-transmembranes (Javelle et al., 2001, with permission).

18 171

VGT, vesicular glutamate transporter family). Re- provide potential tools for detailed analysis of trans- cently, two amino acid transporters from mycorrhizal porter genes in tree roots. fungi have been characterized. AmAap1 was identified from A. muscaria by screening a cDNA library Tree & fungal hexose transporters (Nehls et al., 1999). HcBap1 was isolated from H. cylindrosporum by functional complementation of a It is assumed that sucrose is delivered into the apo- yeast strain deficient in amino acid transporters (Wipf plast at the plant-fungus interface (Hartig net) and et al., unpublished results). Their expression in yeast hydrolyzed via a plant-derived acid invertase (Nehls revealed that they function as high affinity transport- et al., 2001). The resulting hexoses are then taken up ers. Two main functions can be expected for those by fungal cells as well as by plant root cells (Nehls genes, namely uptake of amino acid from the soil for et al., 2000; Wright et al., 2000). A prerequisite nutrition, and the prevention of amino acid loss by for rapid uptake of monosaccharides is a membrane hyphal leakage in the absence of a suitable N source transport system. So far only one hexose transporter at a low internal N status. However, given the variety (AmMst1) has been identified from the ectomycor- of amino acid transporters described in animals, plants rhizal fungus A. muscaria (Nehls et al., 1998). The and yeasts, the characterization of many more fungal expression of AmMst1 in a Saccharomyces cerevisiae transporters is expected and needed. strain, unable to take up hexoses, demonstrated that AmMst1 was a functional monosaccharide transporter Potassium transporters (Wiese et al., 2000). A Picea abies hexose transporter cDNA (PaMST1) that encodes an open reading frame Potassium transport has received much attention in of 513 amino acids was isolated by a RT-PCR based plants and fungi (for review see Rodriguez-Navarro, strategy (Nehls et al., 2000). PaMst1 is expressed 2000). It is clear that the EST resource described in the hypocotyl and in roots of P. abies seedlings, above now offers invaluable molecular tools for study- but not in needles sampled at different developmental ing the molecular mechanisms of K transport in ec- stages (cotyledons and young needles). In addition, tomycorrhizal fungi. For instance, regarding nutrient two putative hexose transporter gene fragments were ion uptake and secretion towards the host plant, se- identified from birch by RT-PCR (Wright et al., 2000). quence analysis of the clones corresponding to the While the expression of the hexose transporter gene K+ transport systems identified in the EST library + of Norway spruce was only slightly (approx. 30%) provides the following working hypotheses. The K reduced in mycorrhizas, the transcript level of both carrier that displays similarities with the yeast TRK hexose transporter genes of birch was reduced by a systems could be responsible for high affinity active factor of three. Even if a reduced transcript level K+ uptake by peripheral hyphae from the soil solution. + does not mean a decreased transporter activity, and On the other hand, the K channels displaying simil- although the number of monosaccharide transporters arities with animal Shaker/Shab outward K+ channels + expressed in plant roots is not yet clear, these results could play a role in K secretion towards the host suggest that plants do not increase their hexose import plant. Within these working hypotheses, a prelimin- capacity during symbiosis. In contrast, the expres- ary step will be to assess the molecular function of sion of the fungal monosaccharide transporter gene these transport systems via their expression in hetero- increases significantly in mycorrhizas. Since, in ad- logous systems (e.g. functional complementation of dition, the transcript level of the fungal (A. muscaria) yeast mutants, electrophysiological characterization in monosaccharide transporter gene is much higher than Xenopus oocytes). that encoding the P. abies hexose transporter (U. Nehls, unpublished), the fungus represents the ma- Host tree transporters jor carbohydrate sink in infected fine roots. It could Although a variety of ammonium, amino acid, pep- thus be assumed that the plant does not compete for tide, phosphate and sugar transporters have been hexose import at the plant-fungus interface, and that confirmed to be expressed in plant roots (Delrot et the fungal activity determines the sink strength for al., 2000; Fischer et al., 1998; von Wiren et al., carbohydrates in mycorrhizas. 2000), data on tree roots is lacking and urgently needed. Current sequencing projects (i.e. poplar database, http://mycor.nancy.inra.fr/PoplarDB.html) may

19 172

Figure 4. Summary of current understanding of transporters in ectomycorrhizal tissues. fp: fungal plasma membrane, rp: root plasma membrane, pP: polyphosphate. Black cylinder: one member of the transporter family has been fully characterized, i.e., functional complementation of a yeast deﬁcient strain; grey cylinder: putative transporters (candidate genes available in i.e. EST resources); white cylinder: hypothetic transporters.

Transporters in ectomycorrhizal tissues: overview deficient yeasts with transporter genes and further ex- and perspectives pression analysis will probably help in understanding the uptake processes. Our current understanding of transport processes in However, the most difficult mechanism to perceive ectomycorrhizal tissues is summarized in Figure 4. will be the release of amino acids into the apoplast by Up to now, only 5 transporters from ectomycorrhizal the fungus. Studies indicate that amino acid release by fungi have been fully characterized, i.e., their function ectomycorrhizal fungi indeed does occur (Plassard et demonstrated by functional complementation of defi- al., 1996). Whether the mechanism involved, specific- cient yeasts (HcAmt2, HcAmt3, Javelle et al., 2001; ally applied to the symbiotic interface, and whether HcBap1, Wipf et al., unpublished results; AmMst1, it concerns a limited range of amino acids remain Nehls et al., 1998; AmAap1, Nehls et al., 1999). A intriguing questions. The lack of deficient yeasts in number of other candidate genes from fungi or from amino acid excretion greatly hampered the study of host roots have been isolated either by degenerate PCR amino acid excretion in other organisms. Research in or from EST resources. However, the precise function these directions however are in progress and should and localization of these putative proteins in mycor- allow the characterization of amino acid exporters in rhizal tissues remain unknown. Nutrient fluxes from mycorrhizal fungi in the near future. fungus to host largely depend upon coordination with Current research work on the model plant Ara- nutrient release by the fungus into, and nutrient re- bidopsis thaliana clearly illustrates the usefulness uptake by the root cells from, the apoplastic interface. of models allowing development of genetic, reverse Unequivocal elucidation of these transport mechan- genetic and transgenesis approaches (Zimmermann isms will rely on innovative physiological and mo- and Sentenac, 1999). For instance, expression of lecular approaches. Heterologous complementation of promoter-reporter gene constructs in transgenic fungi

20 173 as well as immunological-based approaches will allow Blaudez D, Botton B, Dizengremel P and Chalot M 2001 The fate us to localize the expression of these various transport of [14C]glutamate and [14C]malate in birch roots is strongly systems in the fungus (peripheral hyphae, Hartig net- modified under inoculation with Paxillus involutus. Plant Cell Environ. 24, 449–457. work) and to study the effects of nutrient deficiency Bücking H and Heyser W 2000a Subcellular compartmentation of on their expression. In a recent work, the expression elements in non-mycorrhizal and mycorrhizal roots of Pinus and the cellular localization of a proline transporter sylvestris: an X-ray microanalytical study. I. The distribution of phosphate. New Phytol. 145, 311–320. was successfully studied in Aspergillus nidulans using Bücking H and Heyser W 2000b Subcellular compartmentation GFP fusion protein (Tavoularis et al., 2001). It is ex- of elements in non-mycorrhizal and mycorrhizal roots of Pinus citing to consider the value of this approach in studies sylvestris: an X-ray microanalytical study. II. The distribution of of plant-fungus interactions, especially since fluores- calcium, potassium and sodium. New Phytol. 145, 321–331. Buscot A, Munch J C, Charcosset J Y, Gardes M, Nehls U cent protein labeling patterns can be extended to the and Hampp R 2000 Recent advances in exploring physiology ultrastructural level by immunolocalization with GFP and biodiversity of ectomycorrhizas highlight the functioning antibodies (Gordon et al., 2000). However, use of this of these symbioses in ecosystems. FEMS Microbiol. Rev. 24, technology relies on the availability of high through- 601–614. Cairney J W G and Smith S E 1993 Efflux of phosphate from put transformation system for mycorrhizal fungi. In the ectomycorrhizal basidiomycete Pisolithus tinctorius:gen- some of the experiments described in the present pa- eral characteristics and the influence of intracellular phosphate. per, H. cylindrosporum was chosen as a model of ecto- Mycol. Res. 96, 673–676. mycorrhizal fungus, since this species can be grown in Chalot M and Brun A 1998 Physiology of organic nitrogen acquisition by ectomycorrhizal fungi and ectomycorrhizas. FEMS vitro from spore to spore (Debaud and Gay, 1987) and Microbiol. Rev. 22, 21–44. can be transformed (Marmeisse et al., 1992), allowing Chalot M, Brun A, Botton B and Söderström B 1996 Kinetics, ener- genetic and reverse genetic approaches. More recently, getics and specificity of the general amino acid transporter from a technique was developed for transforming mycor- the ectomycorrhizal fungus Paxillus involutus. Microbiology 142, 1749–1756. rhizal fungi, including H. cylindrosporum, based on Cole L, Orlovich D A and Ashford A E 1998 Structure, function, Agrobacterium tumefaciens mediated T-DNA transfer and, motility of vacuoles in filamentous fungi. Fungal Genet. (Pardo et al., 2002). Agrobacterium tumefaciens me- Biol. 24, 86–100. Colpaert J V, van Tichelen K K, van Assche J A and Van Laere diated transformation has been successfully applied to A 1999 Short-term phosphorus uptake rates in mycorrhizal and the wheat pathogen Mycosphaerella graminicola for non-mycorrhizal roots of intact Pinus sylvestris seedlings. New the disruption of an ABC transporter, generated dis- Phytol. 143, 589–597. ruptants with high efficiency (Zwiers and De Waard, Debaud J C and Gay G 1987 In vitro fruiting under controlled conditions of the ectomycorrhizal fungus Hebeloma cylindrosporum 2001). associated with Pinus pinaster. New Phytol. 105, 429–435. Ultimately, the combination of biochemical and Delrot S, Atanassova R and Maurousset L 2000 Regulation of sugar, molecular approaches will provide a platform for amino acid and peptide plant membrane transporters. Biochim. discovering how release and transport events at the Biophys. Acta 1465, 281–306. Emmerton K S, Callaghan T V, Jones H E, Leake J R, Michelsen apoplastic interface are coordinated and how controls A and Read D J 2001 Assimilation and isotopic fractionation of either by the fungus or by the host are exerted. nitrogen by mycorrhizal fungi. New Phytol. 151, 503–512. Evans R D 2001 Physiological mechanisms influencing plant nitrogen isotope composition. Trends Plant Sci. 6, 121–126. Fischer W N , André B, Rentsch D, Krolkiewicz S, Tegeder M, References Breitkreuz K and Frommer W B 1998 Amino acid transport in plants. Trends Plant Sci. 3, 188–195. Ashford A E 1998 Dynamic pleiomorphic vacuole systems: Are Gordon C L, Khalaj V, Ram A F, Archer D B, Brookman J L, they endosomes and transport compartments in fungal hyphae? Trinci A P, Jeenes D J, Doonan J H, Wells B, Punt P J, van den Adv. Bot. Res. 28, 119–159. Hondel C A, Robson G D 2000 Glucoamylase::green fluorescent Ashford A E and Allaway W G, 2002 The role of a motile tubular protein fusions to monitor protein secretion in Aspergillus niger. vacuole system in mycorrhizal fungi. Plant Soil 244, 179–189 Microbiology 146, 415–26. (this issue). Hampp R, Wiese J, Mikolajewski S and Nehls U 1999 Biochem- Altschul S F, Gish W, Miller W, Myers E W and Lipman D J 1990 ical and molecular aspects of C/N interaction in ectomycorrhizal Basic local alignment search tool. J. Mol. Biol. 215, 403–410. plants: an update. Plant Soil 215, 103–113. Bago B, Pfeffer P and Shachar-Hill Y 2001 Could the urea cycle be Hobbie E A, Macko S A and Shugart H H 1999 Interpretation of translocating nitrogen in the arbuscular mycorrhizal symbiosis ? nitrogen isotope signatures using the NIFTE model. Oecologia New Phytol. 149, 4–8. 120, 405–415. Bending g D and Read D J 1995 The structure and function of the Javelle A, Chalot M, Söderström B, and Botton B 1999 Ammonium vegetative mycelium of ectomycorrhizal plants. VI. Activities of and methylamine transport by the ectomycorhizal fungus Paxil- nutrient mobilizing enzymes in birch litter colonized by Paxillus lus involutus and ectomycorrhizas. FEMS Microbiol. Ecol. 30, involutus (Fr.) Fr. New Phytol. 130, 411–417. 355–366.

21 174

Javelle A, Rodríguez-Pastrana B R, Jacob C, Botton B, Brun A, Nehls U, Wiese J, Güttenberger M and Hampp R 1998 Carbon alloc- André B, Marini A M and Chalot M 2001 Molecular character- ation in ectomycorrhizas: identification and expression analysis ization of two ammonium transporters from the ectomycorrhizal of an Amanita muscaria monosaccharide transporter. Mol. Plant fungus Hebeloma cylindrosporum. FEBS Lett. 505: 393–398. Microbe Interact. 11, 167–176. Jentschke G, Brandes B, Kuhn A J, Schröder W H and Godbold D L Ninnemann O, Jauniaux J C and Frommer W B 1994 Identification 2001a Interdependence of phosphorus, nitrogen, potassium and of a high affinity ammonium transporter from plants. EMBO J. magnesium translocation by the ectomycorrhizal fungus Paxillus 13, 3464–3471. involutus. New Phytol. 149, 327–338. Pardo A G, Hanif M, Raudaskoski M and Gorfer M 2002 Genetic Jentschke G, Brandes B, Kuhn A J, Schröder W H, Becker J S transformation of ectomycorrhizal fungi mediated by Agrobac- and Godbold D L 2000 The mycorrhizal fungus Paxillus involu- terium tumefaciens. Mycol. Res. 106, in press. tus transports magnesium to Norway spruce seedlings. Evidence Perez-Moreno J and Read D J 2000 Mobilization and transfer of from stable isotope labeling. Plant Soil 220, 243–246. nutrients from litter to tree seedlings via the vegetative mycelium Jentschke G, Godbold D L and Brandes B 2001b Nitrogen limitation of ectomycorrhizal plants. New Phytol. 145, 301–309. in mycorrhizal Norway spruce (Picea abies) seedlings induced Plassard C, Bonafos B and Touraine B 2000 Differential effects of mycelial foraging for ammonium: implications for Ca and Mg mineral and organic N sources, and of ectomycorrhizal infection uptake. Plant Soil 234, 109–117. by Hebeloma cylindrosporum, on growth and N utilization in Jongbloed R H, Clement J M A M and Borst-Pauwels G W F H Pinus pinaster. Plant Cell Environ. 23, 1195–1205. + 1991 Kinetics of K uptake by ectomycorrhizal fungi. Effect of Plassard C, Chalot M, Botton, B and Martin F 1997 Le rôle des ec- + + NH4 on K uptake. Physiol. Plant. 83, 427–432. tomycorhizes dans la nutrition azotée des arbres forestiers. Rev. Jones M D, Durall D M and Tinker P B 1998 Comparison of For. Fr. 49, 82–98. arbuscular and ectomycorrhizal Eucalyptus coccifera:growth Plassard C, Reid R J and Tester M 1996 Amino acid release by response, phosphorus uptake efficiency and external hyphal the ectomycorrhizal fungus Hebeloma cylindrosporum grown production. New Phytol. 140, 125–134. in vitro. In Mycorrhizas in integrated systems, from genes to Koide R T and Kabir Z 2001 Nutrient economy of red pine is af- plant development. Eds. C Azcon-Aguilar and J M Barea. pp fected by interactions between Pisolithus tinctorius and other 364–367. Proceedings of the Fourth European Symposium on forest-floor microbes. New Phytol. 150, 179–188. Mycorrhizas. European Commission, Brussels, Luxembourg. Kreuzwieser J, Herschbach C, Stulen I, Wiersema P, Vaalburg W Rodriguez-Navarro A 2000 Potassium transport in fungi and plants. + and Rennenberg H 1997 Interactions of NH4 and L-glutamate Biochim. Biophys. Acta 1469, 1–30. − with NO3 transport processes of non-mycorrhizal Fagus sylvat- Rousseau J V D, Sylvia D M and Fox A J 1994 Contribution of ec- ica roots. J. Exp. Bot. 48, 1431–1438. tomycorrhiza to the potential nutrient-absorbing surface of pine. Kreuzwieser J, Stulen I, Wiersema P, Vaalburg W and Rennen- New Phytol. 128, 639–644. berg H 2000 Nitrate transport processes in Fagus- Laccaria- Smith S E and Read D J 1997 Mycorrhizal Symbiosis, Ed 2, mycorrhizae. Plant Soil 220, 107–117. Academic Press, London. Kuhn A J, Schröder W H and Bauch J 2000 The kinetics of calcium Solomon P S and Oliver R P 2001 The nitrogen content of the to- and magnesium entry into mycorrhizal spruce roots. Planta 210, mato leaf apoplast increases during infection by Cladosporium 488–496. fulvum. Planta 213, 241–249. Landeweert R, Hoffland E, Finlay R D, Kuyper T W and van Tavoularis S, Scazzocchio C, Sophianopoulou V 2001 Functional Breemen N 2001 Linking plants to rocks: ectomycorrhizal expression and cellular localization of a green fluorescent fungi mobilize nutrients from minerals. Trends Ecol. Evol. 16, protein-tagged proline transporter in Aspergillus nidulans. Fung. 248–254. Genet. Biol. 33, 115–25. Marini A M, Soussi-Boudekou S, Vissers S and André B 1997 A Timonen S, Finlay R D, Olsson S and Söderström B 1996 Dynam- family of ammonium transporters in Saccharomyces cerevisiae. ics of phosphorus translocation in intact ectomycorrhizal sys- Mol. Cell. Biol. 17, 4282–4293. tems: Non-destructive monitoring using a beta-scanner. FEMS Marini A M, Vissers S, Urrestarazu A and André B 1994 Cloning Microbiol. Ecol. 19, 171–180. and expression of the MEP 1 gene encoding an ammonium trans- van Belle D and André B 2001 A genomic view of yeast membrane porter in Saccharomyces cerevisiae. EMBO J. 13, 3456–3463. transporters. Cur. Opin. Cell. Biol. 13, 389–398. Marmeisse R, Gay G, Debaud J C and Casselton L A 1992 Genetic van Tichelen K K and Colpaert J V 2000 Kinetics of phos- transformation of the symbiotic basidiomycete fungus Hebeloma phate absorption by mycorrhizal and non-mycorrhizal Scots pine cylindrosporum. Cur. Genet. 22, 42–45. seedlings. Physiol. Plant. 110, 96–103. Marschner H 1995 Mineral Nutrition of Higher Plants, Ed 2, Vesk P A, Ashford A E, Markovina, A L and Allaway W G Academic Press, London. 2000 Apoplasmic barriers and their significance in the exo- Näsholm T and Persson J 2001 Plant acquisition of organic nitrogen dermis and sheath of Eucalyptus pilularis–Pisolithus tinctorius in boreal forests. Physiol. Plant. 111, 419–426. ectomycorrhizas. New Phytol. 145, 333–346. Nehls U, Kleber R, Wiese J and Hampp R 1999 Isolation and von Wiren N, Gazzarrini S, Gojon A and Frommer W B 2000 The characterization of a general amino acid permease from the molecular physiology of ammonium uptake and retrieval. Cur. ectomycorrhizal fungus Amanita muscaria. New Phytol. 144, Opin. Plant Biol. 3, 254–261. 343–349. Wallander H 2000a Uptake of P from apatite by Pinus sylvestris Nehls U, Micholajewski S, Magel E and Hampp R 2001 Carbo- seedlings colonised by different ectomycorrhizal fungi. Plant hydrate metabolism in ectomycorrhizas: gene expression, mono- Soil 218, 249–256. saccharide transport and metabolic control. New Phytol. 150, Wallander H 2000b Use of strontium isotopes and foliar K content 533–541. to estimate weathering of biotite induced by pine seedlings col- Nehls U, Wiese J and Hampp R 2000 Cloning of a Picea abies onised by ectomycorrhizal fungi from two different soils. Plant monosaccharide transporter gene and expression-analysis in Soil 222, 215–229. plant tissues and ectomycorrhizas. Trees 14, 334–338.

22 175

Wallander H and Wickman T 1999 Biotite and microcline as a Wipf D U Ludewig M, Tegeder D, Rentsch W, Koch, Frommer K source in mycorrhizal and non-mycorrhizal Pinus sylvestris W B 2002 Amino acid/neurotransmitter transporters are highly seedlings. Mycorrhiza 9, 25–32. conserved between fungi, plants and animals. Trends Biochem. Wallander H, Wickman T and Jacks G 1997 Apatite as a P source Sci. 27, 139–147. in mycorrhizal and non-mycorrhizal Pinus sylvestris seedlings. Wright D P, Scholes J D, Read D J and Rolfe S A 2000 Changes in Plant Soil 196, 123–131. carbon allocation and expression of carbon transporter genes in Wallenda T and Read D J 1999 Kinetics of amino uptake by Betula pendula Roth. colonized by the ectomycorrhizal fungus ectomycorrhizal roots. Plant Cell Environ. 22, 179–187. Paxillus involutus (Batsch) Fr. Plant Cell Environ. 23, 39–49. Wiese J, Kleber R, Hampp R and Nehls U 2000 Functional charac- Zimmermann S and Sentenac H 1999 Plant ion channels: from mo- terization of the Amanita muscaria monosaccharide transporter lecular structures to physiological functions. Curr. Opin. Plant AmMST1. Plant Biol. 2, 1–5. Biol. 2, 477–82. Williams L E and Miller A J 2001 Transporters responsible for the Zwiers L H and De Waard M A 2001 Efﬁcient Agrobacterium uptake and partitioning of nitrogenous solutes. Ann. Rev. Plant tumefaciens-mediated gene disruption in the phytopathogen My- Physiol. Plant Mol. Biol. 52, 659–688. cosphaerella graminicola. Curr Genet. 39, 388–393.

23 24 Annexe 2 du chapitre 1

Hebeloma cylindrosporum – a model species to study

ectomycorrhizal symbiosis from gene to ecosystem

Roland Marmeisse, Alice Guidot, Gilles Gay, Raphaël Lambilliotte, Hervé Sentenac, Jean- Philippe Combier, Delphine Melayah, Laurence Fraissinet-Tachet et Jean-Claude Debaud

New Phytologist (2004) 163: 481-498

Cet article de revue résume les connaissances actuelles sur le champignon ectomycorhizien Hebeloma cylindrosporum en mettant en perspective la possibilité d'utilisation de ce basidiomycète comme un des modèles d'étude de la symbiose ectomycorhizienne. Hebeloma cylindrosporum est une espèce caractéristique de l'écosystème dunaire de la côte atlantique européenne, naturellement associée au pin maritime (Pinus pinaster). Il est très étudié aux niveaux physiologique et écophysiologique. Il constitue un modèle particulièrement approprié pour développer des études génétiques et moléculaires pour les raisons suivantes. Toutes les étapes de son cycle biologique peuvent être obtenues au laboratoire, y compris la fructification en condition axénique. Les deux types de mycélium, haploïde ou dicaryotique, forment des mycorhizes. Des protoplastes viables peuvent être obtenus en grande quantité et servent de matériel pour l'induction de mutations. H. cylindrosporum est la seule espèce ectomycorhizienne pour laquelle des souches mutantes (e.g. souche surproductrice d'auxine; souche déficiente en nitrate-réductase) ont été caractérisées. La maîtrise de la fructification in vitro permet l'étude de la ségrégation des phénotypes mutants dans une descendance haploïde et le transfert des mutations sélectionnées dans différents fonds génétiques. De plus, H. cylindrosporum est maintenant une espèce transformable en routine. La transformation par Agrobacterium a récemment permis d'établir une collection de mutants. Enfin, la banque d'ADNc construite par notre équipe (dans un vecteur d'expression dans la levure, permettant des clonages par complémentation fonctionnelle de mutants de levure; Cf. chapitre 3) a été utilisée pour produire une ressource d'étiquettes identifiant, en particulier, de nombreux systèmes de transport de nutriments.

25 26

Review

Blackwell Publishing, Ltd. Tansley review Hebeloma cylindrosporum – a model species to study ectomycorrhizal symbiosis from gene to ecosystem

Author for correspondence: R. Marmeisse1, A. Guidot1, G. Gay1, R. Lambilliotte2, H. Sentenac2, Roland Marmeisse J.-P. Combier1, D. Melayah1, L. Fraissinet-Tachet1 and J.C. Debaud1 Tel: +33 472448047 Fax: +33 472431643 1Université Claude Bernard Lyon 1, Ecologie Microbienne (UMR CNRS 5557), Bât. A. Lwoff, 43 Bd. Email: [email protected] du 11 Novembre 1918, F-69622 Villeurbanne Cedex, France.2 Ecole Nationale Supérieure d’Agronomie Received: 29 April 2004 de Montpellier, Biochimie et Physiologie Moléculaire des Plantes (UMR 5004 Agro-M/CNRS/INRA/ Accepted: 3 June 2004 UM2), Place Viala, F-34060 Montpellier Cedex 1, France

Contents

Summary 481 V. Nutritional interactions 488

I. Introduction 482 VI. Genetic diversity and dynamics of H. cylindrosporum populations in P. pinaster forest ecosystems 491 II. Taxonomy, distribution, autecology, and host range of H. cylindrosporum 482 VII. Future directions 494

III. The Hebeloma cylindrosporum toolbox 483 Acknowledgements 494

IV. Mycorrhiza differentiation 486 References 494

Summary

Key words: ectomycorrhizal symbiosis, The basidiomycete Hebeloma cylindrosporum has been extensively studied with Hebeloma cylindrosporum, mycorrhiza respect to mycorrhiza differentiation and metabolism and also to population dynamics. differentiation, nitrogen assimilation, Its life cycle can be reproduced in vitro and it can be genetically transformed. Pinus sp., population dynamics. Combined biochemical, cytological, genetical and molecular approaches led to the characterisation of mutant strains affected in mycorrhiza formation. These studies demonstrated the role of fungal auxin as a signal molecule in mycorrhiza formation and should allow the characterisation of essential fungal genes necessary to achieve a compatible symbiotic interaction. Random sequencing of cDNAs has iden- tiﬁed numerous key functional genes which allowed dissection of essential nitrogen assimilation pathways. H. cylindrosporum also proved to be a remarkable model species to uncover the dynamics of natural populations of ectomycorrhizal fungi and the way in which they respond and adapt to anthropogenic disturbance of the forest ecosystem. Although studies on mycorrhiza differentiation and functioning and those on the population dynamics of H. cylindrosporum have been carried out independently, they are likely to converge in a renewed molecular ecophysiology which will envisage how ectomycorrhizal symbiosis functions under varying ﬁeld conditions. New Phytologist (2004) 163: 481–498 © New Phytologist (2004) doi: 10.1111/j.1469-8137.2004.01148.x www.newphytologist.org 481 27

482 Review Tansley review

the ecosystem such as nitrogen deposition (Peter et al., 2001; I. Introduction Lilleskov et al., 2002; Avis et al., 2003). The taxonomic diversity Among the numerous interactions which exist between vascular of ECM fungi could imply that species within a community are plants and fungi, the ectomycorrhizal (ECM) symbiosis is remark- functionally diverse and play different roles. Several studies, able for the conservation of its structural and anatomical usually carried out in vitro, have indeed established that features despite the great taxonomic and phylogenetic diversity different ECM fungal species and different genets of the same of the species involved in this association. Indeed, fungal species display significant quantitative variations for functions species belonging to three of the main fungal lineages (the related to, for example, nutrient uptake which will ultimately order Endogonale in the Zygomycota and more than 5000 affect host plant nutrition and fitness (Cairney, 1999). described species in the Ascomycota and Basidiomycota This brief overview which illustrates the complexity of (Molina et al., 1992)) interact with absorbing roots of mainly the ECM symbiosis indicates that only a multidisciplinary woody plants in the gymnosperms (members of the Pinaceae approach encompassing different research fields and interests family) and/or in several angiosperm families (see Brundrett, – from genes to ecosystem – is likely to illuminate how the 2002 for a review) to form what can be considered as an entirely ECM symbiosis functions under field conditions. It is neces- new organ. This diversity points to several independent origins sary not only to identify the genes and cellular functions of this association and, even within the basidiomycetes, controlling ectomycorrhiza differentiation and metabolism of phylogenetic reconstructions have conclusively suggested that both partners but also the environmental variables affecting the capacity to form ectomycorrhizas has appeared independently the establishment, maintenance and turnover rate of the several times in the course of evolution from saprotrophic different fungal symbionts on the root systems. Such a multi- ancestors (Hibbett et al., 2000). disciplinary approach is only starting to emerge for a limited Ectomycorrhizas are almost invariably characterised by a number of model fungal species. Hartig net made of highly branched hyphae which entirely The aim of this paper is to review the basic biology of one surround, without penetrating, the rhizodermal and – but not such ECM fungal species, the basidiomycete agaric Hebeloma always – the outer root cortical cells (illustrated in Fig. 1). On cylindrosporum and its past, present and potentially future the outside of the root, which no longer differentiates hair contribution to the field of mycorrhizal research. As opposed cells, the fungal hyphae aggregate to various extents to form a to most other ECM fungal species, H. cylindrosporum has sheath (also named fungal mantle) from which emanate extra- been extensively studied with respect to mycorrhiza differen- radical hyphae which explore the soil. The Hartig net is the tiation, metabolism and also with respect to the structure and place of massive bidirectional exchanges of nutriments. On dynamics of its populations in natural forest ecosystems. the one hand, the host plant allocates a significant amount of its photosynthetates (in the range of 10–20%; Smith & Read, II. Taxonomy, distribution, autecology, and host 1997) to the fungal symbionts to support almost entirely their range of H. cylindrosporum metabolism, growth and formation of their fruit bodies. On the other hand, the ECM fungi transfer to the plant essential The genus Hebeloma is traditionally placed in the Agaric nutrients (mainly N, P and K molecules) which have been family Cortinariaceae which includes several other species- absorbed by the extraradical hyphae. rich, ECM genera. However, some preliminary phylogenetic At the level of forest ecosystems, ECM fungi represent one data suggest that Hebelomas could be related to saprotrophic of the main direct recipients of primary production. These species in the genera Agrocybe (Moncalvo et al., 2000) or fungi can account for up to one third of the microbial biomass Pholiota (Moncalvo et al., 2002). Hebeloma cylindrosporum in boreal forest soils (Högberg & Högberg, 2002). It is now Romagnesi was first described in 1965 (Romagnesi, 1965). widely acknowledged that, at least in temperate and boreal This species, easily identified by its cylindrical basidiospores ecosystems, ECM fungi are major players in biogeochemical is, within the genus Hebeloma, phylogenetically distantly cycles and short cut mineralization processes by making related to H. crustuliniforme, the other Hebeloma species directly available to their host plants complex forms of nitro- frequently used in mycorrhizal research (Aanen et al., 2000). gen and phosphorus (such as proteins, nucleic acids…) at a Although there has not been any comprehensive survey of very early stage of organic matter decomposition (Read & its geographical range distribution, H. cylindrosporum has Perez-Moreno, 2003). only been reported to occur in Europe, from Finland or In natural forest ecosystems, the root system of a plant is Norway in the north, to Spain in the south (Courtecuisse & frequently associated with many different ECM fungal species Duhem, 2000). From our own observations and a few reports as well as with different genets of the same species. Further- (Romagnesi, 1965; Jansen, 1982; Contu, 1991), H. cylin- more, although a host plant is permanently associated with drosporum seems to prefer sandy soils with no or very little different ECM fungi, the diversity of this ECM fungal com- organic matter. This species is consequently frequently found, munity changes during the course of forest ageing (Smith but not exclusively, in forest stands developing on sand dunes et al., 2002) as well as in response to various disturbances of along the Atlantic or even the Mediterranean coast (Contu,

New Phytologist (2004) 163: 481–498 www.newphytologist.org © New Phytologist (2004) 28

Tansley review Review 483

1991). In this respect, H. cylindrosporum can be qualified, as 1987). This contrasts with numerous other ECM species for many other Hebeloma species (Last et al., 1983; Fleming et al., which none of the mycelia can be grown in vitro (this is 1984), as a pioneer species, which thrives in newly established also the case of some Hebeloma species) or for which the forests where humus accumulation is low, or in disturbed meiospores fail to germinate or, with species which do not habitats (Guidot et al., 2002b). In South-West France, along form fruit bodies outside their natural forest habitats. For the Atlantic coast, fruit bodies of H. cylindrosporum form a few species such as Laccaria bicolor, fruit bodies producing late in the autumn, usually between mid-October and early viable basidiospores are nevertheless readily obtained under December (Gryta et al., 1997). nursery or greenhouse conditions after association with a Both in the field and on laboratory culture media, H. cylin- compatible host plant (Godbout & Fortin, 1990). drosporum forms mycorrhizas with taxonomically diverse H. cylindrosporum has a typical bifactorial heterothallic life plant species. In the field, H. cylindrosporum is frequently cycle with two unlinked and multiallelic A and B mating-type associated with Pinus trees such as P. pinaster (Romagnesi, loci controlling the mating between haploid mycelia (Debaud 1965; Bruchet, 1980) or P. sylvestris (Romagnesi, 1965; et al., 1986). Germination of basidiospores produces haploid Jansen, 1982) and has also been found associated with Cistus homokaryotic mycelia which can form mycorrhizas (Debaud sp. shrubs (Contu, 1991). Most laboratory work with H. et al., 1988). Mating between two compatible homokaryons cylindrosporum has been performed with P. pinaster. Under having different alleles at both the A and B loci gives a laboratory conditions H. cylindrosporum has been shown to dikaryon characterised by the presence of clamp connections form mycorrhizas with additional hosts, several of which do on the septa and having the two different haploid nuclei in not occur in its natural habitats. This is the case for several each of its cells. The dikaryotic mycelia can be inoculated to American plants such as the Pinaceae Larix laricina (Wong & sterile P. pinaster seedlings grown on a vermiculite substrate Fortin, 1989), the Rosaceae Dryas integrifolia (Melville et al., saturated with a defined medium. Under appropriate light 1987) or the Fagaceae Quercus acutissima and Q. serrata (Oh and temperature conditions, formation of ectomycorrhizas is et al., 1995). Attempts to associate H. cylindrosporum with followed within c. 3–6 months by the formation of sporulat- the model tree species Populus sp. have failed thus far (R. ing fruit bodies (Debaud & Gay, 1987, Fig. 1). In the basidia Marmeisse et al., personal observations). which form at the gill surface, the two haploid nuclei fuse and This wide host range offers the opportunity to address in the resulting diploid nucleus enters in meiosis to produce four the future questions relative to host/symbiont coevolution. It haploid nuclei. A postmeiotic mitosis leads to the formation should be possible to compare the cellular programmes that of four basidiospores each containing two identical nuclei. the fungus turns on or off in order to establish compatible Mendelian segregation has been observed within the haploid interactions with different hosts. Differences between hosts progeny for several heteroallelic markers including the A and would indicate that an ECM fungus has developed alternative B mating types (Debaud et al., 1986; Gryta et al., 2000). The strategies to interact with a wide range of hosts. capacity to complete its life cycle in vitro has been demonstrated for several wild-type dikaryotic strains (Debaud & Gay, 1987; Gryta et al., 2000) but also for dikaryons result- III. The Hebeloma cylindrosporum toolbox ing from crosses between mutant strains (Gay et al., 1994; Among the different factors which have led to the choice Marmeisse et al., 1998). Furthermore, the capacity to form of most model species (either microorganisms, plants or mycorhizas and fruit bodies is a stable attribute retained by animals) are their small size, their fast growth rate, their simple dikaryotic mycelia stored for long periods of time (30 years nutritional and environmental requirements and the ability to and more) at 4°C (R. Marmeisse et al., personal observations). complete their life cycles under laboratory conditions. Several of these factors have been decisive for the development of 2. Growth requirements and in vitro mycorrhiza genetic approaches to the dissection of different biological formation processes. More recently several other items have been added such as efficient genetic transformation protocols and a small Homokaryotic mycelia of heterothallic basidiomycete species genome size. Among the many ECM species studied H. are probably short-lived in the wild but can nevertheless be cylindrosporum is, thus far, one of the very few for which most grown indefinitely in vitro on artificial culture media. Both if not all of these different requirements are met. homokaryotic and dikaryotic mycelia of H. cylindrosporum have no strict nutritional requirements and they can be propagated on a wide range of liquid or solid media of 1. Completion of the life cycle in vitro controlled composition such as the Melin-Norkrans medium The most remarkable feature of H. cylindrosporum as an ECM and their derivatives (Norkrans, 1950; Gay, 1990). H. fungal species is that its entire life cycle, including fruit body cylindrosporum efficiently uses glucose, fructose or starch as formation, can be obtained under axenic conditions in the carbon sources but not galactose, sucrose, cellulose or pectins. laboratory using defined culture media (Fig. 1; Debaud & Gay, The inability to degrade plant cell wall carbohydrates is

widespread among ECM fungi and the inability to use sucrose to the antibiotic hygromycin B (Marmeisse et al., 1992). This probably implies that the fungus relies on plant invertases for protocol yielded transformants (between one to five per µg of its carbon nutrition in mycorrhizas as suggested for other transforming plasmid) which all had integrated one or several ECM species (Salzer & Hager, 1991). As nitrogen sources, copies of the plasmid in their genomes. The protocol allows H. cylindrosporum uses not only ammonium and nitrate but the introduction in the genome, by a process known as co- also several amino-acids, urea and proteins (Wipf et al., 2002; transformation, of a second plasmid which does not contain Guidot et al., 2004b). Homokaryotic mycelia differ from any selectable marker gene. Co-transformation was, for exam- dikaryotic ones by their slower radial growth rates and ple, utilised to introduce a functional copy of the nitrate morphology (Gay et al., 1993). reductase (NR) gene in the genome of NR– mutants to iden- Mycorrhizal syntheses were initially performed in growth tify which of the different NR– mutants were affected in the pouches or conical flasks filled with vermiculite saturated with structural NR gene ( Jargeat et al., 2000). Co-transformation growth medium (Piché & Fortin, 1982; Debaud & Gay, was also used to select transformant strains with hydrophobin 1987; Debaud et al., 1988). A Petri dish technique where genes from another ECM fungus Pisolithus tinctorius (Tagu sterile plant seedlings are placed flat onto a culture medium et al. 2002). was then developed (Wong & Fortin, 1989). This technique A second transformation protocol is based on the capacity allows a non-destructive monitoring of mycorrhiza formation of the bacterium Agrobacterium tumefaciens to transfer its which takes place within c. 2 weeks after inoculation of the T-DNA to fungal cells as it does to plant cells (Bundock roots with plugs of mycelium in the case of P. pinaster (Gay et al., 1995) was developed by Combier et al. (2003). This et al., 1994). Both techniques are equally effective to obtain protocol represents an interesting alternative to the traditional mycorrhizas not only using dikaryotic strains but also homo- protoplast-mediated transformation one. Firstly, this protocol karyotic ones (Debaud et al., 1988; Tranvan et al., 2000). can be implemented on intact fungal hyphae thus circumvent- Mycorrhizas formed by both dikaryons and homokaryons ing the need of making protoplasts. In this respect, we can fore- are similar and are characterised by a loose mantle and a see that numerous other ECM fungal species should soon Hartig net which can surround the first two external layers become amenable to genetic transformation using this tech- of plant root cells (Fig. 1). nique as already reported for Suillus bovinus (Hanif et al., The capacity of homokaryons to form ectomycorrhizas is 2002). Secondly, as opposed to circular or linear plasmids, the also known for the bolete Suillus granulatus (Ducamp et al., way the linear T-DNA integrates eukaryotic genomes is 1986) and the agaric Laccaria bicolor (Kropp et al., 1987). In known. Integration starts on its left border and proceeds the case of H. cylindrosporum, this essential characteristic has towards its right border. This characteristic allows an efficient been exploited for the first time among ECM fungi to select PCR-amplification of the genomic sequences flanking the T- recessive mutations affecting mycorrhiza differentiation (Gay DNA by protocols such as Thermal Asymetric InterLaced et al., 1994; Combier et al., 2004). (TAIL)-PCR one (Liu & Whittier, 1995). These different characteristics of the Agrobacterium mediated transformation have been exploited to develop large scale insertional muta- 3. Protoplasts, mutants and genetic transformation genesis programmes in plants (see Rios et al., 2002 or Lee The comprehension of any biological phenomenon is et al., 2003 for recent examples). It can be anticipated that indissociable from the characterisation of mutants and of trans- similar programmes could be launched at a lesser cost in ECM formants altered in the studied process. Yet, in ECM fungi fungi since fewer T-DNA transformants should be needed to this standard experimental approach remains the exception saturate a fungal genome which is smaller than plant one. and has only been reported for H. cylindrosporum. Regarding H. cylindrosporum, successful amplification by Protoplast preparation has been considered as an essential TAIL-PCR of T-DNA flanking sequences was reported by tool to master in order to select mutants and transformants Combier et al. (2003) who built up a collection of c. 2000 in a species which, as most ECM fungal species, does not T-DNA transformants. For this ECM species, A. tumefaciens- differentiate asexual vegetative spores. Isolation of viable mediated transformation fulfils all the necessary requirements protoplasts from homo- and dikaryotic mycelia of H. to carry out an insertional mutagenesis programme. cylindrosporum was first reported by Hébraud & Fèvre (1988). They have been successfully used to select several mutant 4. Gene structure and sequencing projects strains of interest following UV irradiation. This is the case of several auxotrophic mutants (R. Marmiesse et al., un- Although the size of the haploid genome of H. cylindrosporum published results), of mutants deficient in nitrate reductase has not been worked out, most reports indicate that the activity (Marmeisse et al., 1998) and of auxin-overproducer genomes of filamentous fungi are in the range of 2–5 107 bp mutants (Durand et al., 1992). (see Le Quéré et al., 2002 and references therein). Among the- Protoplasts were further used to establish a protocol of gen- non-protein-coding genes, the nuclear ribosomal (rDNA) etic transformation using a plasmid that conferred resistance gene cluster of H. cylindrosporum has been partially

New Phytologist (2004) 163: 481–498 www.newphytologist.org © New Phytologist (2004) 30 Tansley review Review 485 characterised in order to establish a molecular phylogeny of have led to the characterisation of a maximum of c. 2400 the genus Hebeloma based on the internal transcribed spacer tentative consensus sequences (TCs) which may represent as (ITS) sequences (Aanen et al., 2000) and to develop molecular many different genes. Considering that the genome of the probes to identify fungal genets in natural populations based filamentous ascomycete Neurospora crassa has c. 10 000 different on partial intergenic spacer (IGS) sequences (Guidot et al., protein-coding genes (Galagan et al., 2003) and that other 1999, section VI of this review). Protein coding sequence data filamentous fungi could have similar numbers of genes; 2400 are, however, quickly accumulating as a result of cDNA (EST) TCs could identify about 20% of the coding potential of sequencing programmes. the H. cylindrosporum genome. The coding sequences have a Information on protein-coding genomic sequences comes GC content of 52% and 50% of the TCs do not display any from the characterisation of the genes participating in nitrate similarity with sequences present in databases (E-value > 1E-5 assimilation (coding a nitrate transporter, a nitrate and a in BLASTX searches). Similar values were also reported for nitrite reductases) which are tightly linked and form a gene other EST programmes performed on basidiomycete species (see, cluster (Jargeat et al., 2000, 2003). The occurrence in H. e.g. Peter et al., 2003 and Johansson et al., 2004 for two ECM cylindrosporum of clusters of genes participating to a common species) and largely reflect the low number of basidiomycete metabolic pathway could facilitate future cloning of addi- DNA sequences in databases. tional pathways by a chromosome walking strategy. Analysis The H. cylindrosporum ESTs which are homologous to of the nitrate assimilation pathway also showed that the known genes fall into different functional categories which coding regions were regularly interrupted by introns which represent the main cellular functions expressed in a vegetative ranged in size between 40 and 120 bp, and which could eukaryotic cell such as metabolism, protein synthesis and deg- represent up to 25% of the length of the genes. A high density radation and cytoskeleton assembly. With respect to mycor- of regularly distributed introns has been reported many times rhiza functioning, the ESTs are distributed in several key in protein-coding genes of homobasidiomycete species and metabolism pathways such as nitrogen assimilation (Fig. 2 could represent a general feature of this taxonomic group (see and section V of this review) and allow a global view of such for example, Seitz et al., 1996). Furthermore, as already noted functions as opposed to traditional approaches which concen- by Schuren (1992) for basidiomycete genes, the splice junc- trate on a single gene or pathway. These ESTs open the way tions of H. cylindrosporum introns are rather degenerate, the to transcriptomic profiling of the H. cylindrosporum genome most conserved feature of the 38 introns identified in the during the transition from the free-living to the symbiotic nitrate assimilation gene cluster was that they started with status as already reported for Pisolithus microcarpus (Voiblet RMGT and ended with YAG although intron 1 of the nitrite et al., 2001) and Paxillus involutus (Johansson et al., 2004). reductase started with GC. These characteristics make it difficult to predict a polypeptide sequence accurately on the basis 5. Pinus pinaster, a host plant of growing interest of a genomic sequence. Progress in the understanding of the ECM symbiosis is Study of the ECM association is facilitated when biological now indissociable of large scale sequencing programmes, data are available for both partners. Although H. cylindro- which, by giving access to genes involved in most cellular sporum does not form mycorrhizas with the model tree functions, allow visualising how a genome responds to the Populus sp., it readily forms mycorrhizas with Pinus trees transition from a free-living status to a symbiotic one. Large- which are among the most extensively studied gymnosperm scale sequencing programmes also give access to key candidate species due to their high economic value. This is the case of genes which would have been time-consuming to characterise P. pinaster Ait., one of the natural host plants of H. cylindro- using conventional cloning strategies. While waiting for the sporum. P. pinaster is heavily used in afforestation programmes first complete genome sequence of an ECM fungus (Lammers in France and Southern Europe. Detailed genetic maps based et al., 2004; Martin et al., 2004) random sequencing of on the analysis of RAPD, protein and AFLP markers covering cloned cDNAs prepared from mRNA extracted from either the 12 chromosomes of this diploid species have been fungal and/or mycorrhizal tissues have been performed and established (Plomion et al., 1995; Costa et al., 2000). These published for the ECM fungi Pisolithus microcarpus (Voiblet maps have been used for the positioning of quantitative trait et al., 2001; Peter et al., 2003), Laccaria bicolor (Peter et al., loci controlling agronomic traits such as height (Plomion 2003), Tuber borchii (Lacourt et al., 2002) and Paxillus invo- et al., 1996). Furthermore, c. 1500 sequences generated by lutus (Johansson et al., 2004). Two similar expressed sequence random sequencing of genes (ESTs) expressed either in aerial tag (EST) sequencing programmes have been conducted on parts or roots of water-stressed plantlets as well as in the xylem H. cylindrosporum using mRNA extracted from mycelia grown of adult plants have been deposited in databases. Genes on synthetic media (Wipf et al., 2003; Lambilliotte et al., responding to water stress have also been specifically 2004). In both cases, the cDNAs were cloned in bacterial/yeast identified (Dubos & Plomion, 2003). This large number of shuttle plasmids which allow expression of the cloned cDNAs genes, along with a set of more than 10 000 unigenes in Saccharomyces cerevisiae. Together, these two programmes characterised from Pinus taeda (Kirst et al., 2003), can be used

to study how pine trees respond at the transcriptional level to communicate during ectomycorrhiza formation and the mycorrhizal interactions. Until now, the different transcriptomic molecular mechanisms involved in symbiotic structure studies of mycorrhiza differentiation have been performed differentiation remain largely unknown. As H. cylindrosporum with angiosperm trees ( Voiblet et al., 2001; Johansson et al., 2004) can be genetically manipulated, fungal mutants have been and it is of interest to compare the cellular reprogramming in used as tools to dissect the crosstalk between symbionts response to a common biotic interaction which operates in roots during mycorrhiza formation. of plant lineages which have diverged more than 300 Myr ago. 1. Role of fungal auxin in symbiotic structure 6. The missing tools differentiation In a toolbox there are always unused tools, old ones which A targeted approach was ﬁrst used to study the role of fungal need to be sharpened and perfected and space for new ones, auxin in the symbiotic interaction. Auxin is produced by most some of which have not yet been invented. In recent years, we if not all ECM fungi (Ek et al., 1983; Gay & Debaud, 1987) have seen an unprecedented accumulation of gene sequences and it was hypothesized by Slankis as early as 1973 that fungal from ECM fungal species. Several of these genes are suspected indoleacetic acid (IAA) could be a signal molecule involved to play essential roles in mycorrhiza formation or functioning in mycorrhiza formation. IAA-overproducing mutants of because they are either up or down regulated upon mycorrhiza H. cylindrosporum were used to address this hypothesis experi- formation (Laurent et al., 1999; Kim et al., 1999; Sundaram mentally. These mutants were obtained from UV-irradiated et al., 2001; Voiblet et al., 2001; Johansson et al., 2004). The list homokaryotic protoplasts. Because intracellular tryptophan of candidate genes will certainly increase rapidly with the availability was shown to be the main limiting factor for advent of full genome sequences already programmed in the fungal IAA production (Gay et al., 1994), Durand et al. (1992) case of L. bicolor (Lammers et al., 2004; Martin et al., 2004). selected tryptophan overproducing mutants of H. cylindrosporum Experimental evaluation of gene function will require the which turned out to be also IAA overproducers. When associated selection of mutant strains which can be obtained through with P. pinaster, these mutants formed 3–5 times more large scale mutagenesis programmes as described above using mycorrhizas compared to the wild-type strain (Gay et al., 1994, Agrobacterium T-DNA or by targeted gene inactivation. Fig. 1(b),(c). Mycorrhizas formed by wild-type and IAA Targeted gene inactivation can be achieved either by gene overproducing mutants differed from each other by the replacement or by RNA interference (RNAi). Homologous structure of the Hartig net (Gay et al., 1994; Gea et al., 1994). recombination, which is required for gene replacement, has In mycorrhizas formed by the wild-type homokaryons, the not yet been shown to operate in either H. cylindrosporum Hartig net was generally one hypha wide, uniseriate and or in other ECM fungi, but has been demonstrated in the restricted to the outer half of the root cortex (Fig. 1k,m). By saprotrophic homobasidiomycetes Phanerochaete chrysosporium contrast, IAA-overproducing mutants formed a hypertrophic (Alic et al., 1993) and Schizophyllum commune (Lengeler & Hartig net which frequently reached the endodermis (Fig. 1f ) Kothe, 1999; van Wetter et al., 2000). Similarly, RNAi was and was more than one hypha wide (Fig. 1h,i,j) so that outer developed for several fungal species including the basidiom- cortical cells were completely separated by a large number ycetous yeast Cryptococcus neoformans (Liu et al., 2002). of hyphae (Fig. 1l; Gea et al., 1994; Tranvan et al., 2000; Another essential tool which must be developed is the ex- Laurans et al., 2001). In mycorrhizas formed by the mutant pression of reporter genes such as the β-glucuronidase (GUS) strains, Gea et al. (1994) also reported the occurrence of or a Green Fluorescent Protein (GFP) which, when fused to Hartig net hyphae penetrating inside the living cortical cells, the promoters of genes of interest allow the direct visualisation a phenomenon which has never been reported in pine of their pattern of transcription in the different symbiotic ectomycorrhizas. The plant cortical cells had all the features of tissues. Preliminary results indicate that the GFP protein can be living cells and no necrotic or hypersensitive response could expressed and visualised in living hyphae of H. cylindrosporum be observed. Thus, although very invasive, the fungal mutants (D. Rekangalt & L. Fraissinet-Tachet, unpublished results). did not display a pathogen-like behaviour and IAA overproduction apparently did not affect the symbiotic status of the fungus. It only favoured Hartig net formation and allowed IV. Mycorrhiza differentiation the fungus to overcome the barriers which normally prevent Mycorrhiza differentiation involves dramatic changes in root ECM fungi from developing inside living host cortical cells. morphology, anatomy and physiology giving rise to highly According to Gea et al. (1994), fungal IAA may facilitate integrated symbiotic structures. The formation of these structures Hartig net formation by affecting host cell wall metabolism relies on tightly regulated ontogenic processes that involve and structure, resulting in a loosening of the cell wall com- signalling between partners. Ectomycorrhiza formation has parable to that observed in IAA-treated higher plant cells. These been extensively studied at both cytological and biochemical results strongly suggested the involvement of fungal auxin as levels but the mechanisms by which the fungus and plant a signal molecule in mycorrhiza formation, but its exact role

New Phytologist (2004) 163: 481–498 www.newphytologist.org © New Phytologist (2004) 32 Tansley review Review 487

Fig. 1 Mycorrhizal activity of Hebeloma cylindrosporum. (a) In vitro fruiting of a dikaryotic strain associated with Pinus pinaster. (b) P. pinaster tap-root inoculated with an IAA-overproducing homokaryotic mutant forms a high number of dichotomously branched mycorrhizas 3 weeks after inoculation (c) P. pinaster tap- root inoculated with the corresponding wild- type strain. (d) 1 week after inoculation, the IAA-overproducing mutant colonises the cortex of P. pinaster tap-roots, forming discontinuous patches of Hartig net (arrows). (f) 2–3 week after inoculation, the Hartig net had colonised the whole cortex of tap-roots (arrows). A differentiating mycorrhiza (star) merged through the colonised cortex. (e) Cross-section in a tap-root inoculated as in (f), except that the culture medium was supplemented with triiodo benzoic acid, an inhibitor of polar auxin transport. Under these conditions, the fungus does not form any Hartig net. (g) When a new short root emerges through a mycorrhizal tap-root, it becomes colonised when the tap-root endodermis brakes under the pressure of the growing primordium. A Hartig net can be seen (white arrows) in the basal part of the young primordium, inside the tap-root cortex. The cortex of the mycorrhiza primordium also had a Hartig net (black arrows). (h) 2–3 d later, the young mycorrhiza becomes dichotomously branched. At that stage, the Hartig net is more developed in the basal part of the mycorrhiza (white arrows), than in the outer part (black arrows). (i) 1 week later, the mycorrhiza has a well developed Hartig net (arrows) in the whole cortex. (j) In 3-week-old mycorrhizas, the Hartig net becomes over-developed (arrows) and cortical cells are completely separated from each other by proliferating Hartig net hyphae (stars). (k) This situation never happens in mycorrhizas formed by a wild-type mycelium; they are usually more elongated and show an uniseriate Hartig net (arrows). (l) Cross- section in a mutant mycorrhiza showing a thin mantle and a hypertrophic Hartig net which completely separates plant cortical cells. (m) Cross-section in a wild-type mycorrhiza showing a normal uniseriate Hartig net restricted to the outer cortex. C, cortex; CC, central cylinder; E, epidermis; HN, Hartig net; M, mantle; PCC, plant cortical cell; TRC, tap- root cortex; TRCC, tap-root central cylinder; Bars: (b) and (c), 2 mM; (d), 50 µM; (e)–(k), 100 µM (l) and (m), 25 µM. Pictures (g) and (k) are reprinted from Tree Physiology 20, Tranvan et al. Dynamics of symbiosis establishment between an IAA- overproducing mutant of the ectomycorrhizal fungus Hebeloma cylindrosporum and Pinus pinaster. pp. 123–129, copyright (2000), with permission of Heron Publishing.

and mode in the cascade of molecular events leading to sym- different stages of the symbiotic process. They also show that biotic structures differentiation remained to be elucidated. nonectomycorrhizal fungal mutants can be obtained through As auxin is known to affect the expression of numer- insertional mutagenesis, thus making possible the identi- ous plant genes (Napier & Venis, 1995; Sitbon & Perrot- fication of fungal genes essential for mycorrhiza formation. Rechenmann, 1997), Charvet-Candela et al. (2002) and This represents a major breakthrough in our ability to invest- Reddy et al. (2003) cloned several P. pinaster auxin-regulated igate the molecular mechanisms involved in ectomycorrhiza genes whose expression patterns were studied during mycorrhiza formation. formation. Noticeably, one of them encodes a putative tran- Although the myc– mutants were selected among trans- scription factor which was up-regulated at the very early stages formants, Combier et al. (2004) showed for three of them of ECM symbiosis establishment. This transcription factor that the myc– phenotype did not result from any of the plas- could be at the origin of a cascade of regulatory events con- mid integration in their genomes. Indeed, the myc– pheno- trolling the expression of secondary auxin-response genes types did not cosegregate with plasmid integrations in the similar to EgHypar, an auxin-inducible gene up-regulated during haploid progeny of crosses between the myc– mutants and a the differentiation of Eucalyptus globulus/Pisolithus tinctorius wild-type strain. This result is in accordance with previous ectomycorrhizas (Nehls et al., 1998). Altogether these results reports indicating that conventional transformation of patho- indicate that fungal IAA may act by regulating host plant genic fungi can generate a significant proportion of untagged gene expression in different ECM associations. Additional mutations (Kahmann & Basse, 1999). The fact that these studies are however, necessary to clarify the role of the cloned mutations are untagged could considerably delay the identi- plant genes in ectomycorrhiza formation and to analyse fication of the corresponding altered genes. For this reason, the fungal hormone signal transduction pathway during Combier et al. (2003) developed A. tumefaciens mediated mycorrhiza formation. transformation as an alternative method of insertional mutagenesis. This latter method is supposed to reduce the frequency of untagged mutations and to facilitate molecular 2. Identification of fungal genes required for cloning of inactivated genes (De Groot et al., 1998; Idnurm symbiosis establishment et al., 2004). To date, c. 2000 T-DNA transformants have A second promising approach used to dissect molecular events been generated and are being screened for symbiosis defect. So controlling symbiosis establishment is the characterisation of key far, two myc– and 12 poorly mycorrhizal mutants have been fungal genes controlling this process and whose inactivation identified and are currently being characterised at the mole- should lead to a non-mycorrhizal phenotype. An insertional cular level (J.-P. Combier et al., unpublished results). mutagenesis project was initiated with H. cylindrosporum in an attempt to identify such ‘symbiosis’ genes. Initially, V. Nutritional interactions Combier et al. (2004) used conventional plasmid-mediated transformation of protoplasts to select non-mycorrhizal (myc–) The major consequence of the ECM association on the fungal mutants. Out of 1725 homokaryotic transformants physiology of both partners is the reorientation of their screened on P. pinaster seedlings, 29-non-mycorrhizal (myc–) nutritional metabolisms. The fungal associate becomes a new mutants and 22 mutants which displayed a dramatically reduced sink for the plant photosynthetates which will support the mycorrhizal ability were identified. Light and scanning electron explorative behaviour of the metabolically active extraradical microscopy observations of pine roots inoculated with some hyphae and fruit body formation. In return the fungus provides of the myc– mutants suggested that mutants blocked at dif- its plant partners with essential nutrients such as N, P or K. ferent stages of the symbiotic process had been selected. Some An often measurable consequence of this new partnership is of them, named BAC (Blocked After Contact) seemed to be an overall improvement of the plant mineral nutrition which blocked at a very early stage of the interaction. Their hyphae may result in improved plant growth especially in soils where broke open as soon as they contacted the host root. Other one or several essential nutrients are present in limiting mutants proliferated at the surface of the plant root but their amounts or are not directly accessible to the plant. hyphae did not show any modification in their branching H. cylindrosporum has been studied with respect to its nitro- pattern. These latter mutants possibly did not perceive putative gen and phosphorus nutrition, although the presence among plant signal(s) that normally induce hyphal branching and ESTs of key genes participating in additional metabolisms subsequent mantle differentiation. This class of mutants was (such as potassium transmembrane transporters and chan- named MaD (Mantle Defective). A third class of mutants was nels) should expand the research interests on this fungus called HaND (Hartig Net Defective). These latter mutants (R. Lambilliotte et al., unpublished results). We have chosen form a poorly developed mantle but seem to be unable to to describe in detail H. cylindrosporum nitrogen metabolism in differentiate a Hartig net. These results support the idea that association or not with P. pinaster as it has been tackled from master genes, the products of which are essential for symbiosis different angles using a range of physiological, biochemical establishment do exist in ECM fungi and that they control and molecular techniques.

New Phytologist (2004) 163: 481–498 www.newphytologist.org © New Phytologist (2004) 34 Tansley review Review 489

Fig. 2 Current knowledge of N assimilation pathways in Hebeloma cylindrosporum. Enzymes and transport systems for which the corresponding coding genes have been cloned are mentioned using different character types. Names in italics indicate sequences originating from EST programmes; those which are not italicized designate genes originating from a different cloning procedure. In this latter case the full gene sequence is available and transcriptional and/or some other functional studies have been carried out. Pathways participating in primary assimilation of ammonium and the resulting major amino acid pools are in bold. AAT, aspartate aminotransferase; ALAT, alanine aminotransferase; ASN, asparagine synthetase; GAT, alanine glyoxylate aminotransferase; GOGAT, glutamate synthase. Enzymes participating to amino acid catabolism include an NAD-speciﬁc glutamate dehydrogenase, an arginase and an ornithine carbamoyl transferase. NRT2, NAR1 and NIR1 are, respectively, a nitrate transporter, a nitrate and nitrite reductase (Jargeat et al., 2000, 2003); AMT1, 2 and 3, GDH1 and GLN1 are, respectively, three ammonium transporters, a NADP-speciﬁc glutamate dehydrogenase and a glutamine synthetase (Javelle et al., 2001, 2003); GAP1 is a general amino acid permease (Wipf et al., 2002) and PRT1A and B are two oligopeptide transporters (M. Benjdia & D. Wipf, personal communication).

unrelated homo- or dikaryotic wild-type strains. The molecular 1. Metabolic versatility in N assimilation and biochemical basis of organic N use and of intraspecific It has been argued that one of the major nutritional benefits variation can now be investigated owing to the presence in of the ECM symbiosis results from the capacity of ECM fungi H. cylindrosporum EST databases of sequences that are highly to assimilate a range of soil nutrients that the plant cannot homologous to secreted proteases characterised in other directly access, such as protein forms of nitrogen, or does not fungi and to enzymes participating to amino acid catabolism assimilate preferentially, such as amino acids. (e.g. a NAD-specific glutamate dehydrogenase, arginase…) In vitro studies have shown that, in addition to ammonium (Fig. 2). and nitrate, H. cylindrosporum efficiently uses at least 12 Following its primary assimilation by extraradical hyphae, different amino acids, as well as proteins, as nitrogen sources amino acid N can be transferred to the plant as demonstrated (Wipf et al., 2002; Guidot et al., 2004b). Although this has in the case of glutamate-fed mycorrhizal P. pinaster plants by not been studied for all amino acids, it has been shown that Plassard et al. (2000). Growth of these plants was nevertheless glutamate cannot serve simultaneously as carbon and nitro- far below growth achieved by ammonium-fed-non-mycorrhizal gen sources for mycelial growth; its use as a nitrogen source plants, suggesting that either nitrogen transfer from the fungus requires the presence of simple sugars in the culture medium to the plant was inefficient or that the extraradical hyphae rep- which in the field can be supplied by the host plant (Scheromm resented a strong carbon sink which out-competed plant growth. et al., 1990; Plassard et al., 2000). As for other ECM species (Anderson et al., 1999; Rangel-Castro et al., 2002; Sawyer 2. Absorption and transport systems et al., 2003), both quantitative and qualitative intraspecific variations in use of organic N sources have been recorded in At the forefront of nutrient assimilation are transmembrane H. cylindrosporum (Guidot et al., 2004b). This is for instance transport systems which allow nutrient acquisition frequently the case for proteins which cannot be utilised by several against the soil solution/cytoplasm concentration gradient.

In the case of the mycorrhizal symbiosis, research interests and Plassard (2002) showed that as opposed to non-inoculated on transport systems are not limited to the soil/fungal cell P. pinaster roots which needed to be induced by nitrate for interface; such systems are also likely to be key players in one at least 3 d to reach a maximum uptake rate, mycorrhizas of the less understood process, the bi-directional exchange of formed between P. pinaster and Rhizopogon roseolus can nutrients between the two partners at the Hartig net interface. absorb nitrate immediately upon exposure to nitrate owing A major breakthrough in mycorrhiza research was the recent to the fact that fungal uptake system was expressed constitu- identification of plant phosphate transporters which seem to tively. In this case, which could possibly also apply to H. be specifically expressed in plant cells containing arbuscules of cylindrosporum, a consequence of the mycorrhizal association arbuscular mycorrhizal fungi (Rausch et al., 2001; Harrison under natural conditions could be that it allows an immediate et al., 2002). Similarly, it was also shown that rust biotrophic assimilation of a nutrient before being used by other com- pathogens specifically express sugar and amino acid trans- ponents of the soil microflora. porters in haustorial cells feeding inside living plant cells (Hahn et al., 1997; Voegele et al., 2001). Until now however, 3. Assimilation and regulation of N metabolism no symbiosis-specific transporters have been identified in the case of the ECM association and the function of the different Assimilation of most organic and inorganic N sources con- fungal transporters identified thus far in nutrient exchanges verge towards the formation of ammonium which is then between the two partners remains to be demonstrated. redistributed across different pathways for the synthesis of H. cylindrosporum is the ECM fungal species for which the biomolecules and of storage pools in N-replete mycelia largest number of transport systems involved in nitrogen (Fig. 2). Knowledge of these pathways and of their patterns of uptake has been characterised; they include a putative high regulation could lead to the identification of the molecules affinity nitrate transporter (NRT2; Jargeat et al., 2003), three transferred from the fungus to the plant and open an avenue ammonium transporters (AMT1, 2 and 3; Javelle et al., 2001, for the manipulation of the plant N nutrition through genetic 2003), a general amino acid permease (GAP1; Wipf et al. manipulation of its symbionts. 2002) and two oligopeptide transporters (PTR1a and 1b; M. In H. cylindrosporum, the nitrate assimilation pathway Benjdia & D. Wipf, personal communication). Their func- is the best studied of the different pathways participating to tions, substrate specificities and kinetic parameters have been the assimilation of complex N sources. Three structural genes studied by heterologous expression of the corresponding genes coding for the three components of this pathway have been (amt1, 2 and 3; gap1; ptr1a and 1b) in Saccharomyces cerevisiae. cloned. They code for a nitrate transport system and the The three ammonium transporters differ significantly from nitrate and nitrite reductases (Jargeat et al., 2000, 2003). each others by their affinities for methylamine. AMT2, 1 and Mutants deficient in nitrate reductase activity have been 3 are characterised by Km values at pH 6.1 of 58, 91 and selected and characterised (Marmeisse et al., 1998; Jargeat 260 µ, respectively. It has also been shown that in yeast et al., 2000). As already presented for the nitrate transporter AMT2 and 3 efficiently reabsorb ammonium which leaks out gene, transcription of the three genes of this pathway is not of the cells (Javelle et al., 2001). Finally, transcription of all induced by nitrate but only strongly repressed by the presence three genes is repressed by high (> ±1 m) concentrations of of ammonium in the culture medium which suggests that H. reduced N sources (ammonium or glutamine) while it is dere- cylindrosporum may not possess a pathway-specific regulatory pressed under nitrogen starvation or in the presence of other gene. These characteristics however, do not apply to all N sources such as nitrate (Javelle et al., 2003). These different ECM fungal species. Indeed, in the ascomycete Tuber borchii, characteristics suggest that hyphae can finely adjust their transcription of the nitrate reductase gene requires induction capacity to absorb ammonium according to its availability in by nitrate (Guescini et al., 2003) as already known for the soil solution. saprotrophic and pathogenic filamentous ascomycetes (see Similarly, the nitrate transporter gene nrt2 is highly transcribed Marzluf, 1997). under N deficiency even in the absence of nitrate which, in The three enzyme systems which participate to ammonium most organisms, acts as an inducer of the nitrate assimilation assimilation exist in H. cylindrosporum; their structural genes pathway (Jargeat et al., 2000, 2003). Altogether, these results have been cloned and their roles have been evaluated (Javelle suggest that H. cylindrosporum is able to scavenge efficiently et al., 2003; Fig. 2). A glutamine synthetase (GLN1)/gluta- any trace of inorganic nitrogen which is likely to be a growth- mate synthase (GOGAT) cycle operates and seems to ensure limiting nutrient in sandy soils where this species occurs. ammonium assimilation whatever the external ammonium

Using NO3-specific microelectrodes on intact P. pinaster root concentration. Indeed, transcription of the gln1 gene is not systems, Plassard et al. (2002) demonstrated that the influx affected by external ammonium concentration unlike the gdh1 of nitrate was reduced along H. cylindrosporum mycorrhizas gene, coding an anabolic NADP-specific glutamate dehydro- compared to the influxes measured along non-inoculated genase, which is down-regulated under high ammonium absorbing roots. The functional and ecological significance supply and therefore may only contribute to its assimilation of these data needs to be evaluated further. Indeed, Gobert when it occurs in limited amounts. This was further confirmed

New Phytologist (2004) 163: 481–498 www.newphytologist.org © New Phytologist (2004) 36 Tansley review Review 491

by showing that in a high NH4 medium, this latter enzyme records and analyses (e.g. Brunner et al., 1992; Cripps & cannot compensate the methionine sulphoximine-inhibition Miller, 1993), primarily because fruit bodies are relatively easy of GLN1 which results in a sharp decrease of the intracellular to sample and to identify at the species level. However, studies on glutamine pool and a simultaneous rise in the NH4 one ECM fungal communities performed by sampling mycorrhizas (Javelle et al., 2003). have repeatedly demonstrated that fungal diversity inferred These results can be compared with those obtained on from fruit body analysis did not match the below-ground Tuber borchii, the only other ECM fungus for which genes diversity (e.g. Gardes & Bruns, 1996; Dahlberg et al., 1997). coding an ammonium transporter (Montanini et al., 2002), a At the intraspecific level, the correspondence between above- NADP-GDH (Vallorani et al., 2002) and a GS gene (Mon- and below-ground populations is poorly documented. The tanini et al., 2003) have been cloned. In this ascomycete fun- main contributions of H. cylindrosporum to the field of ECM gus, as opposed to H. cylindrosporum, transcription of the gln1 fungal population biology has been (i) to establish if above gene is enhanced by ammonium starvation (Montanini et al., and below-ground fungal populations differed with respect to the 2003), while conflicting results have been reported for the diversity and the spatio-temporal distribution of the genets regulation of the NADP-GDH gene whose transcription was (ii) to highlight the potential effects of habitat characteristics found to be either repressed (Vallorani et al., 2002) or stimu- on the population dynamics of ECM fungal symbionts. This lated (Montanini et al., 2003) by high concentrations of was made possible by the development of a specific molecular ammonium. This suggests that the relative contribution of marker which allowed precise identification of genets (= indi- alternate pathways to ammonium assimilation may differ viduals) forming mycorrhizas in natural populations. between ECM fungi. The consequences of these differences in term of ability to transfer N to host plants under changing 1. Molecular tools for the analysis of below-ground environmental conditions has to be evaluated. populations Two specific molecular tools have been developed for the 4. Transfer to the host plant analysis of below-ground populations. One was devised to All studies on N metabolism have thus far been carried out identify the fungal genets forming the mycorrhizas, the using mycelia grown in pure culture in the absence of a host second allowed the species-specific quantification of the plant. From these studies we can conclude that the extra- below-ground fungal biomass. radical vegetative hyphae have the potential of using efficiently Fungal genet identification from mycorrhizas has been per- a whole range of N molecules present in limited amounts in formed for a small number of ECM species including Suillus the forest soil solution. None of the studies have, however, grevillei (Zhou et al., 2001), Rhizopogon vesiculosus and R. vin- investigated the mechanisms by which the fungus transfers icolor (Kretzer et al., 2003) by analyzing size polymorphism at N molecules to the plant at the Hartig net interface. It is of several microsatellite loci and for the ascomycete Cenococcum priority to identify which N compounds accumulate in sym- geophilum by sequencing a sequence characterized amplified biotic tissues as they could represent the molecules transferred region (SCAR) (Jany et al., 2002). Both these rather time- from the fungus to the plant. It is also of priority to identify consuming and expensive techniques represent an obstacle for which of the cloned genes and of the metabolic pathways are large scale studies. To circumvent this problem, a H. cylin- specifically expressed in the mycorrhizas. Studies carried out drosporum species-specific and highly polymorphic marker on Amanita muscaria suggest that the microenvironmental was characterised and evaluated. This marker (IGS2.1) is an conditions which prevail inside mycorrhizal roots, such as the internal c. 1500-bp-long fragment of the nuclear ribosomal high concentration in free sugars in the apoplasm, are sus- DNA intergenic spacer IGS2 (which separates the 5S and the ceptible to influence specifically the expression pattern of 18S ribosomal genes) (Guidot et al., 1999). This IGS2.1 genes in the Hartig net (Nehls et al., 2001). Preliminary results sequence, which could be amplified by PCR from field- by Wipf et al. (2002) show that the amino acid transporter collected mycorrhizas using specific primers, was shown to be gene gap1 of H. cylindrosporum is repressed in P. pinaster hypervariable with as many as 12 different restriction fragment mycorrhizas thus suggesting that this transport system length polymorphisms (RFLP) alleles identified in a sample of may only be involved in nutrient acquisition by extraradical 125 haploid strains (Guidot et al., 1999). These polymor- hyphae. phisms result not only from variable numbers of restriction sites but also from length variations which possibly originate from variable numbers of a T AG nucleotide motif. As VI. Genetic diversity and dynamics of H. 2 3 numerous alleles at the IGS2 locus are present in local popu- cylindrosporum populations in P. pinaster lations, it was demonstrated that studying the polymorphism forest ecosystems in the IGS2.1 sequence alone was sufficient to discriminate Genetic diversity and dynamics of ECM fungal communities almost all H. cylindrosporum genets colonising a patch of and populations have traditionally been based on fruit body forest floor (Guidot et al., 1999, 2002b).

To locate and quantify the below-ground fungal biomass (Gryta et al., 1997, 2000; Guidot et al., 2002b, 2004a). In this (represented by the mycorrhizas and the extraradical mycelia) apparently uniform ecosystem, this fungal species occurs in which plays a key role in nutrient uptake, a species-specific two distinct habitats within which the spatio-temporal dynamics quantification of H. cylindrosporum DNA in soil samples was of local populations are strikingly different and illustrate the developed (Guidot et al., 2002a). This competitive PCR two extreme population structures described for other ECM (cPCR) method can detect as little as 1.5 pg of H. cylindrospo- fungal species (Dahlberg & Stenlid, 1990; De La Bastide rum DNA in complex DNA mixtures extracted directly from et al., 1994; Dahlberg, 1997; Bonello et al., 1998; Gherbi 0.5 g of soil. Similar methods based on real-time quantitative et al., 1999; Sawyer et al., 1999; Zhou et al., 1999; Fiore- PCR have been developed for Suillus bovinus and Paxillus Donno & Martin, 2001; Redecker et al., 2001; Bergemann & involutus and are expected to give information on their myc- Miller, 2002; Dunham et al., 2003; Kretzer et al., 2003). elia below-ground distribution (Landeweert et al., 2003). The first habitat (referred to as the ‘dune habitat’ in Guidot et al., 2002b) is the extreme western fringe of the forest which marks the transition with the bare dune. In this habitat, popu- 2. Correspondence between above- and below- lations of H. cylindrosporum are dominated by a low density ground populations of large, perennial genets each producing numerous fruit These molecular methods allowed investigation of the ‘below- bodies (up to 50 or more). These genets whose lifespan can reach ground’ populations of an ECM fungus for the first time. 10–15 years or more, extend in size (c. 50 cm yr−1) by veget- These studies, carried out in four P. pinaster stands in South- ative growth of their below-ground mycelia (Fig. 3a) (Gryta West France, established that in soil areas of c. 1 m2 or less, the et al., 1997, 2000; Guidot et al., 2002b). The low frequency of number of H. cylindrosporum genets colonising the root small size genets (i.e. of ‘young’, newly established individuals) system range from one to as many as 350 (Guidot et al., in this dune habitat suggests a low level of sexual recruit- 2001). In areas where all fruit bodies were formed by the same ment despite the large number of fruit bodies (and spores) genet, only this genet was identified on the roots. By contrast, produced by each genet. The second habitat (the ‘forest in areas where fruit bodies were formed by different genets, habitat’ in Guidot et al., 2002b) is more inland but only in in addition to these latter fruiting genets, other non-fruiting places subjected to a high level of human-induced disturbances genets were also present on the roots (Guidot et al., 2001). such as car park borders, recreational areas or campsites. In Moreover, it was demonstrated that H. cylindrosporum below- this habitat, populations are exclusively composed of annual ground mycelia do not spread more than 50 cm away from genets each producing on average 1.6 fruit bodies and being existing fruit bodies (Guidot et al., 2002a), and that fruit eliminated from the root system within a year following fruit body disappearance at a given place was associated with the body formation while new genets appear the next year in disappearance of the corresponding mycorrhizas and mycelia other soil areas (Fig. 3b) (Gryta et al., 1997; Guidot et al., within one year (Guidot et al., 2001, 2004a). Therefore, in 2002b, 2004a). the case of H. cylindrosporum, although there is not a strict H. cylindrosporum can thus be considered as a fugitive spe- correspondence between the total numbers of genets present cies defined as good coloniser but poor competitor (Hutchin- below-ground and of those forming fruit bodies, populations son, 1951). Its genets survive for several years only in the dune studies based on the sampling and analysis of fruit bodies give habitat where few other ECM fungal competitors are present. an unbiased picture of both the genetic diversity and the In this respect, this dune habitat could represent the optimal spatio-temporal distribution of the below-ground mycelia. habitat for this species. By contrast, it has been suggested that Although a similar correlation between above- and below- in the forest habitat, frequent sexual recruitment is favoured ground populations was established for Suillus grevillei (Zhou by human-induced disturbances which may possibly result in et al. 2001), it is premature to conclude that such a correlation localised elimination of competitors (Guidot et al., 2004a). As is a rule. It would indeed be of interest to extend these studies a result, the occurrence at a local scale of ECM fungal species to species such as Piloderma croceum or thelephoroid species with distinct ecological requirements could contribute to known to predominate as mycorrhizas in some ECM com- maintain in highly disturbed habitats the entire root system munities but rarely observed as fruit bodies (Gardes & Bruns, of plants associated with fungi. Whether the recurrent re- 1996; Dahlberg et al., 1997). establishment of H. cylindrosporum in the human disturbed forest habitat depends upon a continuous inflow of spores from stable populations present in the dune habitat remains 3. Two extreme patterns of population dynamics an open question. according to the habitat characteristics The 10-year-long survey of H. cylindrosporum populations The spatio-temporal structures of natural populations of H. in these two contrasted habitats demonstrated that the ECM cylindrosporum have been studied over a 10-year period by symbiosis is a highly dynamic association in the sense that a sampling fruit bodies in P. pinaster forest stands located in the given fungal species can colonise a significant fraction of the dune forest ecosystem along the S-W Atlantic coast of France root system one year and can be completely eliminated and

New Phytologist (2004) 163: 481–498 www.newphytologist.org © New Phytologist (2004) 38 Tansley review Review 493

Fig. 3 Genets of Hebeloma cylindrosporum differ with respect to their lifespan in the two habitats where this species occurs. (a) Distribution of the fruit bodies of a perennial genet in the ‘dune habitat’ from 1993 to 2000 illustrating the growth of a perennial below- ground mycelium. (b) Spatial distribution of patches of fruit bodies in a ‘disturbed forest habitat’ site from 1990 to 2000. Each patch encompasses several annual genets between two and possibly several hundreds. These genets die within a year after fruit body formation being replaced the next year by new genets which appear in new soil areas. Fruit bodies are represented by small symbols, a unique symbol is attributed to each year of observation of fruit bodies (a). Each patch of fruit bodies is represented by a square, inside which is its corresponding year of observation (b). Pinus pinaster trees are represented by large black stars.

replaced in the ‘next generation’ of mycorrhizas by other appears highly dependent upon environmental conditions. species. Fungal colonisation can result from either meiospore However, the respective contribution of perennial vs. annual germination or from the vegetative spread of perennial mycelia. ECM mycelia to the global functioning of the symbiosis Both these mechanisms have been observed in the case of H. remains unknown. It has been suggested by Guidot et al. cylindrosporum and the balance between these two mechanisms (2002b) that the large perennial genets of H. cylindrosporum

observed in the dune habitat could have originated from Acknowledgements the progressive elimination, possibly through intraspecific competition, of all other genets initially present on the root We would like to thank all our Colleagues who have con- system. Elimination of genets from the root system can be tributed in the recent years to promote Hebeloma cylindro- a purely random and stochastic process. Alternatively, as sug- sporum as a model species and who have accepted to share gested for the Rhizobium-legume symbiosis (Denison, 2000), some of their unpublished results: M. Benjdia, B. Botton, elimination could be an ‘active’ process controlled by the host A. Brun, M. Chalot, H. Gryta, P. Jargeat, C. Plassard, C. Raffier, plant which sanctions ineffective symbionts. In this respect, a M.-C. Verner, D. Wipf and S. Zimmermann. comparative study of the symbiotic performances of the annual and of the perennial genets of H. cylindrosporum could References demonstrate if symbiotic effectiveness is a selected character in ECM fungal populations. Aanen DK, Kuyper TW, Boekhout T, Hoekstra RF. 2000. Phylogenetic relationships in the genus Hebeloma based on ITS1 and 2 sequences, with special emphasis on the Hebeloma crustuliniforme complex. Mycologia 92: 269–281. VII. Future directions Alic M, Akileswaran L, Gold MH. 1993. Gene replacement in the lignin- Even if the most fundamental and original aspects of ECM degrading basidiomycete Phanerochaete chrysosporium. Gene 136: 307– symbiosis functioning still need to be explored, we believe 311. Anderson IC, Chambers SM, Cairney JW. 1999. Intra- and interspecific that many of the obstacles which had, thus far, prevented or variation in patterns of organic and inorganic nitrogen utilization by three at least hampered their study are now largely lifted in the case Australian Pisolithus species. Mycological Research 103: 1579–1587. of H. cylindrosporum. Future research on this organism should Avis PG, McLaughlin DJ, Dentinger BC, Reich PB. 2003. Long-term make use of the ever accumulating genetic and molecular data increase in nitrogen supply alters above- and below-ground (cloned genes, EST resources) to tailor genetically modified ectomycorrhizal communities and increases the dominance of Russula spp. in a temperate oak savanna. New Phytologist 160: 239–253. strains with distinctive symbiotic properties. In this respect, Bergemann SE, Miller SL. 2002. Size, distribution, and persistence of genets it is essential to master targeted gene inactivation by in local populations of the late-stage ectomycorrhizal basidiomycete, homologous recombination or gene silencing by RNA Russula brevipes. New Phytologist 156: 313–320. interference. Nevertheless, appropriate genetic screens of large Bonello P, Bruns TD, Gardes M. 1998. Genetic structure of a natural collections of genetically modified strains obtained by an population of the ectomycorrhizal fungus Suillus pungens. New Phytologist 138: 533–542. untargeted gene inactivation strategy is also likely to identify Bruchet G. 1980. Hebeloma cylindrosporum Romagnesi. Revue Forestière essential genes and functions which have not been suspected Française. 3: 294–295. to participate in mycorrhiza differentiation and functioning. Brundrett MC. 2002. Coevolution of roots and mycorrhizas of land plants. In this respect, beyond the elucidation of basic mechanisms New Phytologist 154: 275–304. which control ectomycorrhiza formation and functioning, Brunner I, Brunner F, Laursen GA. 1992. Characterisation and comparison of macrofungal communities in an Alnus tenuifolia and an Alnus crispa research on ectomycorrhizas could contribute significantly to forest in Alaska. Canadian Journal of Botany 70: 1247–1258. broader research fields such as plant pathology by addressing Bundock P, den-Ras Dulk A, Beijersbergen A, Hooykaas PJJ. 1995. key questions relative to the coevolution between plants and Trans-kingdom T-DNA transfer from Agrobacterium tumefaciens to microorganisms and the basic differences which separate Saccharomyces cerevisiae. EMBO Journal 14: 3206–3214. pathogenic from symbiotic interactions. Burgmann H, Widmer F, Sigler WV, Zeyer J. 2003. mRNA extraction and reverse transcription-PCR protocol for detection of nifH gene expression Until now, mycorrhiza differentiation and functioning on by Azotobacter vinelandii in soil. Applied and Environmental Microbiology the one hand and population/community biology of ECM 69: 1928–1935. fungi on the other hand have largely evolved as two distinct Cairney JWG. 1999. Intraspecific physiological variation: implications for research fields. They are likely to converge in the framework understanding functional diversity in ectomycorrhizal fungi. Mycorrhiza 9: of a new molecular ecology where functional marker genes 125–135. Charvet-Candela V, Hitchin S, Ernst D, Sandermann H, Marmeisse R, (e.g. metabolic genes) will be used to address key questions Gay G. 2002. Characterization of an Aux/IAA cDNA upregulated in such as the identification of the main nutrient sources that a Pinus pinaster roots in response to colonization by the ectomycorrhizal mycelium really use in a soil, its capacity to adjust to changes fungus Hebeloma cylindrosporum. New Phytologist 154: 769–777. Combier J-P, Melayah D, Raffier C, Pépin R, Marmeisse R, Gay G. 2004. in nutrient availability such as localised N deposition and the – functional diversity of fungi co-occurring on the same root Non mycorrhizal (myc ) mutants of Hebeloma cylindrosporum obtained through insertional mutagenesis. Molecular Plant–Microbe Interactions. system. Measuring gene expression profiles of specific micro- (In press). organisms directly in soil is feasible and has already been Combier J-P, Melayah D, Raffier C, Gay G, Marmeisse R. 2003. reported for bacteria (Burgmann et al., 2003; Wellington Agrobacterium tumefaciens-mediated transformation as a tool for et al., 2003). These questions can now be addressed using insertional mutagenesis in the symbiotic ectomycorrhizal fungus Hebeloma H. cylindrosporum which is one of the very few ECM species cylindrosporum. FEMS Microbiology Letters 220: 141–148. Contu M. 1991. Contributo allo studio del genere Hebeloma for which both metabolic genes and natural populations have (Basidiomycetes, Cortinariaceae) in Sardegna (Italia). Revista been thoroughly characterised. Iberoamericana de Micologia 8: 38–42.

New Phytologist (2004) 163: 481–498 www.newphytologist.org © New Phytologist (2004) 40 Tansley review Review 495

Costa P, Pot D, Dubos C, Frigerio J-M, Pionneau C, Bodenes C, Bell-Pedersen D, Nelson MA, Werner-Washburne M, Selitrennikoff CP, Bertocchi E, Cervera M-T, Remington DL, Plomion C. 2000. A genetic Kinsey JA, Braun EL, Zelter A, Schulte U, Kothe GO, Jedd G, map of maritime pine based on AFLP, RAPD and protein markers. Mewes W, Staben C, Marcotte E, Greenberg D, Roy A, Foley K, Naylor Theoretical and Applied Genetics. 100: 39–48. J, Stange-Thomann N, Barrett R, Gnerre S, Kamal M, Kamvysselis M, Courtecuisse R, Duhem B. 2000. Champignons de France et d’Europe. Mauceli E, Bielke C, Rudd S, Frishman D, Krystofova S, Rasmussen C, Lausanne, Switzerland: Delachaux et Niestlé. Metzenberg RL, Perkins DD, Kroken S, Cogoni C, Macino G, Cripps C, Miller OK Jr. 1993. Ecto-mycorrhizal fungi associated with aspen Catcheside D, Li W, Pratt RJ, Osmani SA, DeSouza CP, Glass L, on three sites in the north-central Rocky Mountains. Canadian Journal of Orbach MJ, Berglund JA, Voelker R, Yarden O, Plamann M, Seiler S, Botany 71: 1414–1420. Dunlap J, Radford A, Aramayo R, Natvig DO, Alex LA, Mannhaupt G, Dahlberg A. 1997. Population ecology of Suillus variegatus in old Swedish Ebbole DJ, Freitag M, Paulsen I, Sachs MS, Lander ES, Nusbaum C, Scots pine forests. Mycological Research 101: 47–54. Birren B. 2003. The genome sequence of the filamentous fungus Dahlberg A, Jonsson L, Nylund JE. 1997. Species diversity and distribution Neurospora crassa. Nature 422: 859–868. of biomass above and below ground among ectomycorrhizal fungi in an Gardes M, Bruns TD. 1996. Community structure of ectomycorrhizal fungi old-growth Norway spruce forest in South Sweden. Canadian Journal of in a Pinus muricata forest: above- and below-ground views. Canadian Botany 75: 1323–1335. Journal of Botany 74: 1572–1583. Dahlberg A, Stenlid J. 1990. Population structure and dynamics in Suillus Gay G. 1990. Effects of the ectomycorrhizal fungus Hebeloma hiemale on bovinus as indicated by spatial distribution of fungal clones. New adventitious root formation in derooted Pinus halepensis shoot hypocotyls. Phytologist 115: 487–493. Canadian Journal of Botany 68: 1265–1270. De Groot MJA, Bundock P, Hooykaas PJJ, Beijersbergen AGM. 1998. Gay G, Debaud JC. 1987. Genetic study on indole-3-acetic acid production Agrobacterium tumefaciens-mediated transformation of filamentous fungi. by ectomycorrhizal Hebeloma species. inter- and intra-specific variability in Nature Biotechnology 16: 839–842. homo- and di-karyotic mycelia. Applied Microbiology and Biotechnology 26: De La Bastide P, Kropp BR, Piché Y. 1994. Spatial distribution and 141–146. temporal persistence of the discrete genotypes of the ectomycorrhizal Gay G, Marmeisse R, Fouillet P, Bouletreau M, Debaud J-C. 1993. fungus Laccaria bicolor (Maire) Orton. New Phytologist 127: 547–556. Genotype/nutrition interaction in the ectomycorrhizal fungus Hebeloma Debaud J-C, Gay G. 1987. In vitro fruiting under controlled conditions of cylindrosporum Romagnesi. New Phytologist 123: 335–343. the ectomycorrhizal fungus Hebeloma cylindrosporum associated with Pinus Gay G, Normand L, Marmeisse R, Sotta B, Debaud J-C. 1994. Auxin pinaster. New Phytologist 105: 429–435. overproducer mutants of Hebeloma cylindrosporum Romagnesi have Debaud J-C, Gay G, Bruchet G. 1986. Intraspecific variability in an increased mycorrhizal activity. New Phytologist 128: 645–657. ectomycorrhizal fungus: Hebeloma cylindrosporum. I-Preliminary studies Gea L, Normand L, Vian B, Gay G. 1994. Structural aspects of on in vitro fruiting spore germination and sexual comportment. In: ectomycorrhizas of Pinus pinaster (Ait.) Sol. formed by an IAA Gianinazzi-Pearson V, Gianinazzi S., eds. Physiological and genetical aspects overproducer mutant of the fungus Hebeloma cylindrosporum Romagnesi. of mycorrhizae. Paris, France: INRA. 581–588. New Phytologist 128: 659–670. Debaud J-C, Gay G, Prevost A, Lei J, Dexheimer J. 1988. Ectomycorrhizal Gherbi H, Delaruelle C, Selosse MA, Martin F. 1999. High genetic ability of genetically different homokaryotic and dikaryotic mycelia of diversity in a population of the ectomycorrhizal basidiomycete Laccaria Hebeloma cylindrosporum. New Phytologist 108: 323–328. amethystina in a 150-year-old beech forest. Molecular Ecology 8: 2003–13. − Denison RF. 2000. Legume sanctions and the evolution of symbiotic Gobert A, Plassard C. 2002. Differential NO3 dependent patterns of − cooperation by Rhizobia. American Naturalist 156: 567–576. NO3 uptake in Pinus pinaster, Rhizopogon roseolus and their Dubos C, Plomion C. 2003. Identification of water-deficit responsive genes ectomycorrhizal association. New Phytologist 154: 509–516. in maritime pine (Pinus pinaster Ait.) roots. Plant Molecular Biology 51: Godbout C, Fortin JA. 1990. Cultural control of basidiome formation in 249–262. Laccaria bicolor with container-grown white pine seedlings. Mycological Ducamp M, Poitou N, Olivier JM. 1986. Comparaison cytologique et Research 94: 1051–1058. biochimique entre cultures monospore et boutures de carpophores chez Gryta H, Debaud J-C, Effosse A, Gay G, Marmeisse R. 1997. Fine scale Suillus granulatus. In. Gianinazzi-Pearson V, Gianinazzi S., eds. structure of populations of the ectomycorrhizal fungus Hebeloma Physiological and genetical aspects of mycorrhizae. Paris, France: INRA. cylindrosporum in coastal sand dune forest ecosystems. Molecular Ecology 6: 575–579. 353–364. Dunham SM, Kretzer A, Pfrender ME. 2003. Characterization of pacific Gryta H, Debaud J-C, Marmeisse R. 2000. Population dynamics of the golden chanterelle (Cantharellus formosus) genet size using co-dominant symbiotic mushroom Hebeloma cylindrosporum: mycelial persistence and microsatellite markers. Molecular Ecology 12: 1607–1618. inbreeding. Heredity 84: 294–302. Durand N, Debaud JC, Casselton LA, Gay G. 1992. Isolation and Guescini M, Pierleoni R, Palma F, Zeppa S, Vallorani L, Potenza L, preliminary characterization of 5-fluoroindole-resistant and IAA- Sacconi C, Giomaro G, Stocchi V. 2003. Characterization of the Tuber overproducer mutants of the ectomycorrhizal fungus Hebeloma borchii nitrate reductase gene and its role in ectomycorrhizae. Molecular cylindrosporum Romagnesi. New Phytologist 121: 545–553. Genetics and Genomics 269: 807–816. Ek M, Ljungquist PO, Stenström E. 1983. Indole-3-acetic acid production Guidot A, Debaud J-C, Effosse A, Marmeisse R. 2004a. Below-ground by mycorrhizal fungi determined by gas chromatography-mass distribution and persistence of an ectomycorrhizal fungus. New Phytologist spectrometry. New Phytologist 94: 401–407. 161: 539–547. Fiore-Donno AM, Martin F. 2001. Populations of ectomycorrhizal Laccaria Guidot A, Debaud J-C, Marmeisse R. 2001. Correspondence between genet amethystina and Xerocomus spp. show contrasting colonization patterns in diversity and spatial distribution of above- and below-ground populations a mixed forest. New Phytologist 152: 533–542. of the ectomycorrhizal fungus Hebeloma cylindrosporum. Molecular Ecology Fleming LV, Deacon JW, Last FT, Donaldson SJ. 1984. Influence of 10: 1121–1131. propagating soil on the mycorrhizal succession of birch seedlings Guidot A, Debaud J-C, Marmeisse R. 2002a. Spatial distribution of the transplanted to a field site. Transactions of the British Mycological Society 82: below-ground mycelia of an ectomycorrhizal fungus inferred from specific 707–711. quantification of its DNA in soil samples. FEMS Microbiology Ecology 42: Galagan JE, Calvo SE, Borkovivh KA, Selker EU, Read ND, Jaffe D, 477–486. FitzHugh W, Ma LJ, Smirnov S, Purcell S, Rehman B, Elkins T, Guidot A, Gryta H, Gourbiere F, Debaud J-C, Marmeisse R. 2002b. Forest Engels R, Wang S, Nielsen CB, Butler J, Endrizzi M, Qui D, Ianakiev P, habitat characteristics affect balance between sexual reproduction and

clonal propagation of the ectomycorrhizal mushroom Hebeloma bicolor, is functionally related to vesicular transport and autophagocytosis. cylindrosporum. Oikos 99: 25–36. Journal of Bacteriology 181: 1963–1967. Guidot A, Lumini E, Debaud J-C, Marmeisse R. 1999. The nuclear rDNA Kirst M, Johnson AF, Baucom C, Ulrich E, Hubbard K, Staggs R, Paule C, intergenic spacer as a target sequence to study intraspecific diversity of the Retzel E, Whetten R, Sederoff R. 2003. Apparent homology of expressed ectomycorrhizal Hebeloma cylindrosporum directly on Pinus tree root genes from wood-forming tissues of loblolly pine (Pinus taeda L.) with system. Applied and Environmental Microbiology 65: 903–909. Arabidopsis thaliana. Proceedings of the National Academy of Sciences, USA Guidot A, Verner M-C, Debaud J-C, Marmeisse R. 2004b. Intraspecific 100: 7383–7388. variation in use of different nitrogen sources by the ectomycorrhizal fungus Kretzer AM, Dunham S, Molina R, Spatafora JW. 2003. Microsatellite Hebeloma cylindrosporum. Mycorrhiza. (In press). markers reveal the below ground distribution of genets in two species of Hahn M, Neef U, Stuck C, Göttfer K, Mendgen K. 1997. A putative Rhizopogon forming tuberculate ectomycorrhizas on Douglas fir. New amino acid transporter is specifically expressed in haustoria of the rust Phytologist. 161: 313–320. fungus Uromyces fabae. Molecular Plant–Microbe Interactions. 10: 438– Kropp BR, McAffee BJ, Fortin JA. 1987. Variable loss of ectomycorrhizal 445. ability in monokaryotic and dikaryotic cultures of Laccaria bicolor. Hanif M, Pardo AG, Gorfer M, Raudaskoski M. 2002. T-DNA transfer and Canadian Journal of Botany 65: 500–504. integration in the ectomycorrhizal fungus Suillus bovinus using Lacourt I, Duplessis S, Abbà S, Bonfante P, Martin F. 2002. Isolation and hygromycin B as a selectable marker. Current Genetics 4: 183–188. characterization of differentially expressed genes in the mycelium and fruit Harrison MJ, Dewbre GR, Liu J. 2002. A phosphate transporter from body of Tuber borchii. Applied and Environmental Microbiology. 68: 4574– Medicago truncatula involved in the acquisition of phosphate released by 4582. arbuscular mycorrhizal fungi. Plant Cell 14: 2413–2429. Lambilloitte R, Cooke R, Samson D, Fizames C, Gaymard F, Plassard C, Hébraud M, Fèvre M. 1988. Protoplast production and regeneration from Tatry M-V, Berger C, Laudi M, Legeai F, Karsenty E, Delseny M, mycorrhizal fungi and their use for isolation of mutants. Canadian Journal Zimmermann S, Sentenac H. 2004. Large scale identification of genes in of Microbiology 34: 157–161. the fungus Hebeloma cylindrosporum paves the way to molecular analyses Hibbett DS, Gilbert L-B, Donoghue MJ. 2000. Evolutionary instability of of ectomycorrhizal symbiosis. New Phytologist 164: in press. ectomycorrhizal symbioses in basidiomycetes. Nature 407: 506–508. Lammers P, Tuskan GA, DiFazio SP, Podila GK, Martin F. 2004. Högberg MN, Högberg P. 2002. Extramatrical ectomycorrhizal mycelium Mycorrhizal symbionts of Populus to be sequenced by the United States contributes one-third of microbial biomass and produces, together with Department of Energy’s Joint Genome Institute. Mycorrhiza 14: associated roots, half the dissolved organic carbon in a forest soil. New 63–64. Phytologist 154: 791–795. Landeweert R, Veenman C, Kuyper TW, Fritze H, Wernars K, Smit E. Hutchinson GE. 1951. Copepodology for the ornithologist. Ecology 32: 2003. Quantification of ectomycorrhizal mycelium in soil by real-time 571–577. PCR compared to conventional quantification techniques. FEMS Idnurm A, Reedy JL, Nussbaum JC, Heitman J. 2004. Cryptococcus Microbiology Ecology 45: 283–292. neoformans virulence gene discovery through insertional mutagenesis. Last FT, Mason PA, Wilson J, Deacon JW. 1983. Fine roots and sheathing Eucaryotic Cell 3: 420–429. mycorrhizas. Their formation, function and dynamics. Plant and Soil 71: Jansen AE. 1982. Lactarius hysginus en Hebeloma cylindrosporum. Coolia 25: 9–21. 62–67. Laurans F, Pépin R, Gay G. 2001. Fungal auxin overproduction affects the Jany JL, Garbaye J, Martin F. 2002. Cenococcum geophilum populations anatomy of Hebeloma cylindrosporum-Pinus pinaster ectomycorrhizas. Tree show a high degree of genetic diversity in beech forests. New Phytologist Physiology 21: 533–540. 154: 651–659. Laurent P, Voiblet C, Tagu D, de Carvalho D, Nehls U, De Bellis R, Jargeat P, Gay G, Debaud J-C, Marmeisse R. 2000. Transcription of a Balestrini R, Bauw G, Bonfante P, Martin F. 1999. A novel class of nitrate reductase gene isolated from the symbiotic basidiomycete fungus ectomycorrhizal-regulated cell wall polypeptides in Pisolithus tinctorius. Hebeloma cylindrosporum does not require nitrate induction. Molecular and Molecular Plant–Microbe Interactions 12: 862–871. General Genetics 263: 948–956. Le Quéré A, Johansson T, Tunlid A. 2002. Size and complexity of the Jargeat P, Rekangalt D, Verner M-C, Gay G, Debaud J-C, Marmeisse R, nuclear genome of the ectomycorrhizal fungus Paxillus involutus. Fungal Fraissinet-Tachet L. 2003. Characterisation and expression analysis of Genetics and Biology 36: 234–241. a nitrate transporter and nitrite reductase genes, two members of a gene Lee S, Kim J, Son J-S, Nam J, Jeong D-H, Lee K, Jang S, Yoo J, Lee J, cluster for nitrate assimilation from the symbiotic basidiomycete Hebeloma Lee D-Y, Kang H-G, An G. 2003. Systematic reverse genetic screening of cylindrosporum. Current Genetics 43: 199–205. T-DNA tagged genes in rice for functional genomic analyses: MADS-box Javelle A, Morel M, Rodriguez-Pastrana B-C, Botton B, André B, Marini genes as a test case. Plant Cell Physiology 44: 1403–1411. A-M, Brun A, Chalot M. 2003. Molecular characterization, function and Lengeler KB, Kothe E. 1999. Mated: a putative peptide transporter of regulation of ammonium transporters (Amt) and ammonium- Schizophyllum commune expressed in dikaryons. Current Genetics 36: metabolizing enzymes (GS, NADP-GDH) in the ectomycorrhizal fungus 159–164. Hebeloma cylindrosporum. Molecular Microbiology 47: 411–430. Lilleskov EA, Fahey TJ, Horton TR, Lovett GM. 2002. Belowground Javelle A, Rodriguez-Pastrana B-C, Jacob C, Botton B, Brun A, André B, ectomycorrhizal fungal community change over a nitrogen deposition Marini A-M, Chalot M. 2001. Molecular characterization of two gradient in Alaska. Ecology. 83: 104–115. ammonium transporters from the ectomycorrhizal fungus Hebeloma Liu H, Cottrell T, Pierini L, Goldman W, Doering T. 2002. RNA cylindrosporum. FEBS Letters 505: 393–398. interference in the pathogenic fungus Cryptococcus neoformans. Genetics Johansson T, Le Quéré A, Ahren D, Söderström B, Erlandsson R, 106: 463–470. Lundeberg J, Uhlén M, Tunlid A. 2004. Transcriptional responses of Liu YG, Whittier RF. 1995. Thermal asymmetric interlaced PCR. Paxillus involutus and Betula pendula during formation of ectomycorrhizal automatable amplification and sequencing of insert end fragments from root tissue. Molecular Plant–Microbe Interactions. 17: 202–215. P1 and YAC clones for chromosome walking. Genomics 25: 674–681. Kahmann R, Basse C. 1999. REMI (Restriction Enzyme Mediated Marmeisse R, Gay G, Debaud J-C, Casselton LA. 1992. Genetic Integration) and its impact on the isolation of pathogenicity genes in fungi transformation of the ectomycorrhizal fungus Hebeloma cylindrosporum. attacking plants. European Journal of Plant Pathology 105: 221–229. Current Genetics 22: 41–45. Kim SJ, Bernreuther D, Thumm M, Podila GK. 1999. LB-AUT7, a novel Marmeisse R, Jargeat P, Wagner F, Gay G, Debaud J-C. 1998. Isolation and symbiosis-regulated gene from an ectomycorrhizal fungus, Laccaria characterization of nitrate reductase deficient mutants of the

New Phytologist (2004) 163: 481–498 www.newphytologist.org © New Phytologist (2004) 42 Tansley review Review 497

ectomycorrhizal fungus Hebeloma cylindrosporum. New Phytologist 140: Plomion C, Durel C-E, O’Malley DM. 1996. Genetic dissection of height 311–318. in maritime pine seedlings raised under accelerated growth conditions. Martin F, Tuskan GA, DiFazio SP, Lammers P, Newcombe G, Podila GK. Theoretical and Applied Genetics 93: 849–858. 2004. Symbiotic sequencing of the Populus mesocosm. New Phytologist Rangel-Castro JI, Danell E, Taylor AFS. 2002. Use of different nitrogen 161: 330–335. sources by the edible mushroom Cantharellus cibarius. Mycorrhiza 12: Marzluf GA. 1997. Genetic regulation of nitrogen metabolism in the fungi. 131–137. Microbiology Molecular Biology Review 61: 17–32. Rausch C, Daram P, Brunner S, Jansa J, Laloi M, Leggewie G, Amrhein N, Melville LH, Massicotte HB, Peterson RL. 1987. Ontogeny of early stages Bucher M. 2001. A phosphate transporter expressed in arbuscule- of ectomycorrhizae synthesized between Dryas integrifolia and Hebeloma containing cells in potato. Nature. 414: 462–466. cylindrosporum. Botanical Gazette 148: 322–341. Read DJ, Perez-Moreno J. 2003. Mycorrhizas and nutrient cycling in Molina R, Massicotte H, Trappe JM. 1992. Specificity phenomena in ecosystems – a journey towards relevance ? New Phytologist 157: 475–495. mycorrhizal symbioses: community-ecological consequences and practical Reddy SM, Pandey AK, Melayah D, Marmeisse R, Gay G. 2003. The auxin implications. In. Allen, MF, ed. Mycorrhizal functioning. London, UK: responsive gene–C61 is up-regulated in Pinus pinaster roots following Chapman & Hall, 357–423. inoculation with ectomycorrhizal fungi. Plant, Cell & Environment 26: Moncalvo JM, Lutzoni FM, Rehner SA, Johnson J, Vilgalys R. 2000. 681–691. Phylogenetic relationships of Agaric fungi based on nuclear large subunit Redecker D, Szaro TM, Bowman RJ, Bruns TD. 2001. Small genets of ribosomal DNA sequences. Systematic Biology. 49: 278–305. Lactarius xanthogalactus, Russula cremoricolor and Amanita francheti in late- Moncalvo JM, Vilgalys R, Redhead SA, Johnson JE, James TY, stage ectomycorrhizal successions. Molecular Ecology 10: 1025–1034. Aime MC, Hofstetter V, Verduin SJW, Larsson E, Baroni TJ, Thorn RG, Rios G, Lossow A, Hertel B, Breuer F, Schaefer S, Broich M, Kleinow T, Jacobsson S, Clemencon H, Miller OK Jr. 2002. One hundred and Jásik J, Winter J, Ferrando A, Farrás R, Panicot M, Henriques R, seventeen clades of euagarics. Molecular Phylogenetics and Evolution. 23: Mariaux J-B, Oberschall A, Molnár G, Berendzen K, Shukla V, Lafos M, 357–400. Koncz Z, Rédei GP, Schell J, Koncz C. 2002. Rapid identification of Montanini B, Betti M, Marquez AJ, Balestrini R, Bonfante P, Ottonello S. Arabidopsis insertion mutants by non-radioactive detection of T-DNA 2003. Distinctive properties and expression profiles of glutamine tagged genes. Plant Journal. 32: 243–253. synthetase from a plant symbiotic fungus. Biochemical Journal. 373: Romagnesi H. 1965. Etudes sur le genre Hebeloma. Bulletin de la Société 357–368. Mycologique de France 81: 321–344. Montanini B, Moretto N, Soragni E, Percudani R, Ottonello S. 2002. Salzer P, Hager A. 1991. Sucrose utilization of the ectomycorrhizal fungi A high-affinity ammonium transporter from the mycorrhizal ascomycete Amanita muscaria and Hebeloma crustuliniforme depends on cell wall- Tuber borchii. Fungal Genetics and Biology 36: 22–34. bound invertase activity of their host Picea abies. Botanica Acta 104: 439– Napier RM, Venis MA. 1995. Auxin action and auxin-binding proteins. 445. New Phytologist 129: 167–201. Sawyer NA, Chambers SM, Cairney JWG. 1999. Molecular investigation of Nehls U, Béguiristain T, Ditengou F, Lapeyrie F, Martin F. 1998. The genet distribution and genetic variation of Cortinarius rotundisporus in expression of a symbiosis-regulated gene in eucalyptus roots is regulated by eastern Australian sclerophyll forests. New Phytologist 142: 561–568. auxin and hypaphorine, the tryptophan betain of the ectomycorrhizal Sawyer NA, Chambers SM, Cairney JWG. 2003. Utilisation of inorganic basidiomycete Pisolithus tinctorius. Planta 207: 296–302. and organic nitrogen sources by Amanita species native to temperate Nehls U, Bock A, Ecke M, Hampp R. 2001. Differential expression of the eastern Australia. Mycological Research 107: 413–420. hexose-regulated fungal genes AmPAL and AmMst1 within Amanita/ Scheromm P, Plassard C, Salsac L. 1990. Nitrate nutrition of maritime pine Populus ectomycorrhizas. New Phytologist 150: 583–589. (Pinus pinaster Soland in Ait.) ectomycorrhizal basidiomycete, Hebeloma Norkrans B. 1950. Studies in growth and cellulolytic enzymes on cylindrosporum Romagn. New Phytologist 114: 93–98. Trichoderma. Botanicae Upsalienses 11: 1–126. Schuren FHJ. 1992. Regulation of gene expression during fruit-body Oh KI, Melville LH, Peterson RL. 1995. Comparative structural study of development in Schizophyllum commune. PhD Thesis, University of Quercus serrata and Q. acutissima formed by Pisolithus tinctorius and Groningen, The Netherlands. Hebeloma cylindrosporum. Trees 3: 171–179. Seitz LC, Tang K, Cummings WJ, Zolan ME. 1996. The rad9 gene of Peter M, Ayer E, Egli S. 2001. Nitrogen addition in a Norway spruce stand Coprinus cinereus encodes a proline-rich protein required for meiotic altered macromycete sporocarp production and below-ground chromosome condensation and synapsis. Genetics 142: 1105–1117. ectomycorrhizal species composition. New Phytologist 149: 311–325. Sitbon F, Perrot-Rechenmann C. 1997. Expression of auxin-regulated Peter M, Courty P-E, Kohler A, Delaruelle C, Martin D, Tagu D, genes. Physiologia Plantarum 100: 443–445. Frey-Klett P, Duplessis S, Chalot M, Podila G, Martin F. 2003. Slankis V. 1973. Hormonal relationship in mycorrhizal development. Analysis of expressed sequence tags from the ectomycorrhizal In. Marks, GC, Kozlowski, TT, eds. Ectomycorrhizae. their ecology and basidiomycetes Laccaria bicolor and Pisolithus microcarpus. New Phytologist physiology. New York, NY, USA: Academic Press, 232–298. 159: 117–129. Smith SE, Read DJ. 1997. Mycorrhizal symbiosis. New York, NY, USA: Piché Y, Fortin JA. 1982. Development of mycorrhizae, extramatrical Academic Press. mycelium and sclerotia on Pinus strobus seedlings. New Phytologist 91: Smith JE, Molina R, Huso MMP, Luoma DL, McKay D, Castellano MA, 211–220. Lebel T, Valachovic Y. 2002. Species richness, abundance, and Plassard C, Bonafos B, Touraine B. 2000. Differential effects of mineral and composition of hypogeous and epigeous ectomycorrhizal fungal organic N sources, and of ectomycorrhizal infection by Hebeloma sporocarps in young, rotation-age, and old-growth stands of Douglas-fir cylindrosporum, on growth and N utilization in Pinus pinaster. Plant, Cell (Pseudotsuga menziesii ) in the Cascade Range of Oregon, USA. Canadian & Environment 23: 1195–1205. Journal of Botany. 80: 186–204. Plassard C, Guérin-Laguette A, Véry A-A, Casarin V, Thibaud J-B. 2002. Sundaram S, Kim SJ, Suzuki H, McQuattie CJ, Hiremath ST, Podila GK. Local measurements of nitrate and potassium fluxes along roots of 2001. Isolation and characterization of a symbiosis-regulated ras from the maritime pine. Effects of ectomycorrhizal symbiosis. Plant, Cell & ectomycorrhizal fungus Laccaria bicolor. Molecular. Plant–Microbe Environment 25: 75–84. Interactions 14: 618–628. Plomion C, Bahrman N, Durel C-E, O’Malley DM. 1995. Genomic Tagu D, Marmeisse R, Baillet Y, Riviere S, Palin B, Bernardini F, Mereau A, mapping in Pinus pinaster (maritime pine) using RAPD and protein Gay G, Balestrini R, Bonfante P, Martin F. 2002. Hydrophobins in markers. Heredity 74: 661–668. ectomycorrhizas: heterologous transcription of the Pisolithus HydPt.1 gene

in yeast and Hebeloma cylindrosporum. European Journal of Histochemistry van Wetter MA, Wösten HA, Sietsma JH, Wessels JG. 2000. Hydrophobin 46: 23–29. gene expression affects hyphal wall composition in Schizophyllum Tranvan H, Habricot Y, Jeannette E, Gay G, Sotta B. 2000. Dynamics of commune. Fungal Genetics and Biology 31: 99–104. symbiosis establishment between an IAA-overproducing mutant of the Wipf D, Benjdia M, Rikirsch E, Zimmermann S, Tegeder M, ectomycorrhizal fungus Hebeloma cylindrosporum and Pinus pinaster. Tree Frommer WB. 2003. An expression cDNA library for suppression cloning Physiology 20: 123–129. in yeast mutants, complementation of a yeast his4 mutant, and EST Vallorani L, Polidori E, Sacconi C, Agostini D, Pierleoni R, Piccoli G, analysis from the symbiotic basidiomycete Hebeloma cylindrosporum. Zeppa S, Stocchi V. 2002. Biochemical and molecular characterization of Genome 46: 177–181. NADP glutamate dehydrogenase from the ectomycorrhizal fungus Tuber Wipf D, Benjdia M, Tegeder M, Frommer WB. 2002. Characterization of borchii. New Phytologist 154: 779–790. a general amino acid permease from Hebeloma cylindrosporum. FEBS Voegele RT, Struck C, Hahn M, Mendgen K. 2001. The role of haustoria Letters 528: 119–124. in sugar supply during infection of broad bean by the rust fungus Uromyces Wong KKY, Fortin JA. 1989. A Petri dish technique for the aseptic synthesis fabae. Proceedings of the National Academy of Sciences, USA. 98: 8133–8138. of ectomycorrhizae. Canadian Journal of Botany 67: 1713–1716. Voiblet C, Duplessis S, Encelot N, Martin F. 2001. Identiﬁcation of symbiosis- Zhou Z, Miwa M, Hogetsu T. 1999. Analysis of genetic structure of a Suillus regulated genes in Eucalyptus globulus-Pisolithus tinctorius ectomycorrhiza grevillei population in a Larix kaempferi stand by polymorphism of inter- by differential hybridization of arrayed cDNAs. Plant Journal 25: 181–191. simple sequence repeat (ISSR). New Phytologist 144: 55–63. Wellington EM, Berry A, Krsek M. 2003. Resolving functional diversity in Zhou Z, Miwa M, Matsuda Y, Hogetsu T. 2001. Spatial distribution of the relation to microbial community structure in soil: exploiting genomics and subterranean mycelia and ectomycorrhizae of Suillus grevillei genets. stable isotope probing. Current Opinion in Microbiology 6: 295–301. Journal of Plant Research 114: 179–185.

About New Phytologist

• New Phytologist is owned by a non-proﬁt-making charitable trust dedicated to the promotion of plant science, facilitating projects from symposia to open access for our Tansley reviews. Complete information is available at www.newphytologist.org

• Regular papers, Letters, Research reviews, Rapid reports and Methods papers are encouraged. We are committed to rapid processing, from online submission through to publication ‘as-ready’ via OnlineEarly – the 2003 average submission to decision time was just 35 days. Online-only colour is free, and essential print colour costs will be met if necessary. We also provide 25 offprints as well as a PDF for each article.

• For online summaries and ToC alerts, go to the website and click on ‘Journal online’. You can take out a personal subscription to the journal for a fraction of the institutional price. Rates start at £108 in Europe/$193 in the USA & Canada for the online edition (click on ‘Subscribe’ at the website)

• If you have any questions, do get in touch with Central Ofﬁce ([email protected]; tel +44 1524 592918) or, for a local contact in North America, the USA Ofﬁce ([email protected]; tel 865 576 5261)

New Phytologist (2004) 163: 481–498 www.newphytologist.org © New Phytologist (2004) 44 2. Chapitre 2

Matériel et Méthodes

2.1. Matériel fongique et conditions de culture

2.1.1. Souches utilisées L’espèce fongique étudiée est le champignon basidiomycète supérieur Hebeloma cylindrosporum Romagnesi. L’essentiel du travail de thèse est réalisé sur trois souches différentes: une souche dicaryotique appelée D2, et deux souches homocaryotiques sauvages h1 et h7. Ces souches nous ont été fournies par l’équipe Symbiose Mycorhizienne (UMR CNRS 5557 d’Ecologie Microbienne, Université Claude Bernard Lyon I). Les souches haploïdes h1 et h7 ont été obtenues après germination de basidiospores du dicaryon sauvage HC1 récolté dans la nature en 1970 (Debaud & Gay, 1987). La souche diploïde (n + n) D2 est un dicaryon reconstitué à partir de h1 et h7. Cette équipe nous a également fourni de nombreuses autres souches dont: (i) deux souches du même genre mais d’autres espèces, Hebeloma edurum sinuosum et Hebeloma radicosum; (ii) dix-sept souches provenant de la collection des vingt descendants de HC1 (h1 à h20); (iii) quinze souches homocaryotiques isolées sur différents sites côtiers de l'Europe de l'ouest. Les noms donnés à ces souches intègrent une abréviation identifiant le site de prélèvement: LP, Min, Car et Lac pour les souches isolées dans les Landes sur les sites de Le Porge, Mimizan, Carcan Plage et Lacanau; Tur et TSM pour les souches isolées en Bretagne sur les sites de la Turballe et de La Trinité Sur Mer; NL pour les souches isolées en Hollande.

2.1.2. Milieux de culture

Les différentes souches d’Hebeloma cylindrosporum sont entretenues par repiquage tous les deux mois sur un milieu Pachlewski-Oddoux (Rapior et al., 1987) modifié (milieu P.O.M.). Elles sont cultivées à 23 °C, à l’obscurité. Des morceaux d'agarose de ces cultures peuvent être stockés à 4 °C dans des tubes Eppendorf avec un peu d'eau stérile. De cette façon il est possible de conserver au réfrigérateur des souches viables d'hébélome 1 à 2 ans.

45 Le milieu P.O.M. contient 15 g.L-1 de glucose, 0,74 g.L-1 d’acide glutamique, 0,5 g.L-1 -1 d’asparagine, 5 mg.L de citrate ferrique et KCl 3 mM, KH2PO4 1 mM, MgSO4 2 mM, -1 CaCl2 1 mM, thiamine-HCl 0,3 µM, additionné de 0,2 mL.L d’une solution de microéléments (MnSO4 18,2 mM, ZnSO4 15,3 mM, H3BO3 45,6 mM, CuSO4 3,95 mM,

Na2MoO4 1,2 mM; Morizet & Mingeau, 1976). Le pH est ajusté à 6 avec KOH. Dans le cas du milieu gélosé, 15 g.L-1 d’agar sont ajoutés au milieu liquide.

Le milieu P0 est obtenu de la même façon que le milieu P.O.M. mais il ne contient pas de KH2PO4.

Le milieu K0 est un milieu P.O.M. ne contenant ni KCl ni KH2PO4, de façon à éliminer + -1 K . Le phosphate est apporté sous forme de (NH4)2HPO4 à la concentration de 1 mmol.L . Le pH est ajusté à 6 avec NaOH. Un chélateur de K+, le tetraphénylborate, a été ajouté à une concentration finale de 100 ou 500 µM à certaines cultures afin de s'affranchir totalement du K+ résiduel. Toutes les manipulations se font en condition stérile. Pour cela l'ensemble des milieux et supports de culture sont autoclavés 20 min à 120 °C.

2.1.3. Conditions de culture Trois méthodes de culture en milieux liquide ont été utilisées. 1) Les thalles sont cultivés en flacon de verre de 250 mL contenant 100 mL de milieu. L'implant mycélien d'une culture solide (diamètre 8 mm) est fixé à l’extrémité recourbée d’un fil de nichrome de façon à ce qu'il affleure le milieu de culture. 2) Un implant mycélien est placé dans une boite de Petri contenant 25 mL de milieu. Les thalles se développent ensuite pendant 14 jours, à l’obscurité, sans agitation, à 26 °C. Après cette période de culture, le matériel fongique peut être récolté directement ou transféré dans d’autres milieux (e.g. milieu P0 ou K0). Dans ce cas, chaque thalle subit trois rinçages dans de l’eau déminéralisée stérile. Les thalles sont ensuite transférés dans un nouveau récipient contenant un milieu neuf. 3) Dans le but d'obtenir de grandes quantités de matériel, des cultures liquides sous agitation ont été réalisées. Pour cela, un erlenmeyer de 2 L contenant 500 mL de milieu P.O.M. est ensemencé avec 5 à 10 implants mycéliens puis placé sur un agitateur rotatif à 26 °C pendant 2 semaines. Les thalles utilisés comme matériel de départ pour la fabrication de la banque d’ADNc appartiennent aux souches h1, h7 et D2. Ils ont été cultivés 14 jours dans un milieu P.O.M. liquide. Des thalles ont été récoltés directement après ces 14 jours de culture alors que d’autres ont été transférés sur un milieu P0 ou K0 pendant 48 heures avant d’être récoltés.

46 2.2. Méthodes de biologie moléculaire

2.2.1. Les banques utilisées

2.2.1.1. La banque d’ADNc La banque d’ADNc utilisée a été construite au laboratoire par Frédéric Gaymard à partir d’ARN extraits de thalles cultivés dans les conditions décrites précédemment (Cf. paragraphe 2.I.3.). Les ADNc ont été clonés dans le vecteur pFL61 (Minet et al., 1992). Ce vecteur est un plasmide d’expression navette E. coli/S. cerevisiae. Il contient une origine de réplication dans E. coli (colE1), l’origine de réplication du plasmide 2µ de S. cerevisiae (plasmide multicopies), le gène de résistance à l’ampicilline (AMP1) et le gène URA3 permettant la sélection des levures transformées. Les ADNc sont ligués à un adaptateur de 14 pb avec un CACA sortant en 3' (5'-CTAAATTACTCACA-3'). Ils sont ensuite clonés au niveau des sites cohésifs GTGT libérés par une digestion du vecteur par l'enzyme BstXI (Minet et al., 1992). Les ADNc sont encadrés par 2 sites NotI entre le promoteur et le terminateur de la phosphoglycérate kinase (PGK) de la levure. Cette construction permet de rendre non cohésifs les ADNc entre eux, ainsi que le vecteur. Cela permet d'éviter d'avoir des chimères et de limiter le nombre de plasmides vides. 2.2.1.2. La banque génomique La banque génomique utilisée nous a été fournie par l’équipe Symbiose Mycorhizienne de l'UMR 5557 de Lyon. Elle a été construite à partir du génome de la souche homocaryotique h1 dans le vecteur LambdaGEM®-12 (Promega).

2.2.2. Criblage de la banque d'ADN génomique Les bactéries utilisées (KW251) sont maintenues sur un milieu LB gélosé contenant de la tetracycline (bactopeptone 10 g.L-1, NaCl 5 g.L-1, extrait de levure 5 g.L-1, agar 15 g.L-1, tetracycline 12,5 µg.mL-1). Les bactéries sont cultivées une nuit à 37 °C dans un milieu LBM composé de LB -1 additionné de 0,2% de maltose et 10 mmol.L de MgSO4. La culture est centrifugée à 4 °C pendant 15 min à 2500 g. Après centrifugation, les bactéries sont reprises dans

0,5 volume d’une solution de MgSO4 10 mM et mises en contact avec les phages pendant 15 min à 37 °C sans agitation. La suspension phages-bactéries est mélangée à du top agarose (LB, agarose 0,7%) en surfusion et coulée en surcouche sur des boîtes LB agar préchauffées à 37 °C. Les boîtes sont ensuite placées à 37 °C pendant environ 16 heures puis transférées à 4 °C. Les membranes de nylon (Biotrans, ICN) sont déposées sur les boîtes portant les plages de lyse (1 min pour la première membrane et 4 min pour la deuxième membrane). Après séchage, les membranes sont traitées pendant 7 min par une solution de

47 dénaturation (NaCl 1,5 M, NaOH 0,5 M) puis, pendant 6 min, par une solution de neutralisation (NaCl 1,5 M, EDTA 1 mM, Tris-HCl 0,5 M pH 7,2). Les membranes sont ensuite lavées dans du tampon SSC 2x avant d’être placées dans un four à 80 °C durant 2 heures. Elles sont ensuite stockées à 4 °C dans du papier d’aluminium avant l’hybridation. Les plages donnant un signal positif après hybridation avec la sonde sont prélevées par carottage du milieu gélosé, transférées dans 1 mL de milieu SM (MgSO4 100 mM, gélatine 0,01%, NaCl 100 mM, Tris_HCl 50 mM, pH 7,5) additionné d’une goutte de chloroforme, et conservées à 4 °C.

2.2.3. Extraction d’ADN de phages Afin d'obtenir de plus grande quantité d'ADN nous avons utilisé un protocole dans lequel l'infection et la production des bactériophages se fait en culture liquide. Des bactéries de souches KW251 sont cultivées pendant une nuit dans un milieu LBM (bactopeptone 10 g.L-1, NaCl 5 g.L-1, extrait de levure 5 g.L-1) contenant 0,2% de maltose et 10 mmol.L-1 de MgSO4. Deux mL de cette culture sont additionnés de 6 mL de tampon SM et de 250 µL de solution de phages de façon à obtenir une culture bactérienne infectée. La solution de phages utilisée pour cela est obtenue à partir d'une culture confluente de phages sur boite de Petri. Pour cela 200 µL de préparation de bactéries compétentes sont mélangés à une aliquote (50 à 200 µL) de la suspension de phages issue du carottage. Le mélange phages-bactéries est placé pendant 30 min à 37 °C sans agitation. Il est ensuite mélangé à 3 mL de top agarose en surfusion et coulé en surcouche sur des boîtes LB agar. Ces boîtes sont placées à 37 °C jusqu'à confluence des plages de lyse (environ 16 heures). Le lysat obtenu est récupéré en ajoutant 3 mL de milieu SM sur les boîtes et en plaçant les boîtes sur un agitateur orbital (300 rpm) pendant 2 heures à 20 °C. A l'issue de cette période, le milieu liquide au dessus du milieu gélosé est prélevé et constitue la solution de phage. La culture bactérienne infectée est placée 20 min dans une enceinte à 37 °C avec agitation faible (80 rpm) avant d'être mise dans un erlenmeyer contenant 100 mL de milieu

LB additionnés de Tris-HCl 5 mM (pH 7,5) et de MgSO4 10 mM. Les bactéries sont cultivées à 37 °C avec agitation (190 rpm) jusqu'à l'apparition d'agrégats d'aspect cotonneux (12 à 24 heures). Le lendemain, 1 mL de chloroforme est ajouté à la culture; celle-ci est ensuite incubée 15 min à 37 °C avec agitation. Le mélange est centrifugé à 4 °C pendant 5 min à 22100 g. Le surnageant est prélevé et incubé pendant 30 min à 37 °C en présence de 20 µL de RNase A à 10 µg.µL-1 et de 20 U de DNase I. Après ajout de 100 mL de tampon de précipitation (NaCl 2,5 M, PEG 6000 20%, MgSO4 10 mM), le mélange est incubé dans de la glace pendant 1 heure. Les phages sont récupérés par centrifugation à 4 °C pendant

48 5 min à 22100 g et repris dans 5 mL de milieu SM. La solution contenant les phages est centrifugée à 4 °C pendant 5 min à 10900 g. Le surnageant est récupéré, mélangé à 50 µL d’une solution de SDS 10% et 50 µL d’EDTA 0,5 M, et incubé à 65 °C pendant 15 min. Un volume de la phase inférieure d’un mélange PCI (mélange phénol équilibré à pH 8/chloroforme/alcool isoamylique, 25/24/1, v/v/v) est ajouté au mélange. Après homogénéisation, le mélange est centrifugé à 4 °C pendant 3 min à 10900 g. Un volume de CI est ajouté à la phase supérieure. Après homogénéisation, le mélange est centrifugé à 4 °C pendant 3 min à 10900 g. La phase supérieure est mélangée à 0,7 volume d’isopropanol et le mélange est incubé une nuit à 4 °C. L’ADN est précipité par centrifugation à 4 °C pendant 20 min à 6800 g. Le culot est rincé avec 2 mL d’éthanol à 70%. Après centrifugation à 4 °C pendant 5 min à 6800 g, le culot est séché et repris dans 300 à 500 µL de TE (Tris-HCl 10 mM, EDTA 1 mM).

2.2.4. Complémentation fonctionnelle de mutants de levure par la banque d'ADNc

Les gènes homologues chez Hebeloma des gènes ADE2 (Stotz & Linder, 1990) et TRP1 (Tschumper & Carbon, 1980) de S. cerevisiae ont été clonés par complémentation fonctionnelle de levures mutantes. La souche de levure utilisée est W303-1B (mat a, ura3-1, leu2-3, his 3-11, 15, trp1-1, ade2-1, Canr) (Thomas & Rothstein, 1989), auxotrophe pour l'adenine et le tryptophane du fait de l'inactivation des gènes ADE2 et TRP1. Les cellules ont été transformées par la banque d'ADNc d'Hebeloma (15 µg de plasmide correspondant au pool d'ADNc de taille comprise entre 1 et 2.5 kb) selon le protocole décrit par Schiestl & Gietz (1989). Environ 2x105 transformants ont été criblés sur milieu sélectif YNB solide (Sigma) additionné d'histidine 130 µM, de leucine 230 µM, et soit de tryptophane 200 µM soit d'adenine 150 µM, afin d'identifier respectivement des clones complémentant les mutations ade2 et trp1. Les plasmides transformants ont été isolés des clones positifs et ré-introduits dans la levure mutante W303 afin de confirmer leur aptitude à complémenter les cellules. Ces expériences de confirmation ont été réalisées selon la méthode des "tests en goutte", en déposant sur le milieu de sélection des aliquotes de 10 µL d'une pré-culture de levures transformées, diluée de façon à présenter une absorbance de 0,3 à 600 nm. Les plasmides des clones positifs sélectionnés à l'issue de cette étape ont été amplifiés et les inserts séquencés.

2.2.5. Purification de l'ADN génomique d'Hebeloma

Le protocole utilisé est celui décrit par van Kan (1991). Après quinze jours de culture en milieu liquide P.O.M., les thalles sont récoltés dans des tubes Eppendorf et congelés dans de l’azote liquide. Le matériel peut être conservé à -80 °C, utilisé directement ou lyophilisé (Benchtop 4.5, Virtis). Le matériel est broyé en présence d’azote liquide. L’extraction d’ADN génomique est réalisée dans un tampon d’extraction contenant NaCl 0,5 M,

49 SDS 1%, Na2EDTA 10 mM et Tris-HCl 10 mM, pH 7,5. Ce tampon est préchauffé à 65 °C, à raison de 1 mL pour 0,6 à 0,8 g de matière fraîche (ou 0,2 mg de matière sèche) de matériel fongique. Le broyat est mis en suspension dans le tampon d’extraction préchauffé. Après une incubation de 10 min à température ambiante, le mélange est centrifugé 15 min à 15000 g. Un volume de phénol (équilibré à pH 8) est ajouté au mélange. Après 10 min à température ambiante, le mélange est centrifugé 15 min à 15000 g. Le surnageant est prélevé, mélangé à 1 volume de CI (chloroforme/alcool isoamylique, 24/1, v/v), incubé 10 min à température ambiante et centrifugé 15 min à 15000 g. La phase aqueuse est prélevée et mélangée à 10 µL d’une solution de RNase A à 10 mg.mL-1. Après une incubation de 15 min à 37 °C, la RNase est extraite du milieu par du CI (400 µL). Après une centrifugation de 12 min à 15000 g, le surnageant est prélevé et mélangé à 400 µL d’isopropanol. Après 15 min d'incubation à température ambiante, le mélange est centrifugé pendant 10 min à 15000 g. Le culot d’ADN est alors lavé avec de l’éthanol à 70%, séché et repris dans 20 µL d’eau ultra-pure.

2.2.6. Purification des ARN d’H. cylindrosporum Après quinze jours de culture en milieu liquide, les mycélia sont récoltés, pesés et congelés dans de l’azote liquide. Un gramme de matière fraîche congelée est broyé dans de l’azote liquide. La poudre obtenue est ajoutée à 10 mL du TRIzol® (Invitrogen). Après homogénéisation, le mélange est laissé 5 min à température ambiante. Une première centrifugation est effectuée à 12000 g pour éliminer les débris cellulaires insolubles (polysaccharides, lipides, etc). La phase liquide est alors récupérée dans un nouveau tube, mélangée à 2 mL de chloroforme et laissée quelques minutes à température ambiante. Le tube est alors centrifugé à 15000 g à 4 °C pendant 10 min. La phase aqueuse est récupérée et additionnée de 5 mL d’isopropanol, afin de précipiter les ARN. Après 10 min à température ambiante, les ARN sont culotés par une centrifugation à 15000 g pendant 15 min. Le surnageant est délicatement éliminé, puis le culot d’ARN est lavé avec de l’éthanol à 70%, séché et repris dans 50 µL d’eau traitée au DEPC (ou par un volume plus important s’il y a des difficultés à le re-suspendre). La concentration des ARN est déterminée en mesurant l'absorbance de la préparation à 260 nm, et leur intégrité est appréciée par migration sur gel en présence de BEt.

2.2.7. Hybridations moléculaires: Southern et northern blots

Les membranes sont humidifiées avec du SSC 5x. Elles sont ensuite mises en présence du tampon d'hybridation. Pour les Southern blots, l'hybridation des membranes est réalisée à 65 °C dans le tampon Church composé de SDS 7% p/v, BSA 1% p/v,

Na2HPO4 0,5 M pH 7, EDTA 1 mM. Pour les northern blots, l'hybridation des membranes ARN est réalisée à 42 °C dans le tampon composé de formamide 50%, SSC 5x, sulfate de

50 dextran 10%, N-lauryl sarcausine 1%. Les membranes sont préhybridées au moins 1 heure en présence du tampon d’hybridation aux températures adéquates. Pour les Southern blots, de l’ADN de sperme de saumon soniqué (100 µg par mL de tampon d’hybridation) préalablement dénaturé (10 min à 95 °C suivi de 5 min dans la glace) est ajouté. La sonde est synthétisée en utilisant le kit "Prime-a-gene® Labeling System" de Promega. Pour cela, la matrice (25 ng) est diluée dans 12,5 µL d’eau, dénaturée 8 min à 95 °C et placée 4 min dans la glace. Après ce traitement, la matrice dénaturée est mise en présence de tampon de marquage, de BSA (concentration finale: 400 µg.mL-1), de dGTP et de dTTP (concentration finale pour chaque nucléotide: 20 µmol.L-1), de 50 µCi d’[α-32P]dATP, de 50 µCi d’[α-32P]dCTP et de 10 U du fragment Klenow de l’ADN polymérase I (Promega). La sonde est polymérisée pendant 1 heure à température ambiante. Les molécules de sonde sont séparées des nucléotides non incorporés par filtration sur une colonne d’exclusion de Sephadex G50 (Nick Column, Amersham Pharmacia Biotech). La sonde (à raison de 106 cpm par mL de tampon d’hybridation) est prélevée, dénaturée (10 min à 95 °C puis refroidie 4 min dans la glace) et ajoutée au tampon d’hybridation. Après 16 heures à la température adéquate (65 °C ou 42 °C), la membrane est lavée dans des solutions salines comme suit: 2 lavages dans une solution contenant SSC 2x, SDS 0,1% pendant 10 min à température ambiante, 1 lavage dans une solution contenant SSC 1x, SDS 0,1% pendant 20 min à température ambiante, 1 lavage dans une solution contenant SSC 1x, SDS 0,1% pendant 20 min à la température d'hybridation, 1 lavage dans une solution contenant SSC 0,5x, SDS 0,1% pendant 20 min à la température d'hybridation. Le lavage de la membrane est contrôlé à chaque étape avec un compteur Geiger et peut être interrompu si nécessaire. Les membranes sont placées aux contact d’un écran phosphoimageur (Kodack ou Fuji) pendant une durée de quelques heures à quelques jours selon l’intensité du signal. L’écran est ensuite révélé à l’aide d’un Phosphoimageur (Storm 860, Fla 5000) et les signaux sont quantifiés à l’aide du logiciel ImageQuant (Amersham Biosciences).

2.2.8. Amplification des acides nucléiques par PCR

Les réactions de PCR sont réalisées à l'aide de la polymérase thermostable de Thermus brokianus (ExtraPol I, Eurobio). Le mélange réactionnel (50 µL) contient du tampon de réaction (fourni avec l'enzyme), MgCl2 2,5 mM, 0,2 U d'ExtraPol I, chacun des déoxynucléotides triphosphates (dNTP) 200 µM, 5 pmoles de chaque amorce nucléotidique, et de 0,1 à 50 ng de matrice. Généralement, les protocoles d'amplification

51 comportent un traitement de 3 min à 95 °C, suivi de 10 cycles dénaturation/hybridation/élongation: 45 s à 95 °C/45 s à une température de départ de 65 °C et diminuée de 1 °C par cycle/1 min par kb à 72 °C, puis de 30 à 35 cycles avec une température d’hybridation de 55 °C. La PCR se termine par une étape à 72 °C et 20 min à 4 °C. La durée de la dernière étape à 72 °C est variable selon l’utilisation faite des produits PCR. Dans la majorité des cas elle est de 5 min. Dans certaines expériences, pour permettre l'induction de l'activité polyA terminal transférase de l'enzyme, elle est de 20 min. Cela permet des clonages rapides et efficaces en utilisant le kit TOPO TA Cloning® (Invitrogen). D’autres enzymes thermostables ont été utilisées dans certaines expériences, en particulier les enzymes correctrices d’erreur ("proofreading"), Isis DNA Polymerase™ (Qbiogen) et Pfu DNA Polymerase (Promega), afin d'obtenir des séquences ne contenant pas d'erreur. Ces enzymes ont été utilisées selon les protocoles préconisés par les fournisseurs.

2.2.9. Amplification des régions manquantes des ADNc par RACE-PCR Les expériences ont été effectuées selon un protocole classique ou selon une méthode reposant sur l'utilisation d'un kit.

2.2.9.1. RACE-PCR classique Cette technique permet d'amplifier par PCR la partie 5' inconnue d'un ADNc à partir d'une préparation d'ARNm. Pour cela, un adaptateur est ligué à l'ADN double brins obtenu à partir des ARNm. Les ARN totaux sont extraits par les méthodes décrites dans le paragraphe 2.2.6.. Les ARNm sont purifiés en utilisant le système polyAtract™ (Promega) selon les recommandations du fournisseur. La transcription inverse de 2 µg d'ARNm est réalisée en présence de 10 pmoles de l'oligonucléotide spécifique de la région 5' du gène ou de TM polyd(T)15 et de 200 U de Superscript (Gibco-BRL) selon les recommandations du fournisseur. Le deuxième brin d'ADN est synthétisé dans 100 µL d'un milieu (Tris-HCl -1 40 mM pH 7,2, KCl 90 mM, MgCl2 3 mM, DTT 3 mM, BSA 0,5 µg.mL , dNTP 0,2 mM) contenant 23 U d'ADN polymérase I d'E. coli (Promega) et 0,8 U de RNase H (Promega) à 14 °C pendant 2 heures. Une unité d'ADN polymérase du phage T4 est ajoutée au mélange. Après 10 min d'incubation à 37 °C, 10 µL d'EDTA 200 mM et 1 volume de PCI (50/48/2) sont ajoutés successivement. La phase aqueuse est traitée avec 1 volume de CI (48/2), et les acides nucléiques sont précipités par l'addition de 0,5 volume d'acétate d'ammonium 7,5 M, de 0,4 µL de glycogène 35 mg.mL-1 et de 2,5 volumes d'éthanol. Après 15 min à -20 °C, la solution est centrifugée et le culot d'ADNc est remis en suspension dans 10 µL d'eau.

52 L'adaptateur (concentration finale: 10 µM) est obtenu en hybridant 2 oligonucléotides mélangés en rapport équimolaire (ADA1: 5'-CTAATACgACTCACTATAgggCTCgAgCggCC gCCCggggAggT-3', ADA2: 5'-ACCTCCCC-3', cette seconde amorce est phosphatée en 5' et aminée en 3'). Après un traitement à 95 °C, une diminution progressive de la température jusqu'à 25 °C permet l'hybridation des deux oligonucléotides. Deux µL de la solution contenant l'adaptateur sont mélangés à 5 µL de la solution contenant l'ADNc, en présence de tampon et de 1 U de ligase (GIBCO-BRL). La réaction de ligature se déroule à 16 °C pendant une nuit. Le produit de ligature est dilué 10 fois avant les réactions de PCR. Une première réaction de PCR (30 cycles) est réalisée avec des amorces s'hybridant dans l'adaptateur d'une part et en amont de l'amorce de transcription inverse d'autre part. Une deuxième PCR (35 cycles), dite "nested", est réalisée en prenant une dilution 50x du produit de la première PCR comme matrice, et en utilisant une amorce s'hybridant dans l'adaptateur et une amorce s'hybridant dans la séquence précédemment amplifiée (en aval des amorces utilisées lors de la première PCR). Le produit de cette deuxième PCR est déposé sur gel d'agarose 2%. Les fragments peuvent ensuite être clonés et séquencés.

2.2.9.2. Utilisation du kit "FirstChoice® RLM RACE" d'Ambion L'intérêt de ce kit est de favoriser le clonage de l'extrémité 5' pleine longueur des ADNc. A la différence des autres approches de RACE-PCR, il consiste à liguer un adaptateur directement sur les ARNm, et spécifiquement sur les ARN intègres en 5'. Pour cela, la préparation d'ARN est déphosphorylée. Seuls les ARN complets coiffés par une 7-méthylguanidine (7-méthylguanidine fixée au premier nucléotide par une liaison 5'-5' triphosphate) échappent à ce traitement. L'addition d'une pyrophosphatase acide de tabac permet ensuite d'éliminer la 7-méthylguanidine des ARN intègres et de libérer une extrémité 5' phosphorylée. De ce fait, seuls les ARNm complets présentent une extrémité phosphorylée. Un adaptateur est ligué à cette extrémité grâce à la T4 RNA ligase. Après une transcription inverse, il est possible de faire une PCR avec un couple d'amorces dont l'une est spécifique du gène dont on veut obtenir l'ADNc complet et l'autre spécifique de l'adaptateur. Les expériences ont été réalisées en suivant strictement le protocole préconisé par le fournisseur du kit.

2.2.10. Production et ordonnancement d'une banque d'ADNc

Des bactéries DH5-α ou JM109 rendues compétentes sont transformées avec la banque d'ADNc liguée dans le vecteur pFL61 (Cf. paragraphe 2.2.1.1.). La solution de bactérie est placée sous agitation à 37 °C pendant 1 heure puis des parties aliquotes sont étalées sur des boites de Petri LB agar contenant de l'ampicilline. Les colonies isolées sont répiquées sur des plaques 96 puits (Greiner) dont les puits sont remplis avec 200 µL de milieu

53 sélectif solide (LB agar ampicilline). Les plaques sont placées à 37 °C. Après 16 h de culture, deux empreintes sont réalisées avec un peigne de réplication, transférant les clones sur milieu liquide (100 µL de LB ampicilline par puits). Ces plaques sont transférées à 37 °C, sur agitateur horizontal, et les bactéries se développent pendant 16 h. Quarante-trois µL de glycérol (à 50% dans de l'eau) sont additionnés et mélangés dans chaque puits. Un lot de plaques (une des deux "empreintes") est congelé à -80 °C, pour constituer le "stock glycérol de référence". Le second lot est conservé à -50 °C et constitue une réserve utilisée pour prélever les clones d'intérêts. Chaque clone est identifié par un nom composé d'un nombre à 3 chiffres indiquant le numéro de la plaque, suivi d'un binôme lettre/nombre identifiant le puits sur la plaque. Pour le séquençage des clones et la production d'étiquettes, les clones sont dupliqués sur milieu liquide (LB ampicilline) à partir des plaques de culture initiale sur milieu gélosé. L'extraction des plasmides est faite avec le kit "Wizard® SV 96 Plasmid DNA Purification System" (Promega). Après séquençage, la nomenclature des étiquettes produites est la suivante: chaque séquence est désignée par le nom du clone correspondant suivi de la lettre A ou R selon la nature de l'amorce (pour la bordure gauche amorce pFLA, 5'-CTCTTTTTTACAgATCATCAAgg-3', et pour la bordure droite amorce pFLR, 5'-CTATTATTTTAgCgTAAAggATgg-3').

2.3. Analyses bioinformatiques

2.3.1. Matériel et logiciels La bioanalyse est effectuée principalement à l'aide d'un PC sur lequel est installé le système d'exploitation Linux (distribution RedHat 7.2; http://www.redhat.fr/), ainsi que plusieurs suites logicielles d'analyse de séquences. Parmi ces suites, celle d'EMBOSS (European Molecular Biology Open Software Suite; http://www.hgmp.mrc.ac.uk/Software/ EMBOSS/) contient plus de 150 programmes d'analyse de séquences, celle de Blast (Basic Local Alignment Search Tool; http://www.ncbi.nih.gov/BLAST/; Altschul et al., 1990; Altschul et al., 1997) permet de faire des recherches de similitudes entre séquences et celle de Phylip (PHYLogeny Inference Package de J. Felsenstein; http://evolution.genetics.washington.edu/phylip.html) contient 34 programmes de phylogénie. Les autres suites ou logiciels utilisés de façon importante sont Phred (http://www.phrap.org; Ewing et al., 1998), Cross_match (masquage des zones de séquences correspondant à du contaminant; http://www.phrap.org) et Clustalw (alignement multiple; Thompson et al., 1994). Le fait de travailler sous Linux permet d'automatiser une grande partie des analyses. Un exemple de tâche automatisée est présenté sur la Figure 2.1.

54 2.3.2. Traitement des séquences et analyse de la ressource d'étiquettes Le séquençage des étiquettes est effectué dans le Laboratoire Génome et Développement des Plantes (UMR 5096) de Perpignan, à l'aide de séquenceurs Perkin Elmer ABI 377 et ABI 3100. L'analyse globale de la ressource d'étiquettes complétée par les transcrits disponibles dans les banques de données publiques est effectuée et analysée en collaboration avec la plate-forme Génoplante-Info à Evry (UR Génomique Info, INRA/Infobiogen). Cette équipe a développé un pipeline d'analyse permettant le traitement des données produites par des projets de séquençage d'étiquettes, ainsi qu'une base de données permettant leur stockage et consultation. Nous avons utilisé la structure mise en place. Le site de présentation de la banque d'étiquettes est hébergé à Génoplante-Info (http://urgi.infobiogen.fr/projects/INRA_Hcy1/). En résumé, les séquences des étiquettes sont extraites des chromatogrammes ("base calling") et débarrassées des régions de mauvaise qualité à l'aide du logiciel Phred en affectant au paramètre seuil de qualité la valeur de 20 (Ewing et al., 1998). Elles sont ensuite nettoyées des séquences correspondant au vecteur ou à des adaptateurs à l'aide du logiciel Cross_match. Les queues polyA potentielles sont raccourcies à une longueur de 10 nt de façon à éviter les appariements artefactuels dans les alignements lors de la réalisation de l'assemblage ("clustering") des séquences. Les séquences d'H. cylindrosporum obtenues au cours de ce projet ainsi que 12 séquences d'ARMm déjà disponibles dans la banque EMBL et 548 étiquettes disponibles dans dbEST (en décembre 2003) sont rassemblées ("poolées") et ré- analysées pour être débarrassées des séquences contaminantes (à l'aide de Cross_match, configuré avec les paramètres suivants: -minmatch 100, -minscore 150, excepté pour les ARN ribosomiques: -minmatch 100 -minscore 100, et les vecteurs -minmatch 12 -minscore 20). Les contaminations observées à ce stade correspondent à de l'ADN en provenance de la levure (1 séquence) ou d'ARN ribosomiques de plante (4 séquences). Aucune contamination par de l'ADN d'E. coli n'est détectée. Une dernière étape avant le traitement de l'assemblage consiste à "masquer" les régions présentant des homologies résiduelles détectées par Cross_match avec des séquences déposées dans la banque de vecteur Univec (http://www.ncbi.nlm.nih.gov/ VecScreen/UniVec.html), ainsi que les séquences répétées détectées par RepeatMasker (Smit, AFA & Green; http://ftp.genome.washington.edu/RM/RepeatMasker.html). Les séquences ne présentant pas de "fragment de séquence" non masqué d'une longueur au moins égale à 60 nucléotides sont éliminées pour l'assemblage. L'assemblage est effectué avec LASSAP (http://www.gene-it.com; Glémet & Codani, 1997) avec la configuration de paramètres "longueur minimale: 60 nt", et "minimum d'identité: 90%".

¥ ¥

>>>¥>>>>¥>>>¥> >¥>¥> >¥>¥> >¥>¥> >¥>¥> >

¥¥ ¥¥ ¥ ! ! "!

#¥ #¥ ¥ #¥#¥ #¥#

>>>¥>>>>¥>>>¥> >¥>¥> >¥>¥> >¥>¥> >¥>¥> >

! ! !$ !¥! !

#¥ # # # # ¥#¥ #¥ # # # # ¥#¥

!!! ¥ ! ! !¥! ¥ !

¡ -¥¨¥¨632£0 ¤$ © ¥¡ ¦¥

## ¥####¥# # # ¥# ¥#¥ # #¥# ¥#¥# #¥#¥# ¥# # ¥# ¥#¥ #

! !¥! ! !¥! ! ! !¥! ! !¥! !

# #¥ #¥#¥# #¥# # # #¥ #¥#¥# #¥# #

!!!$ ! !¥! !$ !

# ### # #¥ # # # #¥# # # #¥ # #

! ! ¥?! ¥"!$¥ ! ! ! ¥"! ¥"!$¥ !

## # ¥ ¥# # #¥ #¥# # ¥ ¥# # #¥

!!! ! ! ! ! !$ !¥! ! ! ! ! ! !$

% &'¥( '( & (21 1 '¥(

¦)¤¥¦* ¥¦,+-)¥)¦ £. / 0 £ -¡ 34£0 £¥¨0 £ 74£¥¨ £¥8¥¦* ¥¦¥¨,9£¡ 0 / ¦¥¨4¤§-¡ ¡ ¦¥¨$9-) £)0: ¢¡ £¥¤§¦¥¨

(2; (

¦¤0 ¦ ¡

¤@-)¤¥£0 )£0 / -)2 ¥¦

( &¥'(

0 - 0 ¦¥¨A. ¦¨¨ ¦¥)¤¥¦¥¨

OP¢QRS T

F"C¥UDVE

>¥> >¥>¥> >¥>¥> >¥>¥> >¥>>>¥>>>¥>>>>¥> >>

QZZQR¢[\

D¢VEYX

#¥ # # # # ¥ # # #

¥ !¥!¥! ¥ !

Z [QAacbR

]¥^ ^F_`^

#¥# #¥#¥# ¥# # ¥# ¥# #

! !¥! ! !!!!¥! !§

C CC$e

# #¥ ¥# #¥# #¥# # # ##

! ¥ ¥ ?! !

SmnZ QZ m`R¥nZQ bp#

_ ^

fg"h ¢¥ E"h f h ij¥¥E¢V C@2hlk k go X g Gq¥qrVD

# # # # # # #

! !$ ! !!! !

#RSm¢Zn n P[sbQn¢tnRu b`[wv R bQ ntn RFu b[

^ ^ ^

o o¥o C qx¥D ¥`e

# ¥ ¥# # #¥

! ! ! !§ =CCC

Qb Z T

j f k ¥r

J . £¥¨0 K

$B D

> >¥>¥> >¥>¥> >¥>¥> >¥>>>¥>>>¥>>>>¥> >>

y n¥R QzT Z`[ \{ m`Q ZYT Q

o V?CD g EV i| o xD

¤§-)0 ¡ ¦ML?N

>¥> >¥>¥> >¥>¥> >¥>¥> >¥>>>¥>>>¥>>>>¥> >>

W W W

Qb Z Z Q[T \¥{n[ Z vQ[T \ { m [T \

}~ ^

g g DV ¥ r¥E g g ¢¥ V

# # #¥# ###¥## #

>¥>

!¥! !¥!$ !¥! ?! ! !

R u`QzT

#¥# #¥ #¥ #

! ¥ ! !!!!

#¥ # # # # # # ¥# #

! ! ! ! ! ! !

¥§¥@¥@$¥§@$FF @F$$ F¥$F¥ F@ § ¥¥@¥<¡F@¢¥¥£

#¥ # ¥# #

! ! ! ?! ¥"!!

$¥¥¤@¥¤¥@¤¦ §¤¥¤¨¨¤F¤§¤¥©ª@¤Fw«¬¤¡¥¤¥¤@¥¤

¥# ¥## ¥ # #

! ¥"! ¥! ! !

F®F¯°¥±@¢§²$¥¥@³¥§@F¡¥§ @§$¥$¥¡F¥F@<FFF¥@¥¡´@¥¥µ

# ¥ ¥# ##

! !$ !¥! ¥ ¥ !$!

#¥ ¥# # #¥#¥#

!¥! ¥ ! !¢CCC

¥§¥¢$µ¥@FF³ ¶§z¢·¢

¤ F¥¤§³¤<¥

¥EFB ¥

F®F¯°¥±@µ²¸ ¥F@³¥z²¹·

¥ # #

>¥>¥> >¥>>>¥>>>¥>>>>¥> >>

! G

>¥> >¥>¥> >¥>¥> >¥>¥> >¥>>>¥>>>¥>>>>¥> >>

( 1 & ( ( &¥'( & '( '( ( 1 (

ºK¥0 ¡ £/ 0 ¥I ) / ¤$ / ¦¡¡ ¨ . 0 £0¥ J . £¥¨@0 K ¥¦¥¨*¨ ¦)¤@¦¥¨4 ¥I 0 / ¦0 0 ¦¥¨¤¥-¥)0 ¡ ¦M. £,+£) ¦,)-¥) H / ¤$ ¥/ ¦¡¥3 . 0 / £¥¨@0 £4¤§-)0 ¦)£¥)0¥0 - 0 ¦¥¨

5 &¥'( & '(

¡ ¦¥ ¥-¥) ¥£¥)0 ¦,» L J¼ ½ . ¦¥¨*¨ ¦)¤§¦¥¨* ¥I 0 / ¦0 0 ¦¥¨

(

9£¥¡ ¨@¦ ¡

& ( ; (

L`-3 £/ . . ¦¿ + 0ÀH / )ÂÁ £. ¦

& ( 5

L"-¥3 £/ . . ¦ª¿ + 0ÓH / )ÕÔÖ¾

ÜÜÝ<ÞÜßÏàá âÝÌàÝ ãåäà äÑáæ¢ç¥àè

ÜÜÝ<ÞÜéÏà¥àáßÐé¥é¢ÝÎãÜ âËÜ`êFàß

¥ ËFÌ VÌr¥¥rÍr

¥ EÎÏE¥EÐVÍr

ÜÜÝ<ÞÜÝÌàè¢ÝÜÏàáäÑâã àåáæ¢çãä

¥ÑD¢Ð¢rÌVÒ¥D

5 ( ( ( 5 ( '( ( &¥'( & ( & ( & ( ( 1 ( (

£. ¤ . 9- ¡ ¤¦)0 £¥8¥¦*¦)4¾ 9- ¡¤§ £ ¦*¨¥- ¨¨ ¦)¤¥¦ N ¨ 3 ¡ ¨ . 0 £0 ¥¦,+¥. £¥¨0¨@- ¨ -¡ 34¦* ¥I )20 £+¥. ¦£

ºK¥0 ¡ £¥¤@0 ¨¦

¾?¦¥¦¥¤¦¥¦

<= Y¥Vxr`

O O y y y O y

ÃÄ FÄ $Æ?}

j j Åi ! G Å !

y y y

}§Æ Æ Æ Æ ÆÇ } Æ¥Ã

j j ! j¥i! !

Y¥Vxr`

y yÈ È y

Æ Æ¥Æ Æ }

i¥! ! i ` j

Ê". / 8)¦34¦)0

#¥ #¥# ¥# # ¥# #

! ¥ ! !¥!¥! ¥ ! !

<=EF¥V xE¥E

(

3 . 0 / 9¥. ¦

¥ ¥# ¥# # #¥# #¥ # #¥

!$ ! ! ¥ !¥!

yy # yyO O¥# y

Æ Ä

j !É§Å j i¥ G

#¥ # # # #¥ #

!¥! ! !$ ! !¥! !

yF O y ¥O

Ä`}FÄ Ã¥Æ

i ! j! É

# # # # ¥ ¥# ¥# #¥

!¥! ! ! !$ ! ! ! !¥! ! ! !

È ¥¥ y

} ] Æ¢Ç Ç

G G j ! j¥j

#¥ ¥ # # # # #

!$ !$ !¥! ¥¥ !¥! !

¢¡ £)¨§¦

ÆÇ } ] $Æ¥Ã

!j !j

# # #¥ #¥ ¥

!¥! ! ! !$"! !¥! !

<=¥$Dpr x¥V

#¥ ¥ ¥ ¥ # ¥ #

!¥! ! ! ! ! !

È È¥

Ä } } Ä¥Ä

i i iGiÅ jÅ j

#¥ #¥ ¥ ¥ #¥ #¥ #

! ! !$ ! ¥ ! !$"!

# ¥#

! !$

(

¢¡ £¥ ¤0 / -)

¨$9

¥EF¥V xE¥E

# #¥ ¥ #¥# #

! ! ! !$ !¥!$ !

# #¥ ¥# # ¥#¥ ¥# ¥#

! ¥ ¥ ! ! !¥! ! !¥!§

Z Pu Q¥R #n nb u bn R

_ ~ ^ ~Ø ^

o¥g o ¥¥ ¥ÙG g

% ( &'(

- ¨*¨ ¦)¤@¦¥¨*¦K§0 ¡ £/ 0 ¦¥¨

¥#

CFEVØ¢C¥Vr¥Ú

¥# #

C¥¥ÍC@ ¥Î

¥#

CrÛDECrVFÏD

¥#

! CFEVØ¢C¥Vr¥Ú

(

£+¥. ¦4 ¥I ¨@£¥8¥¦4 ¥¦¥¨4¤§-¥ ¥-)¨

56 Figure 2.1. Exemple de chaîne de traitement automatisée. Tous les chromatogrammes (traces) sont récupérés et traités les uns après les autres par le programme Phred ("base calling" et affectation d'une valeur de qualité à chaque base), qui crée pour chaque séquence un fichier au format fasta en éliminant les extrémités de la séquence d'une qualité inférieure à un seuil (seuil de 20, soit 1 chance sur 100 que la base soit fausse). Puis chacun de ces fichiers est traité par Cross_match qui masque les zones correspondant à du vecteur. Une fois toutes les séquences nettoyées, le programme "concatène" tous les fichiers produits par Cross_match pour obtenir un seul fichier (contenant toutes les séquences). Ce fichier est traité par le programme Blast (recherche de similitudes dans une banque de données publique comme NR qui contient toutes les séquences non redondantes de protéines). Le fichier résultat du blast est ensuite analysé par un "parseur" qui extrait l'information importante et la présente de façon lisible, sous la forme d'un tableau contenant entre autre le nom de la séquence de l'étiquette (en jaune), la taille de cette séquence (en marron), les positions de début (en bleu) et de fin (en vert) de l'alignement et la E_value de l'alignement (en rouge). Cette information permet d'extraire de la séquence la sous-séquence (la partie) qui s'aligne avec une protéine connue et qui donc doit correspondre à une partie traduite. Cette sous-séquence va servir par exemple à calculer le pourcentage en GC ou connaître la table d'usage des codons, ou bien être traduite et permettre de faire un alignement multiple.

57 Pour chaque groupe ainsi défini ("cluster"), les séquences non masquées (à l'exception des polyA/T) relevant de ce groupe sont ré-assemblées et "ligaturées in silico" ("contiged") en utilisant CAP3 (Huang & Madan, 1999) avec les options par défaut. Les séquences ainsi obtenues ("contigs") sont alors annotées par comparaison avec la banque de séquences non redondantes SWALL (Swiss-Prot, SPTREMBL) en utilisant LASSAP (avec les paramètres E_value=0.00001 et Score=50). Une base de données relationnelle permet de stocker et d'associer les séquences aux annotations, ainsi que de relier les séquences aux "clusters" et "contigs" correspondants. Une interface est développée pour permettre une consultation de ces données à travers le réseau Internet, l'utilisateur pouvant se déplacer, avec des questions, dans les "clusters" et le long des "contigs" (consensus, origine des séquences individuelles, alignements, annotations, disponibilité des clones). Des graphiques présentent les alignements de séquence pour chaque "contig", en indiquant les scores correspondant aux annotations. L'utilisateur peut également effectuer des recherches par mot clé, et exécuter lui-même certains programmes d'annotation (Clustalw, Blast, Primer3).

58 3. Chapitre 3

Participation au développement d'Hebeloma cylindrosporum

en tant qu'espèce modèle: construction d'une banque d'ADNc

et d'une ressource d'étiquettes

L'analyse historique du développement des espèces modèles en biologie, tel Arabidopsis thaliana pour les végétalistes, révèle clairement que les premiers programmes de séquençage systématique d'ADNc et de production d'étiquettes ont joué un rôle considérable dans la structuration de la communauté scientifique concernée, l'établissement de réseaux de collaborations, et finalement l'accélération du développement des programmes de recherche et de l'acquisition des connaissances. Dans ce contexte, alors que notre équipe commençait à s'intéresser à la symbiose ectomycorhizienne et au modèle Hebeloma cylindrosporum, nous avons choisi de contribuer au développement de cette espèce en tant que modèle, au sein de la communauté française, par la production d'une banque d'étiquettes. Dans l'espoir d'augmenter l'intérêt de cette démarche, nous avons choisi de construire la banque d'ADNc dans un vecteur d'expression navette S. cerevisiae / E. coli, permettant d'engager directement des opérations de clonage d'ADNc par complémentation fonctionnelle de souches de levure mutante.

Ce travail est présenté ci-dessous directement sous la forme de l'article auquel il a donné lieu.

59 60

Research

Large-scaleBlackwell Publishing, Ltd. identiﬁcation of genes in the fungus Hebeloma cylindrosporum paves the way to molecular analyses of ectomycorrhizal symbiosis

Raphaël Lambilliotte1, Richard Cooke2, Delphine Samson3, Cécile Fizames1, Frédéric Gaymard1, Claude Plassard4, Marie-Violaine Tatry 1,4, Christel Berger2, Michèle Laudié 2, Fabrice Legeai3, Emmanuelle Karsenty 3, Michel Delseny 2, Sabine Zimmermann1 and Hervé Sentenac1 1Biochimie et Physiologie Moléculaire des Plantes, UMR 5004 Agro-M-CNRS-INRA-UM2, 2, Place Viala, F −34060 Montpellier Cedex, France; 2Laboratoire de Génétique et Développement des Plantes, UMR 5096 CNRS-UP, 52, Avenue de Villeneuve, F−66860 Perpignan, France; 3Génoplante-Info, Unité de Recherche Génomique-Info, INRA, Infobiogen, 523 Place des Terrasses, F−91034 Evry Cedex, France; 4Rhizosphère et Symbiose, UMR 1222 Agro-M-INRA, 2, Place Viala, F−34060 Montpellier Cedex, France

Summary

Author for correspondence: • In an attempt to advance the understanding of ectomycorrhizal symbiosis, which Hervé Sentenac improves mineral nutrition and resistance to abiotic and biotic stresses of most Tel: +33 499612605 woody plants from temperate and boreal regions, we produced a cDNA library of Fax: +33 499612930 Email: [email protected] the ectomycorrhizal fungus Hebeloma cylindrosporum in a yeast expression vector. The library was used for functional complementation cloning and for sequencing of Received: 16 April 2004 4036 expressed sequence tags (ESTs). Accepted: 21 June 2004 • Expression of the library in a yeast ade2 and trp1 mutant strain allowed cloning of two Hebeloma genes, HcADE2 and HcTRP1 by functional complementation. This experiment highlighted both the efficiency of the complementation strategy and the quality of the library. • All sequence data available on Hebeloma (4596) were analysed and contiged. The whole EST resource is accessible via a web interface, which allows searching and navigation through clusters and tentative contigs (TCs). • Analysis of the database revealed a low level of counterparts already identified in other ectomycorrhizal fungi. For example, it allowed identification of a large set of membrane transporters, such as phosphate, potassium, sulphate or micronutrient transporters. Thus, this EST resource provides a valuable tool for research on ectomycorrhiza and symbiotic interactions.

Key words: Hebeloma cylindrosporum, ectomycorrhizal fungus, expressed sequence tag (EST), expression cloning, membrane transport. New Phytologist (2004) 164: 505–513 © New Phytologist (2004) doi: 10.1111/j.1469-8137.2004.01185.x

fungal groups and form intricate associations called mycorrhizas. Introduction Mycorrhizal symbiosis appeared very early during evolution Most terrestrial plants live in symbiosis with fungal partners and was instrumental in the colonization of land by ancient (Smith & Read, 1997). Their roots can interact with speciﬁc plants (Simon et al., 1993; Taylor et al., 1995). Approximately two kinds of mycorrhizas can be distinguished: the ectomycorrhizas, in which the fungal symbiont develops intercellular The gene nucleotide sequences reported in the paper have been submitted to the EMBL database with accession numbers AJ617285 and AJ617286 for hyphae from a mycelial sheath covering the surface of short HcADE2 and HcTRP1, respectively. ESTs have been submitted to the lateral roots, and the endomycorrhizas, characterized by intra- GenBank dbEST database with accession numbers CK991564 to CK995663. radical mycelium growth and intracellular fungal development.

www.newphytologist.org 505 61

506 Research

Ectomycorrhization concerns almost all woody plants from dikaryon HC1 (Debaud & Gay, 1987; Gay et al., 1993). temperate and boreal ecosystems. Most often, the fungal partners The strains were grown in the dark either at 29°C on liquid of these plants belong to Basidiomycota and Ascomycota. medium (Scheromm et al., 1990) or at 22°C on agar solid Whatever the kind of mycorrhizal symbiosis, the fungal medium. The standard growth medium contained 85 m partner provides the plant with mineral nutrients and improves glucose, 5 m glutamic acid, 3.3 m asparagine, 5 mg l−1 ferric     its tolerance to biotic and abiotic stress. In exchange, the citrate, 3 m KCl, 1 m KH2PO4, 2 m MgSO4, 1 m  −1 plant provides the fungus with photosynthates. When soil CaCl2, 0.3 µ thiamine-HCl, supplemented with 0.2 ml l resources are limiting, as often occurs in natural condi- of micronutrient solution (Morizet & Mingeau, 1976); pH tions, mycorrhizal symbiosis can strongly improve the mineral was adjusted to 6.0 with KOH. Solid medium was obtained nutrition of the host plant and, finally, the productivity of by adding 1.5% agar. the ecosystem (Smith & Read, 1997). Thus, identification of mechanisms involved in exchanges of solutes and signals cDNA library construction between the two symbionts can be considered as a crucial issue (Martin et al., 2001). At the molecular level, our present know- Mycelia from D2, h1 and h7 strains were grown for 2 wk on ledge in this field is still rather poor. For example, very few standard liquid medium. To increase the chance of identifying fungal genes encoding membrane transport systems have been genes involved in potassium or phosphate transport, they were characterized to date – two phosphate transporters in endomy- transferred for one more week either to renewed standard corrhizal zygomycetes from the order Glomales (Harrison medium, phosphate-free medium (standard medium without + & van Buuren, 1995; Maldonado-Mendoza et al., 2001), and KH2PO4) or K -free medium (standard medium without  eight transporters in ectomycorrhizal fungi (Nehls et al., 1998; KCl and 1 m (NH4)2PO4 substituted for KH2PO4). Similar Nehls et al., 1999; Montanini et al., 2002; Wipf et al., 2002; amounts from the nine types of fungal material (three strains Jargeat et al., 2003; Javelle et al., 2003) – and most of them in three media) were pooled. RNA was extracted as described were cloned from the basidiomycete Hebeloma cylindrosporum by Lobreaux et al. (1992) and purified with a polyAtrack kit and are involved in nitrogen nutrition. (Promega, Madison, WI, USA). cDNA was obtained using M- Hebeloma cylindrosporum is often associated with Pinus MLV Reverse Transcriptase, RNase H Minus (Promega) and pinaster along the temperate Atlantic coast. However, it is able second-strand synthesis carried out using a Universal Riboclone to form ectomycorrhizas with a wide range of species from cDNA Synthesis System (Promega). An aliquot (5 µg) of the different gymnosperm and dicot families (Giltrap, 1982; Debaud cDNA library was sized into three different pools (0.4–1 kb, et al., 1997). This fungus was recently shown to be transform- 1–2.5 kb and 2.5–7 kb) and another aliquot (3 µg) was not able via Agrobacterium tumefaciens, and a T-DNA insertion sized. The four cDNA pools were ligated to a DNA adapter mutant collection has been obtained (Combier et al., 2003). with CACA cohesive ends compatible with the GTGT ends Furthermore, to date, Hebeloma represents the only ectomy- produced in the multicopy vector pFL61 (containing the corrhizal species that can be grown in vitro from spores to spores replication origin of the yeast 2 µm plasmid) by BstXI (Debaud & Gay, 1987), allowing development of genetic digestion, as described by Minet et al. (1992). A fraction of approaches. Thus, H. cylindrosporum can be considered a good cDNA was ligated in pFL61 vector and, after transformation, candidate as an ectomycorrhizal model species. In this context, 5000 clones were randomly picked. Most of them (c. 4000) we constructed a library of Hebeloma cDNA in a yeast expression were picked from 2.5 × 105 clones obtained after electropora- vector. Here we show that this library can be used for cloning tion of about one-third of the 1–2.5 kb cDNA pool. The of genes by functional complementation of yeast mutants. other clones (c. 1000) were picked from the unsized and 2.5– Furthermore, a collection of 4036 expressed sequence tags 7 kb sized libraries. The selected clones were ordered in 96- (ESTs) was obtained. Analysis of this resource with a primary well plates, grown in liquid medium and sequenced. The interest in genes likely to play a role in uptake of nutrient ions mean length of the inserts was determined by polymerase from the soil, secretion of nutrients towards the host plant or chain reaction (PCR) analysis. Amplification of 350 clones uptake of photosynthates from the plant allowed identifica- from the 1–2.5 kb cDNA pool provided a mean length tion of a large set of candidate genes. estimate of 1.4 kb (standard deviation 0.4 kb).

Materials and Methods EST sequencing and sequence data analysis Sequencing was performed (dye terminator method, ABI377 Organism and culture media and ABI3100 sequencers; Perkin Elmer, Foster City, CA, Three strains of the ectomycorrhizal basidiomycete H. cylind- USA) on puriﬁed plasmid (Wizard SV 96 Plasmid DNA rosporum Romagnesi, D2, h1 and h7, were used. The dikaryotic Puriﬁcation System, Promega). The resulting sequences were strain D2 was derived from the fusion of h1 and h7, two analysed by a pipeline developed by GénoPlante-Info (GPI; compatible haploid strains obtained from the in vitro fruiting Samson et al., 2003). Expressed sequence tag chromatograms

New Phytologist (2004) 164: 505–513 www.newphytologist.org © New Phytologist (2004) 62

Research 507 were trimmed for bad quality zones, using Phred as the homologues of the yeast ADE2 (Stotz & Linder, 1990) and base caller (Ewing et al., 1998; http://www.phrap.org) with a TRP1 (Tschumper & Carbon, 1980) genes by functional com- threshold of 20. Vector and adapter sequences were removed plementation. ADE2 encodes a phosphoribosylamino-imidazole- using the _ software (unpublished; see http:// carboxylase and TRP1 encodes a phosphoribosylanthranilate www.phrap.org) with the parameters minmatch 12 and minscore isomerase. These enzymes are necessary for adenine and try- 20, and the GPI program . PolyA/polyT tails were ptophan synthesis, respectively. Yeast cells were transformed cut to 10 bp to avoid spurious matches. (Schiestl & Gietz, 1989) with 15 µg of cDNA library (using Sequences obtained in this project (GenBank accession the amplified 1–2.5 kb cDNA sized pool). About 2 × 105 nos CK991564–CK995663), as well as 12 Hebeloma mRNA transformants were directly selected on solid YNB selective sequences already present in EMBL and 548 Hebeloma ESTs medium (Sigma, St Louis, MO, USA) supplemented with from dbEST (Wipf et al., 2003) were pooled to screen for 130 µ histidine and 230 µ leucine, and with either 200 µ contamination with sequences matching Escherichia coli (no tryptophan or 150 µ adenine, to identify clones comple- occurrence), yeast (one occurrence), plant rRNA (four occur- menting the ade2 and trp1 mutations, respectively. Plasmids rences) and plant mitochondria (no occurrence) using the from positive clones were extracted and retransformed into _ software (minmatch 100 and minscore 150, W303 cells to confirm complementation. cDNAs from selected except for rRNA; minmatch 100, minscore 100). positive plasmids were recovered and sequenced. Drop tests Before clustering, regions displaying residual homology were performed by spotting on solid selective medium 10 µl (detected by the _ software) with vectors present aliquots of a yeast cell suspension diluted to an optical density in Univec (a vector library, http://www.ncbi.nlm.nih.gov/ at 600 nm of 0.3 from a culture grown overnight in selective VecScreen/UniVec.html) were masked as well as repeats liquid medium. obtained with  (A. Smit, unpubl. data; A full-length TRP1 cDNA was reconstituted by PCR on http://repeatmasker.genome.washington.edu). Sequences with the 1–2.5 kb cDNA sized pool using primers complementary remaining unmasked stretches shorter than 60 nucleotides to the sequence just upstream from the plasmid cloning site were eliminated before clustering. Clustering was performed (5′-CTGCATAAAGGCATTAAAAAGAGGAGCG-3′) and with  (Glemet & Codani, 1997; http://www.gene-it.com) specific to the clone complementing the yeast trp1-1 mutation with the following parameters: minimal length of 60 bp and (5′-CAAGAAGAGTCTGTAAGTCAACC-3′). PCR was per- minimal percentage of identity of 90%. Unmasked sequences formed using Extrapol II (Eurobio, Courtaboeuf, France). (except for polyA/T tail) from each cluster were contiged using CAP3 (Huang & Madan, 1999) with the default options. Results and discussion The resulting contig consensi (tentative contigs, TCs) were annotated by comparison against SWALL (December 2003 Functional complementation of yeast mutants with the release), a nonredundant protein database obtained from Swiss- cDNA library Prot, SPTREMBL and their updates (ftp://ftp.ebi.ac.uk/pub/ databases/), using  2 algorithm and GPI tools, The Hebeloma cDNA library was directly cloned in a yeast with the following parameters: E = 0.00001, S = 50. expression vector, to allow cloning of fungal genes by func- Sequences and annotations, as well as links between tional complementation of yeast mutants (Wipf et al., 2003). sequences, clusters, TCs and libraries, are stored in a rela- The suitability of the library for developing yeast comple- tional database. To access these data, a web interface (http:// mentation approaches was tested for two different auxotrophic urgi.infobiogen.fr//Projects/INRA_Hcy1/) has been developed mutations, ade2 and trp1, both carried by the W303 yeast strain to allow users to query and navigate through clusters and TCs (Thomas & Rothstein, 1989). Yeast cells were transformed with (consensus, origin of its members, alignments, annotation the cDNA library and transformants were selected for growth and availability of the clones). Graphical representations show on adenine- or tryptophan-free medium, respectively. From sequence alignments for each singleton and TC (STC), and 4 × 105 transformants, one single transformant was able to annotation hits. All sequences and consensi are also accessible grow on the former medium, and eight on the latter. Plasmid through a web  developed with the Pise generator extraction, amplification and retransformation into W303 cells (Letondal, 2001). confirmed the complementation phenotype (Fig. 1a,b). After Analyses of GC content and codon usage were performed sequencing of the corresponding inserts, PCR on genomic using  software (http://www.molbiol.ox.ac.uk/cu/). DNA and reverse transcriptase polymerase chain reaction (RT-PCR) experiments confirmed the Hebeloma origin of the complementing cDNAs (data not shown). The protein Yeast transformation and selection deduced from the sequence of the cDNA complementing the The Saccharomyces cerevisae strain W303-1B (mat a, ura3–1, ade2 mutation displayed c. 53% identity and 66% similarity leu2-3, his 3-11, 15, trp1-1, ade2-1, Canr) (Thomas & with the ADE2 enzyme from yeast (Stotz & Linder, 1990). Rothstein, 1989) was used for cloning of H. cylindrosporum Sequence alignment of the two proteins suggested that

Fig. 1 Functional cloning of Hebeloma cylindrosporum genes by expression of the cDNA library in a Saccharomyces cerevisiae mutant strain. (a) Functional complementation of the ade2-101 mutation in the W303 yeast strain. Yeast cells were transformed with the cDNA library and plated on adenine-free selection medium. A single positive clone was obtained (HcADE2). A drop test (photograph) was performed on the selection medium after re-transformation of W303 cells with this clone (in pFL61). Negative control: W303 cells transformed with the empty plasmid pFL61. Positive control: W303 cells cotransformed with the empty plasmids pFL61 and pZA2, the latter (derived from pFL39; Bonneaud et al., 1991) carrying the yeast ADE2 gene as a marker. (b) Functional complementation of the trp1-1 mutation in the W303 yeast strain. Eight positive clones were obtained after selection of the transformed cells on tryptophan-free selection medium, corresponding to four different partial cDNAs (incomplete at the 5′ end; panel c) from the same gene. They were named HcTRP1-a, -b, -c and -d. Each of them (in the pFL61 vector) was reintroduced into W303 for a drop test on the selection medium. Negative control: W303 cells transformed with pFL61 empty plasmid. Positive control: W303 cells cotransformed with the empty plasmids pFL61 and pFL39 (Bonneaud et al., 1991), the latter carrying the yeast TRP1 gene as a marker. (c) The HcTRP1 cDNA encodes a trifunctional enzyme. Below the full-length sequence (obtained by polymerase chain reaction on the cDNA library) are representations at the same scale of the four partial cDNAs HcTRP1-a to -d. Open and closed triangles, ﬁrst ATG and stop codons, respectively. (d) Representation of the S. cerevisiae TRP1 gene product, of its counterpart in Arabidopsis thaliana, and of multifunctional enzymes from Escherichia coli, Schizosaccharomyces pombe and Neurospora crassa endowed with TrpF activity.

the cloned Hebeloma cDNA, HcADE2 (EMBL accession no. is sufﬁcient for functional complementation of the yeast trp1 AJ617285), contains the full-length coding sequence. Sequence mutant strain. In conclusion, the two experiments performed analyses of the eight clones complementing the trp1 mutation in order to check the feasibility of using the cDNA library for showed that the eight clones correspond to four partial cDNAs cloning Hebeloma coding sequences by functional comple- from the same gene, the coding sequence being truncated at mentation of yeast mutant strains gave positive results, high- the 5′ end in each clone (Fig. 1c). The four partial cDNAs all lighting the quality of the library. contain a domain called TrpF (Fig. 1d), the deduced sequence of which displays c. 26% identity and 40% similarity with Analysis of the EST resource the TRP1 protein disrupted in the yeast mutant. The PCR experiments on the H. cylindrosporum library (1–2.5 kb cDNA Sequencing of H. cylindrosporum cDNAs gave 4036 high sized pool) allowed reconstitution of the full-length coding quality ESTs (1439 ESTs between 150 bp and 500 bp, and sequence of the corresponding gene, named HcTRP1 (EMBL 2597 ESTs longer than 500 bp). The average sequence length accession no. AJ617286). Sequence analysis suggested that was 483 bp. After clustering and contiging, they represent the encoded protein is a trifunctional enzyme comprising, as 2399 STCs (1941 singletons and 458 TCs). The library is already described in some fungi (Schechtman & Yanofsky, accessible at the Génoplante address (http://urgi.infobiogen.fr/ 1983), a TrpF domain showing the same enzymatic activity as /Projects/INRA_Hcy1/). The library contains the whole set the yeast TRP1 gene product, and two other domains, TrpC of available Hebeloma sequences (ESTs from this project and and PabA, also involved in tryptophan synthesis. Thus, the the 560 Hebeloma sequences already present in databases, whole set of data indicates that the TrpF domain of HcTRP1 representing a total of 2691 STCs; Table 1). This site allows

New Phytologist (2004) 164: 505–513 www.newphytologist.org © New Phytologist (2004) 64 Research 509

Table 1 Analysis of the expressed sequence tag (EST) library and matches to known proteins from public databases (Galagan clustering of Hebeloma sequences et al., 2003). As a whole, these data highlight the early stage

of genome exploration in filamentous fungi (Martin et al., Number of ESTs 4584 2004) and the high diversity of the genes remaining to be Number of STCs 2691 Number of singletons 2078 characterized in these organisms. They emphasize the fact that Number of TCs 613 further production of EST resources as well as genome Number of TCs containing 2 ESTs 316 sequencing are important in ectomycorrhizal fungi. Number of TCs containing 3 ESTs 116 Number of TCs containing 4 ESTs 59 The GC content in the whole set of STCs was 50%, while Number of TCs containing more than 50 ESTs 3 it was 52% in the set of sequences identified as coding regions Number of TCs longer than 1000 bp 26 (i.e. having counterparts in databases, as identified by  Number of STCs sharing similarities with proteins from other speciesa alignment; E-value < 1E-5), suggesting a higher GC content a BLASTX E-value < 1E-5 1275 (1090) in the coding sequences, in agreement with previous analyses a BLASTX E-value < 1E-20 794 (658) in S. cerevisiae, P. chrysosporium, and other organisms (Akashi, 2001; Vinogradov, 2003; Martinez et al., 2004). Furthermore, STC, singleton and tentative contigs (TCs). a BLAST searches were performed either in the NCBI NR database or in the sequences identified as coding regions and corresponding Swissprot; the numbers in parentheses refer to the search in the latter to singletons (794 sequences), TCs including at least three database. ESTs (163 sequences) or TCs including at 10 least ESTs (18 sequences) display GC contents of 51%, 54% and 54%, respectively. These differences suggest that highly expressed interrogation by  (using the Blast server link) and by sequences have a higher GC content, which may reflect greater keywords (using the GPiDB (Genoplante-info database) link). codon usage biases, as reported in other organisms (Akashi, 2001; Expressed sequence tag resources have been produced for Vinogradov, 2003). It has been shown that highly expressed a few ectomycorrhizal fungal species, principally Paxillus invo- genes in S. cerevisiae, Caenorhabditis elegans and Drosophila lutus (Johansson et al., 2004), Laccaria bicolor and Pisolithus melanogaster have relatively higher codon usage biases, when microcarpus (Tagu & Martin, 1995; Voiblet et al., 2001; Peter compared with genes expressed at low levels. These increases et al., 2003). About 7500, 1900 and 1400 ESTs, respectively, in codon usage biases have been shown to favour the use of have been identified for these three species in the GenBank major codons and relatively abundant tRNAs, a phenomenon dbEST database. When the whole set of STCs present in the which is thought to result in improved efficiency of the Hebeloma library was blasted against these four pools of ESTs protein synthesis machinery (Akashi, 2001). Analysis of the (, E-value < 1E-5), no hits were found for a consider- codon usage bias between the three classes of Hebeloma able fraction of the Hebeloma sequences (2052 out of 2691 coding sequences corresponding to singletons or to TCs STCs, i.e. c. 76% of the resource). Thus, the present Hebeloma including at least 3 or 10 ESTs showed a systematic bias in library provides very new sequence information on ectomyc- the second class compared with the first and in the third class orrhizal fungal species. In addition, the genomes of four non- compared with the second. This is particularly clear for codons mycorrhizal basidiomycetes have been sequenced recently. with a C residue rather than an A at the third position, except These are the rot Phanerochaete chrysosporium (Martinez et al., for codon AGC (serine), as illustrated for the arginine and 2004), the saprophyte Coprinus cinereus, the plant pathogen leucine codons in Fig. 2a,c. Finally, synonymous codon usage Ustilago maydis and the human pathogen Cryptococcus neoformans was compared between H. cylindrosporum and S. cerevisiae. The (data available before publication at http://www.broad.mit.edu/ most important biases were observed for codons specifying annotation/fungi/coprinus_cinereus/, http://genome.jgi-psf. arginine and leucine (Fig. 2b,d). The frequencies of CGC org/whiterot1/whiterot1.home.html, http://www-genome.wi. (encoding arginine) and CUC (leucine) codons are several-fold mit.edu/annotation/fungi/ustilago_maydis/index.html, and higher in H. cylindrosporum than in S. cerevisiae. Such discrep- http://baggage.stanford.edu/group/C.neoformans/down- ancies might impede translation of Hebeloma cDNA in yeast. load.html, respectively). The percentage of Hebeloma STCs A subset of 2900 ESTs was sorted into functional categories that have no counterparts (, E-value < 1E-5) in these (Fig. 3). Being interested in membrane transport (see below), genomes is rather high at 54, 40, 57 or 60%, respectively. we defined a ‘Transporters’ cluster, which was found to com- Furthermore, about 60% of the Hebeloma STCs have no prise about 1% of the ESTs. The predicted products of 3–4% counterpart (, E-value < 1E-5) in the Neurospora crassa of the genes show similarity to membrane transporters in annotated protein database (http://www-genome.wi.mit.edu/ S. cerevisiae or N. crassa (Paulsen et al., 1998; Borkovich et al., annotation/fungi/neurospora/). Finally, about 50% of the 2004). Membrane transporter-encoding genes generally have translated STCs do not display any similarity with proteins rather low expression levels, suggesting that genes expressed identified in other species ( with low stringency para- at a low level are fairly well represented in the EST resource. meters: E-value < 1E-5), consistent with the recent observa- Polymerase chain reaction amplification on genomic DNA tion that about 40% of Neurospora proteins lack significant and RT-PCR experiments were performed for a few (putative)

Fig. 2 Codon usage in Hebeloma cylindrosporum and comparison with Saccharomyces cerevisiae. The analysis concerns arginine (a,b) and leucine (c,d), the two amino acids for which the differences in codon usage found between H. cylindrosporum and S. cerevisiae are the most signiﬁcant. (a,c) Codon usage in Hebeloma sequences identiﬁed as corresponding to singletons (grey bars), or tentative contigs (TCs) including at least three expressed sequence tags (ESTs) (diagonally hatched bars) or TCs including to at least 10 ESTs (horizontally hatched bars). (b,d) Comparison of codon usage between H. cylindrosporum (open bars) and S. cerevisiae (closed bars). Only codons from the regions that could be aligned with other sequences from the NCBI NR database using the BLASTX program and an E-value lower than 1E-5 were taken into account in these analyses.

transporter genes (one K+ carrier, one K+ channel and two inorganic phosphate (Pi) carriers; STC identification numbers: 009C09R1.0A1.1 and 009A07R1.0A1.1; see later and Table 3), the two enzymes HcADE2 and HcTRP1 involved in the synthesis of adenine and tryptophan and two house- keeping genes (EF1-α and tubulin-α; STC identification numbers: CTG_HC_54.2-002B03R1.0A and CTG_HC_ 75.2-010E10R1.2A). In each case, they confirmed the Hebe- loma origin of the corresponding ESTs (data not shown).

Analysis of the most abundant ESTs Fig. 3 Relative distribution of 2900 Hebeloma ESTs by functional categories. Analysis was performed using BLASTX algorithm. NH, Clustering and contig analysis identified three TCs, 001B03R1, no hit (sequences having no counterpart with E-value ≤ 1E-5); M, 001G06R1 and 002C02R1, represented by more than 80 ESTs metabolism (sequences having counterpart involved in metabolism in each (Table 2) (i.e. about twice as many as observed for the other organisms with E-value ≤ 1E-5); PS, Protein synthesis; PM&P, next most redundant sequences, e.g. the ADP/ATP carrier postranscriptional modification and proteolysis; C, cytoskeleton; protein, represented by 27 ESTs). Sequence analysis indicates ST, signal transduction; NP, nuclear proteins; T, transporters; ′ MP, probable membrane proteins; CW, cell wall proteins; NC, that these three clones are complete at the 3 extremity nonclassified: ESTs having similarities with hypothetical protein were (presence of a poly A tail) and that two of them (001B03R1 categorized in ‘Non Classified’ together with ESTs which could not be and 001G06R1) are probably complete at the 5′ extremity classified into the above functional categories. (in frame stop codons present upstream from the initiating ATG). The encoded polypeptides (predicted from the full

Table 2 Most abundant transcripts as determined by clustering of expressed sequence tags (ESTs)

Number Accession STC accession Size (bp) of ESTs E-value Strongest BLASTX hit Species number

001B03R1.0A1.1 1490 91 No hit 001G06R1.0A1.1 1288 88 No hit 002C02R1.0A1.1 1218 82 No hit 008G03R1.0A1.1 638 33 No hit 004D07R1.0A1.1 702 28 No hit 001G04R1.0A1.1 649 27 5E-70 ADP/ATP carrier protein Oryza sativa sp.|P31691 001B04R1.0A1.1 817 28 2E-47 small heat shock protein Laccaria bicolor gb|AAM78595.1

New Phytologist (2004) 164: 505–513 www.newphytologist.org © New Phytologist (2004) 66 Research 511 sequences) are of 427, 268 and 338 residues (46, 30 and 39 the hypothesis that hydrophobin genes are highly expressed in kDa), respectively. They are highly charged and have isoelectric Hebeloma. points of 9.4, 10.3 and 4.9, respectively. The second polypeptide displays one putative transmembrane segment, and the Identification of fungal membrane transport systems third has three repeats of a domain of 90 residues which is rich in basic residues in its N-terminal part and in acidic residues Ectomycorrhizal symbiosis improves plant nutrition by increasing in its C-terminal part. Searches using the  program the absorbing surface area, excreting chelating compounds revealed no significant similarity between any of these or ectoenzymes and mobilizing sparsely available nutrient three polypeptides and sequences from the nonredundant sources (Marschner & Dell, 1994; Chalot et al., 2002). Beneficial protein database or deposited in web sites for the four fungi effects have been reported for all major and minor elements P. chrysosporium, C. cinereus, U. maydis and C. neoformans (see (Smith & Read, 1997; Landeweert et al., 2001). Improvement earlier). Thus, it will be interesting to check whether these of the plant phosphorus nutrition is one of the most well- three highly expressed sequences are typical of ectomycorrhizal documented effects, at the physiological and ecophysiological fungi. levels, since phosphate is often the most limiting mineral nutrient Fungal hydrophobins form a class of cysteine-rich hydrophobic in natural ecosystems. Two phosphate transporters (Table 3) and cell wall proteins known to play important roles in morpho- several enzymes involved in P metabolism could be identified genetic processes (Kershaw & Talbot, 1998). They have been in the EST resource, opening the way to molecular analysis of shown to be expressed at interfaces between fungal cell walls Pi uptake, accumulation and transfer to the host plant. Other and the air or solid surfaces, including plant surfaces in patho- genes involved in the transport of potassium, sulphate, water, genic or symbiotic interactions (Kershaw & Talbot, 1998). and minor elements such as iron and manganese (Table 3) could Hydrophobin genes have been shown to be highly expressed be identified in the EST resource. Clearly, while molecular in several basidiomycetes (Wessels et al., 1991) and ectomyc- analyses of ectomycorrhizal symbiosis are still in their infancy orrhizal species (Tagu et al., 1996; Mankel et al., 2002). Analysis (Combier et al., 2003; Peter et al., 2003; Wipf et al., 2003), the of the present Hebeloma EST library allowed us to identify cDNA and EST libraries we have produced provide valuable three different hydrophobin genes, the corresponding TCs resources further strengthening the interest of Hebeloma as a comprising 10, 5 and 2 ESTs. This result is consistent with model ectomycorrhizal species.

Table 3 Singleton and tentative contigs (STCs) identifying transport systems (BLASTX analysis) probably involved in a role in solute absorption or translocation towards the host plant by the fungus

STC no. Putative function by BLASTX similarity Species E-value Accession number

019D05R1.2A1.1 MFS inorganic phosphate transporter Schizosaccharomyces pombe 1E-17 CAB91163.1 019F03R1.2A1.1 Phosphate transporter Pholiota nameko 3E-53 BAB43910.1 009C09R1.0A1.1 Potassium transport protein TRK1 Schizosaccharomyces pombe 5E-6 CAA93300.1 009A07R1.0A1.1a Action potential broadening potassium channel Aplysia sp. 8E-3a AAC60504.2 048D01R1.3A1.1 Putative sulphate transporter protein Saccharomyces cerevisiae 5E-10 CAA88781.1 025B07R1.2A1.1 Putative chloride channel ClC-3 Xenopus laevis 6E-8 CAA71072.2 009C02R1.0A1.1 P-type calcium ATPase 3 Schizosaccharomyces pombe 1E-23 CAA17009.1 005H11A1.0A1.1 High-afﬁnity iron permease CaFTR2 Candida albicans 7E-15 AAF69681.1 009D07R1.0A1.1 Nramp manganese transporter Schizosaccharomyces pombe 7E-6 CAA93297.1 049H07R1.3A1.1 MIP water channel Schizosaccharomyces pombe 6E-21 CAB69639.1 032G12R1.2A1.1 Putative amino acid permease Schizosaccharomyces pombe 2E-8 CAA19131.1 015E11R1.2A1.1 Peptide transport protein PTR2 Saccharomyces cerevisiae 1E-9 CAA51947.1 011E01R1.2A1.1 Ammonium transporter Hebeloma cylindrosporum 0.0 AAK82417.1 015F01R1.2A1.1 Multidrug resistance protein 1 Filobasidiella neoformans 7E-31 AAC49889.1 015G02R1.2A1.1 ABC transporter ABCC.10 Dictyostelium discoideum 6E-15 AAL85713.1 019F12R1.2A1.1 ABC transporter ATP-binding protein Pyrococcus abyssi 2E-10 CAB49438.1 029D10R1.2A1.1 ATP-binding cassette subfamily E member 1 Homo sapiens 1E-68 BAB93476.1 041C02R1.3A1.1 Probable ABC transporter Schizosaccharomyces pombe 4E-27 CAA17906.1 043E08R1.3A1.1 Multidrug resistance P glycoprotein Saccharomyces cerevisiae 4E-6 1512309A 043F01R1.3A1.1 MRP-like ABC transporter Oryza sativa 5E-26 CAD59448.1 007G12R1.3A1.1 Putative hexose transporter protein Agaricus bisporus 7E-7 CAD58863.1 029C01R1.2A1.1 Hexose transporter Aspergillus oryzae 9E-20 BAC20337.1 031D07R1.2A1.1 Monosaccharide transporter AmMst-1 Amanita muscaria 2E-31 CAB06078.1 044A11R1.3A1.1 Related to myo-inositol transport protein ITR1 Neurospora crassa 4E-23 CAB99236.1 aSequencing of the full length insert gave a sequence which conﬁrms this similarity with an E-value of 1E-31.

Acknowledgements Huang X, Madan A. 1999. CAP3: a DNA sequence assembly program. Genome Research 9: 868–877. This work was supported (EST sequencing) by Montpellier Jargeat P, Rekangalt D, Verner MC, Gay G, Debaud JC, Marmeisse R, LR Génopole. Fraissinet-Tachet L. 2003. Characterisation and expression analysis of a nitrate transporter and nitrite reductase genes, two members of a gene cluster for nitrate assimilation from the symbiotic basidiomycete Hebeloma References cylindrosporum. Current Genetics 43: 199–205. Javelle A, Morel M, Rodriguez-Pastrana BR, Botton B, Andre B, Akashi H. 2001. Gene expression and molecular evolution. Current Opinion Marini AM, Brun A, Chalot M. 2003. Molecular characterization, in Genetics and Development 11: 660–666. function and regulation of ammonium transporters (Amt) and Bonneaud N, Ozier-Kalogeropoulos O, Li GY, Labouesse M, ammonium-metabolizing enzymes (GS, NADP-GDH) in the Minvielle-Sebastia L, Lacroute F. 1991. A family of low and high copy ectomycorrhizal fungus Hebeloma cylindrosporum. Molecular Microbiology replicative, integrative and single-stranded S. cerevisiae/E. coli shuttle 47: 411–430. vectors. Yeast 7: 609–615. Johansson T, Le Quere A, Ahren D, Soderstrom B, Erlandsson R, Borkovich KA, Alex LA, Yarden O, Freitag M, Turner GE, Read ND, Lundeberg J, Uhlen M, Tunlid A. 2004. Transcriptional responses of Seiler S, Bell-Pedersen D, Paietta J, Plesofsky N, Plamann M, Paxillus involutus and Betula pendula during formation of ectomycorrhizal Goodrich-Tanrikulu M, Schulte U, Mannhaupt G, Nargang FE, root tissue. Molecular Plant–Microbe Interactions 17: 202–215. Radford A, Selitrennikoff C, Galagan JE, Dunlap JC, Loros JJ, Kershaw MJ, Talbot NJ. 1998. Hydrophobins and repellents: proteins with Catcheside D, Inoue H, Aramayo R, Polymenis M, Selker EU, fundamental roles in fungal morphogenesis. Fungal Genetics and Biology Sachs MS, Marzluf GA, Paulsen I, Davis R, Ebbole DJ, Zelter A, 23: 18–33. Kalkman ER, O’Rourke R, Bowring F, Yeadon J, Ishii C, Suzuki K, Landeweert R, Hoffland E, Finlay RD, Kuyper TW, van Breemen N. 2001. Sakai W, Pratt R. 2004. Lessons from the genome sequence of Neurospora Linking plants to rocks: ectomycorrhizal fungi mobilize nutrients from crassa: tracing the path from genomic blueprint to multicellular organism. minerals. Trends in Ecology and Evolution 16: 248–254. Microbiology and Molecular Biology Reviews 68: 1–108. Letondal C. 2001. A Web interface generator for molecular biology Chalot M, Javelle A, Blaudez D, Lambilliotte R, Cooke R, Sentenac H, programs in Unix. Bioinformatics 17: 73–82. Wipf D, Botton B. 2002. An update on nutrient transport process in Lobreaux S, Massenet O, Briat JF. 1992. Iron induces ferritin synthesis in ectomycorrhizas. Plant and Soil 244: 165–175. maize plantlets. Plant Molecular Biology 19: 563–575. Combier JP, Melayah D, Raffier C, Gay G, Marmeisse R. 2003. Maldonado-Mendoza IE, Dewbre GR, Harrison MJ. 2001. A phosphate Agrobacterium tumefaciens-mediated transformation as a tool for transporter gene from the extra-radical mycelium of an arbuscular insertional mutagenesis in the symbiotic ectomycorrhizal fungus mycorrhizal fungus Glomus intraradices is regulated in response to Hebeloma cylindrosporum. FEMS Microbiology Letters 220: 141–148. phosphate in the environment. Molecular Plant–Microbe Interactions 14: Debaud JC, Gay G. 1987. In vitro fruiting under controlled conditions of 1140–1148. the ectomycorrhizal fungus Hebeloma cylindrosporum associated with Pinus Mankel A, Krause K, Kothe E. 2002. Identification of a hydrophobin pinaster. New Phytologist 105: 429–435. gene that is developmentally regulated in the ectomycorrhizal fungus Debaud JC, Marmeisse R, Gay G. 1997. Genetics and molecular biology of Tricholoma terreum. Applied and Environmental Microbiology 68: the fungal partner in the ectomycorrhizal symbiosis Hebeloma 1408–1413. cylindrosporum × Pinus pinaster. In: Carroll GC, Tudzynski P, eds. The Marschner H, Dell B. 1994. Nutrient uptake in mycorrhizal symbiosis. Mycota V, part B. Berlin, Germany: Springer-Verlag, 95–115. Plant and Soil 159: 89–102. Ewing B, Hillier L, Wendl MC, Green P. 1998. Base-calling of automated Martin F, Duplessis S, Ditengou F, Lagrange H, Voiblet C, Lapeyrie F. sequencer traces using phred. I. Accuracy assessment. Genome Research 8: 2001. Developmental cross talking in the ectomycorrhizal symbiosis: 175–185. signals and communication genes. New Phytologist 151: 145–154. Galagan JE, Calvo SE, Borkovich KA, Selker EU, Read ND, Jaffe D, Martin F, Tuskan GA, DiFazio SP, Lammers P, Newcombe G, Podila GK. FitzHugh W, Ma LJ, Smirnov S, Purcell S, Rehman B, Elkins T, 2004. Symbiotic sequencing for the Populus mesocosm. New Phytologist Engels R, Wang S, Nielsen CB, Butler J, Endrizzi M, Qui D, Ianakiev P, 161: 330–335. Bell-Pedersen D, Nelson MA, Werner-Washburne M, Selitrennikoff CP, Martinez D, Larrondo LF, Putnam N, Gelpke MD, Huang K, Chapman J, Kinsey JA, Braun EL, Zelter A, Schulte U, Kothe GO, Jedd G, Mewes W, Helfenbein KG, Ramaiya P, Detter JC, Larimer F, Coutinho PM, Staben C, Marcotte E, Greenberg D, Roy A, Foley K, Naylor J, Henrissat B, Berka R, Cullen D, Rokhsar D. 2004. Genome sequence of Stange-Thomann N, Barrett R, Gnerre S, Kamal M, Kamvysselis M, the lignocellulose-degrading fungus Phanerochaete chrysosporium strain Mauceli E, Bielke C, Rudd S, Frishman D, Krystofova S, Rasmussen C, RP78. Nature Biotechnology 22: 695–700. Metzenberg RL, Perkins DD, Kroken S, Cogoni C, Macino G, Minet M, Dufour ME, Lacroute F. 1992. Complementation of Catcheside D, Li W, Pratt RJ, Osmani SA, DeSouza CP, Glass L, Saccharomyces cerevisiae auxotrophic mutants by Arabidopsis thaliana Orbach MJ, Berglund JA, Voelker R, Yarden O, Plamann M, Seiler S, cDNAs. Plant Journal 2: 417–422. Dunlap J, Radford A, Aramayo R, Natvig DO, Alex LA, Mannhaupt G, Montanini B, Moretto N, Soragni E, Percudani R, Ottonello S. 2002. Ebbole DJ, Freitag M, Paulsen I, Sachs MS, Lander ES, Nusbaum C, A high-affinity ammonium transporter from the mycorrhizal ascomycete Birren B. 2003. The genome sequence of the filamentous fungus Tuber borchii. Fungal Genetics and Biology 36: 22–34. Neurospora crassa. Nature 422: 859–868. Morizet J, Mingeau M. 1976. Influence des facteurs du milieu sur Gay G, Marmeisse R, Fouillet P, Bouletreau M, Debaud JC. 1993. l’absorption hydrique (étude effectuée sur tomate décapitée en exudation). Genotype/nutrition interactions in the ectomycorrhizal fungus Hebeloma I. Facteurs nutritionnels. Annales Agronomiques 27: 183–205. cylindrosporum Romagnesi. New Phytologist 123: 335–343. Nehls U, Wiese J, Guttenberger M, Hampp R. 1998. Carbon allocation in Giltrap NJ. 1982. Hebeloma spp. as mycorrhizal associates of birch. ectomycorrhizas: Identification and expression analysis of an Amanita Transactions of the British Mycological Society 79: 157–160. muscaria monosaccharide transporter. Molecular Plant–Microbe Glemet E, Codani JJ. 1997. , a LArge Scale Sequence compArison Interactions 11: 167–176. Package. Computer Applied Bioscience 13: 137–143. Nehls U, Kleber R, Wiese J, Hampp R. 1999. Isolation and characterization Harrison MJ, van Buuren ML. 1995. A phosphate transporter from the of a general amino acid permease from the ectomycorrhizal fungus mycorrhizal fungus Glomus versiforme. Nature 378: 626–629. Amanita muscaria. New Phytologist 144: 343–349.

New Phytologist (2004) 164: 505–513 www.newphytologist.org © New Phytologist (2004) 68 Research 513

Paulsen IT, Sliwinski MK, Nelissen B, Goffeau A, Saier MH Jr. 1998. cDNA clones from Eucalyptus globulus-Pisolithus tinctorius Unified inventory of established and putative transporters encoded within ectomycorrhiza. Molecular Plant–Microbe Interactions 8: 781–783. the complete genome of Saccharomyces cerevisiae. FEBS Letters 430: 116– Tagu D, Nasse B, Martin F. 1996. Cloning and characterization of 125. hydrophobins-encoding cDNAs from the ectomycorrhizal basidiomycete Peter M, Courty PE, Kohler A, Delaruelle C, Martin D, Tagu D, Frey-Klett P, Pisolithus tinctorius. Gene 168: 93–97. Duplessis S, Chalot M, Podila GK, Martin F. 2003. Analysis of expressed Taylor TN, Remy W, Hass H, Kerp H. 1995. Fossil arbuscular mycorrhizae sequence tags from the ectomycorrhizal basidiomycetes Laccaria bicolor from the early Devonian. Mycologia 87: 560–573. and Pisolithus microcarpus. New Phytologist 159: 117–129. Thomas BJ, Rothstein R. 1989. Elevated recombination rates in Samson D, Legeai F, Karsenty E, Reboux S, Veyrieras JB, Just J, transcriptionally active DNA. Cell 56: 619–630. Barillot E. 2003. GenoPlante-Info (GPI): a collection of databases and Tschumper G, Carbon J. 1980. Sequence of a yeast DNA fragment bioinformatics resources for plant genomics. Nucleic Acids Research 31: containing a chromosomal replicator and the TRP1 gene. Gene 10: 179–182. 157–166. Schechtman MG, Yanofsky C. 1983. Structure of the trifunctional trp-1 Vinogradov AE. 2003. Isochores and tissue-specificity. Nucleic Acids Research gene from Neurospora crassa and its aberrant expression in Escherichia coli. 31: 5212–5220. Journal of Molecular Applied Genetics 2: 83–99. Voiblet C, Duplessis S, Encelot N, Martin F. 2001. Identification of Scheromm P, Plassard C, Salsac L. 1990. Effect of nitrate and ammonium symbiosis-regulated genes in Eucalyptus globulus-Pisolithus tinctorius nutrition on the metabolism of the ectomycorrhizal basidiomycete, ectomycorrhiza by differential hybridization of arrayed cDNAs. Plant Hebeloma cylindrosporum Romagn. New Phytologist 114: 227–234. Journal 25: 181–191. Schiestl RH, Gietz RD. 1989. High efficiency transformation of intact yeast Wessels J, de Vries O, Asgeirsdottir SA, Schuren F. 1991. Hydrophobin cells using single stranded nucleic acids as a carrier. Current Genetics 16: genes involved in formation of aerial hyphae and fruit bodies in 339–346. Schizophyllum. Plant Cell 3: 793–799. Simon L, Bousquet J, Levesque RC, Lalonde M. 1993. Origin and Wipf D, Benjdia M, Rikirsch E, Zimmermann S, Tegeder M, Frommer WB. diversification of endomycorrhizal fungi and coincidence with vascular 2003. An expression cDNA library for suppression cloning in yeast land plants. Nature 363: 67–69. mutants, complementation of a yeast his4 mutant, and EST analysis from Smith SE, Read DJ. 1997. Mycorrhizal symbiosis. San Diego, CA, USA: the symbiotic basidiomycete Hebeloma cylindrosporum. Genome 46: 177– Academic Press. 181. Stotz A, Linder P. 1990. The ADE2 gene from Saccharomyces cerevisiae: Wipf D, Benjdia M, Tegeder M, Frommer WB. 2002. Characterization of sequence and new vectors. Gene 95: 91–98. a general amino acid permease from Hebeloma cylindrosporum. FEBS Tagu D, Martin F. 1995. Expressed sequence tags of randomly selected Letters 528: 119–124.

About New Phytologist

Identification d'un canal potassique de la famille Shaker

chez Hebeloma cylindrosporum

La mycorhization améliore la nutrition potassique de l'arbre (Harley & Smith, 1983). L'utilisation de 86Rb+ comme traceur de K+ a révélé que la capacité de transport de cet ion, rapportée au poids de matière sèche des tissus, est au moins 10 fois plus élevée chez Hebeloma crustuliniforme que chez 3 espèces de conifères différentes formant des ectomycorhizes avec ce champignon. Le flux de (86Rb+)K+ est 2 à 3 fois plus élevé dans les racines mycorhizées que dans les racines non mycorhizées (Rygiewicz & Bledsoe, 1984). Des études in vitro effectuées avec deux champignons ectomycorhiziens, ont montré que les hyphes ont la capacité d'altérer les micas et de "libérer" les ions K+ neutralisant les silicates du réseau cristallin minéral (Paris et al., 1995; Jongmans et al., 1997). Ce phénomène est accentué par une carence en K+ (et en Mg2+). L'altération serait provoquée par l'excrétion de H+ (qui se traduit par une acidification de la surface des minéraux) et d'oxalate (qui favoriserait la dégradation des minéraux en chélatant les ions aluminium présents dans les réseaux cristallins) (Paris et al., 1995). Ce chapitre présente le travail réalisé pour caractériser un gène de canal potassique identifié par la ressource EST que nous avons produite. En introduction à la partie expérimentale, le paragraphe Eléments bibliographiques ci-dessous résume les données disponibles concernant les rôles que l'ion K+ joue dans la cellule et les mécanismes de transport membranaire de cet ion chez les plantes et les champignons.

4.1. Eléments bibliographiques

4.1.1. Rôles du potassium dans la cellule

Chez tous les organismes, la charge électrique nette des acides nucléiques, protéines et lipides est globalement négative au pH du cytoplasme. La neutralité électrique est assurée par l'accumulation de K+ dans le cytoplasme à une concentration voisine de 100 mM. La sélection par l'évolution d'une accumulation préférentielle de K+ par rapport à Na+ tient

71 probablement au fait que Na+ est plus chaotropique et donc moins apte que K+ à maintenir la configuration native des macromolécules (Eisenman, 1961; Clarkson & Hanson, 1980). D'autre part, il est probable que l'accumulation de potassium et l'exclusion de sodium ont représenté, chez les premiers organismes vivants dans l'eau de mer, le moyen le plus direct permettant d'énergiser la membrane cellulaire, par la création de différences de potentiels électrochimiques de Na+ et K+ par rapport au milieu extérieur. En liaison avec le fait qu'il constitue l'ion inorganique le plus abondant dans le cytoplasme, le potassium est impliqué dans plusieurs grandes fonctions. Au niveau cellulaire, il participe à la neutralisation de la charge électrique nette des bio-molécules, à la polarisation électrique de la cellule (la conductance potassique est généralement la composante dominante de la conductance membranaire), et au contrôle du potentiel osmotique (Clarkson & Hanson, 1980). En liaison avec cette dernière fonction chez les végétaux, K+ est impliqué dans le contrôle des mouvements d'eau, de la pression de turgescence, dans l'élongation cellulaire, et dans les fonctions connexes au niveau de la plante entière (e.g. ouverture des stomates, nasties).

4.1.2. Les systèmes de transport de K+ chez les plantes et chez les champignons: données cinétiques et électrophysiologiques La concentration de K+ dans la solution du sol est en général comprise entre quelques dizaines de µmol.L-1 et quelques mmol.L-1 (Barber, 1984). Les plantes et les champignons du sol possèdent des systèmes de transport, canaux ou transporteurs*, leur permettant de se développer sur une gamme étendue de concentration de K+, allant de 10-6 à 10-1 mol.L-1 (Kochian & Lucas, 1988; Maathuis & Sanders, 1996).

4.1.2.1. Données chez les plantes Au niveau cinétique, les isothermes décrivant l'effet de la concentration sur la vitesse d'absorption présentent une allure complexe, qui peut cependant être analysée selon le formalisme de Michaelis-Menten, à condition d'imaginer l'intervention de deux systèmes + différant par leur affinité pour K : un système à forte affinité (faible KM, de l'ordre de -1 -1 10 µmol.L ), relayé par un système à faible affinité (KM de l'ordre de 1 à 10 mmol.L )

* La distinction entre canal et transporteur (terme anglais consacré par l'usage : "carrier") repose sur des critères mécanistiques et cinétiques. Un canal passe d'un état "fermé" à un état "ouvert" par un changement conformationnel (facilité par une variation du potentiel électrique transmembranaire ou la fixation d'un ligand par exemple). Une fois ouvert, le canal conduit un flux d'ions sans passer par un nouveau changement conformationnel à chaque fois qu'un ion le traverse. Au contraire, un transporteur subit un cycle de changement conformationnels à chaque substrat fixé sur une face de la membrane et transporté vers l'autre face. Cette différence au niveau des mécanismes fait que le flux d'ions conduit par un canal (ca. 106 ions par seconde) est bien plus élevé que celui conduit par un transporteur (ca. 102-103 ions par seconde) (Stein, 1990). L'expression "système de transport" désigne de façon générique les canaux, transporteurs et pompes.

72 (Epstein et al., 1963). L'analyse thermodynamique a conduit à conclure que le système à forte affinité catalyse un transport actif (i.e. contre le gradient de potentiel électrochimique de K+) alors que le système à faible affinité catalyse un transport passif (Kochian & Lucas, 1988; Maathuis & Sanders, 1996). Le transport à haute affinité du potassium pour des concentrations de l'ordre de la dizaine de µmol.L-1 serait directement couplé au transport de protons via un symport H+:K+ (Maathuis & Sanders, 1994). L'analyse des isothermes et des données pharmacologiques suggèrent que le transport à faible affinité est dû à des canaux (Kochian & Lucas, 1988; Schroeder et al., 1994). Il faut noter cependant que des données moléculaires publiées récemment suggèrent que la distinction entre transport à forte affinité et transport à faible affinité ne reflète pas l'intervention de systèmes de transport et de mécanismes de couplage énergétique différents (e.g. co-transporteurs et canaux). Par exemple, l'inactivation chez Arabidopsis (mutant knock-out) du gène codant + le canal AKT1 provoque, en présence de NH4 dans la solution nutritive, une perte de la capacité de transport de K+ à forte affinité de la racine, suggérant que ce canal serait impliqué dans l'absorption de K+ même à partir de solution très diluées (10 µM) (Hirsch et al., 1998). Cela signifie probablement que le potentiel de membrane est plus négatif, en présence de faible concentrations en K+, que ce qui est estimé par les techniques d'électrophysiologie. Autrement dit, l'hypothèse classique que le transport de K+ "à forte affinité", dans la gamme de concentrations 10-100 µM, est actif et dû à l'activité de co-transporteurs, pourrait traduire essentiellement une sous-estimation du potentiel de membrane par les techniques de l'électrophysiologie endocellulaire (voir à ce propos la revue publiée par Schroeder et al. en 1994). Dans le même ordre d'idées, un transporteur de K+ identifié chez Arabidopsis semble doté d'une capacité de transport à la fois dans le domaine des faibles et des fortes concentrations (i.e. cinétique biphasique: Fu & Luan, 1998; Kim et al., 1998).

4.1.2.2. Données chez les levures et champignons filamenteux Les analyses cinétiques du transport de K+ (86Rb+) chez Saccharomyces cerevisiae ou chez Neurospore crassa révèlent également une composante à forte affinité et une composante à faible affinité (Rodriguez-Navarro & Ramos, 1984; Rodriguez-Navarro et al., 1986). Chez la levure, ces deux composantes sont liées à l'expression des gènes TRK1 et TRK2 respectivement (Cf. ci-dessous). Il n'existe aucune analyse des contraintes thermodynamiques du transport de K+ chez la levure (les cellules sont trop petites pour que le potentiel de membrane puisse être mesuré à l'aide d'une électrode endo-cellulaire). Les mesures électrophysiologiques sur N. crassa révèlent que la (H+)ATPase membranaire peut maintenir le potentiel de membrane de ce champignon à une valeur très négative (ca. -240 mV en présence de K+ 10 µM, i.e. probablement plus négative que le potentiel d'équilibre de K+) (Slayman, 1965). Cela suggère que des canaux potassiques

73 pourraient être impliqués dans l'absorption de K+ chez Neurospora même dans le domaine des faibles concentrations (1-10 µM).

4.1.3. Les systèmes de transport de K+ chez les plantes et chez les champignons: données moléculaires

4.1.3.1. Les canaux potassiques Tous les canaux potassiques identifiés à ce jour, chez les animaux ou chez les végétaux, sont caractérisés par la présence d'un domaine très conservé, appelé P (pour Pore) ou H5. Ce domaine joue un rôle majeur dans la structuration du pore aqueux du canal et le contrôle de la sélectivité ionique. Le canal est une structure multimérique. Quatre domaines P s'assemblent pour former le pore (Doyle et al., 1998). Les différents canaux se distinguent par le nombre de domaines P présents par polypeptide (1 ou 2), et le nombre de segments transmembranaires (2, 4, 6 ou 8). Sur la base de ces critères, quatre types de structure secondaire peuvent être définis (Jan & Jan, 1997), définissant 4 familles appelées Shaker, TWIK, IRK et TOK. Les structures correspondantes sont présentées sur la Figure 4.1.

(1) Canaux identifiés chez les plantes. Les premiers canaux potassiques végétaux identifiés, KAT1 et AKT1 chez Arabidopsis, ont été clonés par complémentation fonctionnelle de mutants de levure défectifs pour le transport de K+ (gènes TRK1 et TRK2 inactivés) (Anderson et al., 1992; Sentenac et al., 1992). Ces deux canaux appartiennent à la famille Shaker (Cf. Figure 4.1A), caractérisée par la présence d'un domaine hydrophobe constitué de 6 segments transmembranaires S1 à S6 (S4 ayant une charge électrique nette positive), et d'un domaine P entre S5 et S6. En aval du domaine hydrophobe, les deux canaux présentent un site potentiel de fixation des nucléotides cycliques. AKT1 possède un domaine ankyrine (système d'interaction protéine-protéine) en aval du domaine de fixation des nucléotides cycliques (Zimmermann & Sentenac, 1999). Les programmes de séquençage systématique, mais aussi différentes stratégies de clonage (e.g. criblage à basse stringence, utilisation du système double hybride; Czempinski et al., 1999; Dreyer et al., 1999), ont ensuite révélé de nombreux autres canaux apparentés à AKT1 ou KAT1, chez Arabidopsis (la famille Shaker compte 9 membres chez cette espèce) et chez d'autres plantes comme la pomme de terre et la tomate (Pilot et al., 2003). Les caractéristiques fonctionnelles de certains de ces canaux ont été analysées via les techniques d'électrophysiologie (courants macroscopiques et "single channel") en système hétérologue. Il est important de noter que, dans ce domaine, il faut pouvoir disposer de plusieurs systèmes d'expression (ovocyte de xénope, cellule d'insecte, cellule de mammifère de type COS), parce que certains canaux s'expriment

74 A type Shaker B type TWIK S1 S6 M1 M4 P milieu P1 P2 + + + membrane + +

cytoplasme N C

C type IRK D type TOK M1 M2 P P1 P2

Figure 4.1. Structure secondaire des canaux potassiques. Tous les canaux K+ sont caractérisés par la présence d'un ou deux domaines membranaires appelés P, très conservés. Le canal fonctionnel est une structure multimérique, et 4 domaines P s'assemblent pour former le pore aqueux de la protéine. Quatre familles multigéniques de canaux sont distinguées. A: Canaux de type Shaker. Le premier canal de ce type a été cloné chez la drosophile. Chez la plante modèle Arabidopsis thaliana, la famille Shaker compte 9 gènes. Les canaux Shaker présentent six segments transmembranaires (classiquement appelés S1 à S6) et un domaine P (présent entre S5 et S6). Le domaine S4 possède plusieurs résidus chargés positivement (R ou K, symbolisés par les signes "+"). Ce domaine constitue le siège de la sensibilité au voltage du canal. B: Canaux de type TWIK (Two pore domain Weakly Inward rectifying K+ channel). Ces canaux (4 segments transmembranaires, M1 à M4, et 2 domaines P) ont été clonés initialement chez l'homme, puis chez les plantes. C: Canaux de type IRK (Inwardly Rectifying K+ channel). Ces canaux, initialement clonés chez les animaux représentent la structure la plus simple, avec deux segments transmembranaires (classiquement appelés M1 et M2) et un domaine P. Un seul canal de ce type est présent chez Arabidopsis. D: Canal de type TOK (Two pore Outward K+ channel). Le premier canal de ce type a été cloné chez Saccharomyces cerevisiae. Il présente 8 segments transmembranaires et 2 domaines P, évoquant la structure d'un canal de type Shaker (sans charge positive dans S4) en tandem avec un canal de type IRK. Récemment, un canal de ce type a été trouvé chez Neurospora crassa.

75 dans un système d'expression mais pas dans un autre. C'est, par exemple, le cas d'AKT1, qui a pu être caractérisé dans les cellules d'insecte (Gaymard et al., 1996) et dans la levure (Bertl et al., 1997) mais pas dans l'ovocyte de xénope. En résumé, l'ensemble des données électrophysiologiques disponibles indique que les canaux de type Shaker végétaux sont régulés par le voltage. Ils sont actifs sur la membrane plasmique. Certains (e.g., AKT1, KAT1, KAT2 et SPIK chez Arabidopsis) sont du type rectifiant entrant (activés par l'hyperpolarisation, autorisant de ce fait un influx de K+). D'autres (e.g., SKOR et GORK chez Arabidopsis; Gaymard et al., 1998; Ache et al., 2000; Hosy et al., 2003) sont du type rectifiant sortant (activés par la dépolarisation et autorisant un efflux de K+). Enfin, des canaux peu rectifiants, comme AKT2 chez Arabidopsis, laissent passer les ions potassiques dans les deux directions (Marten et al., 1999; Lacombe et al., 2000; Dreyer et al., 2001). La fonction de quelques canaux Shaker, en particulier AKT1, KAT1, SPIK, SKOR et GORK chez Arabidopsis, a pu être établie par des approches de type génétique inverse (Véry & Sentenac, 2003). AKT1 est exprimé dans les tissus périphériques de la racine, où il participe à la fonction de prélèvement de K+ à partir de la solution du sol (Hirsch et al., 1998). KAT1 est présent dans les cellules de garde, où il conduit l'influx de K+ qui permet l'ouverture des stomates (Ichida et al., 1997). SPIK est exprimé dans le tube pollinique en croissance, où il joue un rôle dans l'influx de K+ impliqué dans la régulation de la turgescence au cours de l'élongation du tube (Mouline et al., 2002). SKOR est exprimé dans les tissus stélaires de la racine et participe à la sécrétion de K+ dans la sève xylémique (Gaymard et al., 1998). GORK constitue le principal canal potassique sortant de la cellule de garde et joue un rôle important dans la fermeture des stomates et l'économie de l'eau par la plante (Becker et al., 2003; Hosy et al., 2003). Le gène KCO1 code un canal d'un type différent, présentant des homologies de structure et de séquence avec les canaux potassiques animaux de la famille TWIK (canaux à 4 segments transmembranaires et deux pores en tandem; Cf. Figure 4.1B; Lesage et al., 1996; Czempinski et al., 1997). L'expression du polypeptide correspondant dans des cellules d'insecte génère un courant potassique sortant activé par une augmentation de la concentration de Ca2+ dans le cytoplasme (Czempinski et al., 1997). En relation avec cette propriété, les analyses de séquences révèlent la présence dans le polypeptide KCO1 de deux motifs de type "EF-hand" potentiellement impliqués dans la fixation de Ca2+. De plus, la mobilité électrophorétique du polypeptide est affectée par la présence de Ca2+ (Czempinski et al., 1999). KCO1 appartient à une famille multigénique contenant 5 membres chez Arabidopsis (Czempinski et al., 1999). Des données récentes ont localisé le canal KCO1 sur le tonoplaste (Czempinski et al., 2002; Schönknecht et al., 2002). Un canal d'un nouveau type, apparenté aux canaux animaux de type IRK (Cf. Figure 4.1C; Kubo et al., 1993) à deux segments transmembranaires et un pore, est

76 également identifié chez Arabidopsis (KCO3; Czempinski et al., 1999). Ses caractéristiques fonctionnelles et sa localisation sont encore inconnues.

(2) Canaux identifiés chez les levures et champignons filamenteux. Le séquençage systématique du génome de S. cerevisiae a permis d'identifier le canal potassique TOK1 (Ketchum et al., 1995). Ce canal a défini une nouvelle famille, caractérisée par la présence de 8 segments transmembranaires et deux pores (Figure 4.1D). TOK1 est un canal rectifiant sortant dont le mode de régulation n'est pas encore clairement précisé et dont la fonction est inconnue. Récemment, un canal de ce type a été trouvé et caractérisé chez Neurospora crassa (Roberts, 2003). Aucun canal potassique n'a encore été cloné et caractérisé sur le plan fonctionnel chez les basidiomycètes.

4.1.3.2. Les transporteurs

(1) Transporteurs identifiés chez les plantes. Le premier gène susceptible de coder un transporteur de K+ végétal a été cloné chez le blé, par complémentation fonctionnelle d'une souche de levure mutante déficiente pour le transport de cet ion (Schachtman & Schroeder, 1994). Ce gène, appelé TaHKT1 (pour High affinity K+ Transporter) est exprimé préférentiellement dans le cortex racinaire et dans les cellules bordant les tissus vasculaires dans les feuilles. La première analyse des caractéristiques fonctionnelles de la protéine HKT1, après expression dans la levure et dans l'ovocyte de xénope, a conduit à l'identifier comme un système de transport à haute affinité catalysant un symport H+:K+ (Schachtman & Schroeder, 1994). Cependant, les études ultérieures, conduites également dans la levure et dans l'ovocyte de xénope, ont suggéré une activité de symport Na+:K+ (Rubio et al., 1995; Gassmann et al., 1996). La signification d'un tel mécanisme de couplage n'est pas claire puisque la présence de Na+ dans le milieu n'est pas indispensable à l'absorption active de K+ par la racine (Rubio et al., 1995; Walker et al., 1996). Un homologue de TaHKT1 a été cloné chez Arabidopsis et appelé AtHKT1 (Uozomi et al., 2000). Ce système s'est révélé, de façon surprenante, comme très peu perméable à K+ mais très perméable à Na+. Il est exprimé dans le phloème, dans les organes sources ou puits. Sa disruption affecte la résistance de la plante au sel (Mäser et al., 2002; Berthomieu et al., 2003). Dans leur ensemble, les données obtenues suggèrent qu'AtHKT1 joue un rôle dans la recirculation ("redirection") de Na+ des parties aériennes vers les racines, évitant ainsi une suraccumulation toxique de sodium dans les feuilles (Berthomieu et al., 2003). Une seconde famille de transporteur de K+ chez les plantes a été révélée initialement à partir de l'observation de similarités de séquences entre les transporteurs de K+ Kup d'Escherichia coli et HAK de la levure Schwanniomyces occidentalis (ci-dessous). Ces

77 similarités ont ensuite permis le clonage du système de transport de potassium HvHAK1 chez l'orge (12 segments transmembranaires potentiels) (Santa-Maria et al., 1997). L'expression de ce système dans une souche de levure déficiente pour le transport de K+ restaure l'absorption de cet ion, avec des caractéristiques cinétiques similaires à celles du mécanisme de transport à haute affinité décrit chez l'orge. L'analyse des banques de données a ensuite conduit au repérage d'une famille multigénique de systèmes homologues de HvHAK1 chez Arabidopsis (Quintero & Blatt, 1997; Fu & Luan, 1998; Kim et al., 1998), qui ont été appelés de façon générique AtKUP# (12 segments transmembranaires potentiels). La sur-expression d'AtKUP1 dans des cellules d'Arabidopsis isolées (cultivées en suspension) se traduit par une forte augmentation de la capacité de transport de K+ à haute affinité, mais aussi par une augmentation de la capacité de transport à faible affinité (Kim et al., 1998). De même, exprimé dans la levure, AtKUP1 transporte K+ selon une cinétique complexe, présentant à la fois une composante dans le domaine des faibles concentrations et une composante dans le domaine des fortes concentrations (Fu & Luan, 1998).

(2) Transporteurs identifiés chez les levures et champignons filamenteux. Deux gènes impliqués dans le transport de K+ ont été identifiés chez Saccharomyces cerevisiae. Ce sont TRK1 (Gaber et al., 1988) et TRK2 (Ko & Gaber, 1991). Le premier est nécessaire au développement du transport à forte affinité et le second au développement du transport à faible affinité. Les deux protéines (4 répétitions d'un motif MPM, formé d'un premier segment transmembranaire, suivi d'un pore, suivi d'un second segment transmembranaire; Durell & Guy, 1999) partagent 55% d'identité. Des similarités de séquences sont également détectées avec les gènes de la famille HKT (Schachtman & Schroeder, 1994). Des homologues de ScTRK1 et ScTRK2 ont été clonés chez d'autres levures. Les analyses électrophysiologiques sur protoplaste de levure suggèrent que le système SpTRK (homologue de TRK1 chez la levure Schizosaccharomyces pombe) fonctionne comme un symport H+:K+ (Lichtenberg-Fraté et al., 1996). La complémentation fonctionnelle d'un mutant (trk1, trk2) de S. cerevisiae par une banque d'ADNc de la levure Schwanniomyces occidentalis a conduit à l'identification d'un système de transport de K+ d'un nouveau type, appelé HAK (Banuelos et al., 1995). Ce système (85 kDa, 12 segments transmembranaires potentiels) présente des homologies de séquence avec les systèmes de transport Kup bactériens (Cf. ci-dessus). Des homologues de HAK ont été récemment identifiés chez Arabidopsis (Cf. ci-dessus) et appelés AtKUP. Il est intéressant de noter que le programme de séquençage systématique du génome de Neurospora crassa vient de révéler la présence d'un gène homologue des AtKUP d'Arabidopsis thaliana. Nous avons identifié dans la ressource d'étiquettes d'Hebeloma un homologue des TRK de levure, que nous avons appelé HcTRK. Une opération de recherche conduite

78 dans l'équipe (Claire Corratgé et Sabine Zimmermann) vise à déterminer le rôle de ce système. Les premiers essais de caractérisation électrophysiologique après expression dans l'ovocyte de xénope se sont révélés positifs. Les résultats obtenus suggèrent qu'HcTRK est perméable à la fois à K+ et Na+.

4.2. Résultats

4.2.1. Identification d'une étiquette codant un canal potassique de la famille Shaker L'analyse (effectuée par Blastx contre la base de données protéique non redondante (NR); ftp://ftp.ncbi.nih.gov/blast/db/) de la banque d'étiquettes d'Hebeloma révèle une séquence susceptible d'identifier un gène codant un canal potassique de la famille Shaker (Lambilliotte et al., 2004). Les similarités avec des membres de la famille Shaker effectivement caractérisés comme des canaux sont cependant relativement faibles. Les similarités les plus fortes sont trouvées avec les canaux animaux, et en particulier avec le canal Shaker de la sous-famille Shab chez Aplysia sp. (Quattrocki et al., 1994). Le niveau de similarité avec ce dernier canal est caractérisé par une E_value* de 0,002 et un score de 47. Aucune similarité n’est trouvée avec les canaux végétaux de la famille Shaker. Le séquençage de l'ADNc correspondant à cette étiquette confirme l'appartenance de cette séquence à la famille Shaker. Cet ADNc initial est appelé HcSKCi, pour Hebeloma cylindrosporum Shaker K+ Channel initial. Le niveau de similarité avec le canal d'Aplysia sp. devient très significatif, avec une E_value de 1e-25. Le niveau de similarité le plus important (caractérisé par une E_value de 1e-29 et un score de 130) est trouvé avec le canal Kv2.1 de la sous-famille Shab de xénope (Burger & Ribera, 1996). Depuis juillet 2004 la plus forte similarité est trouvée dans NR avec une séquence polypeptidique déduite de l’annotation in silico du séquençage du génome de Cryptococcus neoformans, avec une E_value de 1e-91 et un score de 338. Les polypeptides codés par les gènes de la famille Shaker sont caractérisés par la présence d'un domaine hydrophobe constitué de 6 segments transmembranaires, appelés S1 à S6, qui forment le canal sensu stricto. Le segment S4 présente des résidus positifs (R et K) qui lui confèrent la possibilité de percevoir des variations du champ électrique transmembranaire et de se comporter comme un "senseur de voltage". Ses mouvements dans la membrane, en réponse aux variations du champ électrique, provoquent les changements conformationnels qui ouvrent ou ferment le canal. Le pore aqueux du canal

* Le résultat du programme Blast associe deux paramètres aux alignements locaux obtenus: le score et la E_value. Le score est défini comme la somme des scores élémentaires calculés (à partir d'une matrice de substitution, e.g. blosum62) sur chacune des positions de l'alignement en vis à vis. La E_value est une évaluation de la confiance que l'on peut avoir sur la pertinence de l'alignement obtenu. Il s'agit d'une valeur statistique déterminée à partir du score (plus cette valeur est proche de 0, plus le résultat à de chance d'avoir une signification biologique).

79 A

1 GAACTTTCAAGACTCAGGCGACCGCCCCCGCTTTCGCTGCGCTTTTTTACTGAAGAACGC 60 1ELSRLRRPPPLSLRFFTEER20

61 CCACCACAATCTCCCAATGACAATAACGACTCATTTCCTGTGTCGGCGTCGTACGAAGAC 120 21PPQSPNDNNDSFPVSASYED40

121 GAGTCGATCGCCTTACATCCACTATGGAAACGCCAGCTTTTCAAGCTCATGGAGCAGCCT 180 41ESIALHPLWKRQLFKLM EQP 60

181 ACCTCGTCAAATTCGGCGTTCGTGATACAGATGTTCTCGACATTTCTTATTGTCTTCTCG 240 61TSSNSAFVIQMFSTFLIVFS80 S1

241 GCGCTCGTTACGGTACTTGAAACAGTTCCAGCTGTTCATTCAATATCGACGAGGGTTTGG 300 81ALVTVLETVPAVHSISTRVW100

301 TTCGGGGTGGAGACGAGTGTGGTTGCATTGTTTACGGTGGAATATATTGCGCGATGTCTT 360 101FGVETSVVALFTVEYIARCL120 S2

361 GCATGGAGTACGACATGGATGAGCCTTTTCCGATGGATGATTTCTTTCTACGGAGTCATC 420 121AWSTTWMSLFRWMISFYGVI 140

421 GATCTTTTGTCAGTGCTGCCGTACTATCTGGAGTTGATGTTCTTACAAGATACATCAGTT 480 141DLLSVLPYYLELMFLQDTSV160 S3

481 TACTTCAGATTCTCTATTCTTCGAATGTTTCGTCTCCTGCGGGTATTTCGGCCATTCCGT 540 161YFRFSILRMFRLLRVFRPFR180 S4

541 TACAACCACACAATTCTCCTCACGATGGAGGTCATGTACCTCTCAGTACGCCGTTCACAA 600 181YNHTILLTMEVMYLSVRRSQ200

601 CACGCCCTACTTGCCATTGGATTCTTCGTCATGATGATCCTCACCGTGTTCAGCACGTTA 660 201HALLAIGFFVMMILTVFSTL220 S5

661 TTGTATTTTGCAGAAAGAGGAACGTGGGACGAGTTGCTGGGTACCTTCATCAATGCGGAT 720 221LYFAERGTWDELLGTFINAD240

721 GGTGACCCTACACAGTTTTCATCCATTCCTGCTGCGGCTTGGTTCGTCCTCGTCACGATC 780 241GDPTQFSSIPAAAWFVLVTI260 pore

781 ACGACCGTCGGATACGGAGAAATTACACCGCGATCCTTTCTCGGTCGACTCATCACGCTG 840 261TTVGYGEITPRSFLGRLITL 280

841 CCCATCCTTGTGTTCGGGCTCCTCTTAATTACACTGCCGAGTTTCGTCCTTGGGCGCGAA 900 281PILVFGLLLITLPSFVLGRE300 S6

901 TTTAGTCACGTTTGGGAGAAAATGAATTCGGATCGGAAGGAGGGAGAAGATGCAGGTGCT 960 301FSHVWEKMNSDRKEGEDAGA320

961 GGCGGTGAAGGAGGAAGTCGCAGCCCTACAGGGATGCCGAGTGCATCCGCAGGGAGATCA 1020 321GGEGGSRSPTGMPSASAGRS340

1021 GCTCGACCTCCACGCTCCTCGCGAATATCACGCTCTGGGGAGGATACCGAGGATCCTTAT 1080 341ARPPRSSRISRSGEDTEDPY360

80 1081 GGGCCTTCATCGTTTTATTACTCCCCCGCTGGCTATTCGTCTCGCAGGCCAGATTGGGAA 1140 361GPSSFYYSPAGYSSRRPDWE380

1141 AGGCCGTTTGGTGGTGTGGCAGCTGCGAGGGACTTGACTAACTTGAAGTTGGCGCAAAAC 1200 381RPFGGVAAARDLTNLKLAQN400

1201 CAAACGGAGCTGAGTAGACAGATAGAGGAGTTGGCCGGGACGGTCGAGGTCCAAGGGAGG 1260 401QTELSRQIEELAGTVEVQGR420

1261 TTGTTGAGGAGATTGTTGGAGAAACTAGATTCTTCGACGAGTGATGTGGGGTTGTTAGAT 1320 421LLRRLLEKLDSSTSDVGLLD440

1321 TCGAAGGTAGCTGGAGAAGCTAGCTAACCTTAGGGTTGGGGATCTTTTTTTTATATTTAT 1380 441SKVAGEAS*

1381 GGAGACAATGGGATATCGCTAGGATTTTGTAATGGTATCTTTGGAGGGGCGAATATAAAT 1440

1441 AATACCTACC 1450

B S1 S2 S3 S4 S5 S6 Pore

Figure 4.2. Séquences nucléique et protéique déduite de l'ADNc initial du canal Shaker identifié par l'étiquette 009A07. A: La séquence qui correspond à l’étiquette initiale est soulignée en pointillés. Les segments transmembranaires sont soulignés et numérotés de S1 à S6, la région correspondant au pore est indiquée par un double soulignement (identifiés sur la base du profil d’hydrophobicité et des similarités avec les canaux animaux). La première méthionine en phase est indiquée en caractère gras. La caractérisation d'un clone génomique et des expériences de RACE-PCR ultérieures identifient un codon ATG en phase avec la séquence codante de cet ADNc partiel, 21 nucléotides en amont de son premier résidu (Cf. Figure 4.12A). B: Profil d’hydrophobicité de la séquence polypeptidique déduite obtenue en utilisant l’algorithme de Kyte et Doolittle avec une fenêtre de 11 acides aminés (progamme DNAstrider 1.4).

81 est structuré par un domaine appelé P, présent entre S5 et S6, à l'intérieur duquel la séquence G-Y-G-[DE] constitue la marque d'un canal sélectif de K+. La séquence de l'ADNc HcSKCi est présenté sur la Figure 4.2A. La région soulignée en pointillés correspond à l'étiquette initiale dont la séquence polypeptidique déduite présente seulement les deux premiers domaines transmembranaires. Les autres domaines transmembranaires (ainsi que le domaine P) sont présents dans l'ADNc. Le profil d'hydrophobicité présenté sur la Figure 4.2B indique la localisation des domaines transmembranaires sur la séquence polypeptidique déduite. La Figure 4.3 présente l'alignement global de la séquence polypeptidique déduite de l'ADNc avec celle du canal Shaker Kv2.1 de xénope. La zone de forte similarité concerne la région transmembranaire du polypeptide. Les extrémités N et C terminales ne s’alignent que très ponctuellement, et de façon non significative.

4.2.2. Relations phylogénétiques du canal au sein de la superfamille Shaker

La Figure 4.4 présente une analyse des relations phylogénétiques entre le canal Shaker identifié chez l'hébélome (déduit de la séquence de l'ADNc HcSKCi) et différents canaux Shaker animaux, végétaux ou bactériens. L’alignement est réalisé sur la région identifiée comme un domaine de transport d’ion, qui correspond approximativement à la région transmembranaire des canaux à 6 domaines transmembranaires avec un pore. Les deux canaux fongiques sont très nettement isolés et l’embranchement de ce groupe se situe au niveau des sous-familles Shaker, Shab, Shal et Shaw identifiées chez les animaux. La relation phylogénétique avec les canaux végétaux est plus distante.

4.2.3. Le génome de la souche h1 d'Hebeloma présente plusieurs copies du gène HcSKC L'ADN génomique des souches monocaryotiques h1 et h7 est extrait, digéré par 10 enzymes de restriction différentes et hybridé avec une sonde radioactive préparée à partir de l'ADNc initial HcSKCi de façon à déterminer, par Southern blot, le nombre de copies du gène HcSKC que ces génomes contiennent. L'autoradiogramme correspondant est présenté sur la Figure 4.5. Les profils fournis par l'analyse des deux souches h1 et h7 sont très différents. Le profil observé dans le cas de la souche h7 est relativement simple et compatible avec l'hypothèse d'un gène présent sous la forme d'une copie unique. Par contre, le profil observé chez la souche h1 est complexe. Son analyse conduit à conclure à l'existence de plusieurs copies du gène HcSKC chez h1. Cette hypothèse est confirmée par l'analyse du génome de la souche dicaryotique D2, correspondant à la fusion des souches h1 et h7. Le profil observé pour D2 (non montré) correspond à la superposition des profils obtenus pour h1 et h7. L'examen des profils obtenus avec les différentes enzymes suggère que la souche h1 contient au minimum 3 copies du gène HcSKC.

82 HcSKC1 1 ------ELSRLRRPPPLSL XlKv2.1 1 MPGWMNKHGSRSTTSLPPDPMDIIRSKACSRRVKVNVGGLAHEVLWRTLDRLPRTRLGKL

HcSKC1 14 R------FFTEERP------PQSPNDNND XlKv2.1 61 RDCNTNECLMEICDDYNLEENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELD

HcSKC1 31 SFPVSASYEDESIALHPLWKR------QLFKLME XlKv2.1 121 YWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREKEGDEFDNTCCADKRKKLWDLLE

HcSKC1 59 QPTSSNSAFVIQMFSTFLIVFSALVTVLETVPAVHSISTR------VWFGVETSVVALF XlKv2.1 181 KPNSSVAAKILAIISILFIVLSTIALSLNTLPDLQAIDEFGQTTDNAQLAHVEAVCIAWF S1 S2

HcSKC1 112 TVEYIARCLAWSTTWMSLFRWMISFYGVIDLLSVLPYYLELMFLQDTSVYFRFS----IL XlKv2.1 241 TMEYLLRFLSSPNKWK----FFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVV S3

HcSKC1 168 RMFRLLRVFRPFRYNHTILLTMEVMYLSVRRSQHALLAIGFFVMMILTVFSTLLYFAERG XlKv2.1 297 QIFRIMRILRILKLARHSTG-LQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEK- S4 S5

HcSKC1 228 TWDELLGTFINADGDPTQFSSIPAAAWFVLVTITTVGYGEITPRSFLGRLITLPILVFGL XlKv2.1 355 ------DEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGV Pore S6

HcSKC1 288 LLITLPSFVLGREFSHVWEKMNSDRKEGE------XlKv2.1 403 LVIALPIPIIVNNFSEFYKEQKRQEKAVKRREALERAKRNGSIVSMNMKDAFARSVELMD

HcSKC1 317 ------DAGAGGEGGSRSPTGMP------SASAGRSARPPRSSRISRSGE--- XlKv2.1 463 VVVEKTDETSGRKDKVQDNHLSPSRWKWKKRTLSETSSNKSFDAKEQGSPEKTRSGSSPQ

HcSKC1 355 ------DTEDPYGPS------XlKv2.1 523 NLNVQQLEDIYNKMAKTQSQPILNSKDLNQPSKPAEELEMGSIPGPTVPMLATHREGFID

HcSKC1 364 ------SFYYSPAGYSSR------RPDWERPFGGVAA XlKv2.1 583 MRSMSSIDSFISCTAEFPESGRFSHSPLAILPYRMNVNSGQNTSHGYKESRVRPLSSDVS

HcSKC1 389 ARDLTNLKLAQNQTELSRQIEELAG-TVEVQGRLLRRLLEK------XlKv2.1 643 RESFTEVHPKTDLSRHATYILESPKTLVKVKNPLMLRSLKVNFLEGETSSLLPAPNVLSP

HcSKC1 429 ------L XlKv2.1 703 TSHRQEGPSNQDTSFIYEHSVQSPETSLYTTASARTPSKSPEKHMAIDFTFHDANVHKYI

HcSKC1 430 DSSTSDVGLLDSKVAGEAS------XlKv2.1 763 DADTDDEGQLLDGLDSSPSKELLGTMSPKYNITKSGHRTQRDNVHRGDKNHLEGAPFLSS

HcSKC1 ------XlKv2.1 823 SRYVGQNCIYATEGMTGRRQGNLETVKMENHISPQVHVLPGGGGGHSNKHNPSI

Figure 4.3. Alignement de la séquence polypeptidique déduite de l'ADNc initial HcSKCi avec le canal Shaker animal XlKv2.1. L'alignement est réalisé avec Clustalw (http://www.ebi.ac.uk/clustalw/index.html) puis mis en forme avec le logiciel Boxshade (http://www.ch.embnet.org/software/BOX_form.html). Les fonds noirs ou gris correspondent respectivement aux acides aminés identiques ou similaires. XlKv2.1 est un canal Shaker (de la sous-famille Shab) identifié chez Xenopus leavis (Burger & Ribera, 1996).

83 84 I I I V I H I I I I I I I d I R c I I o u a u in am gl c v in r v pn ac H B B E P H D P K S h1 h7h1 h7 h1 h7 h1 h7 h1 h7 h1 h7 h1 h7 h1 h7 h1 h7 h1 h7 Taille A (kb) 12 7 5 4 3

Taille B (kb) 12 7 5 4 3

Figure 4.5. Analyse par Southern blot du nombre de copies du gène HcSKC chez les souches h1 et h7 d'Hebeloma. Dix enzymes de restriction (indiquées en haut de la figure) sont utilisées. Après digestion, l'ADN génomique de h1 et h7 est déposé de façon alternative dans les puits. A: La membrane est hybridée avec la sonde complète HcSKC. B: Photo du gel d’agarose coloré au BEt avant transfert.

85 4 3 4 6

1 h h h h 1 - - - - 9 h 1 1 0 h 4 3 5 2 - 3 h h 2 - 3 1 h - - 5 5 5 5 3 R R 3 3 B 9 9 9 9 5

B 5 B 9 5 5 1 1 5 u u u u 9 . . 9 9 3 9 3

2 1 D D D D 6 M 6 r r 7 5 m c 3 0 6 8 9 0 7 5 4 1 i L L a Y S u a P 7 1 1 2 4 5 8 1 1 1 1 1 2 Y P P P 1 p p 1 1 1 1

L N N T T C M L L h h h h h h h h h h h h h L L L L h h h h h h h Taille Taille (kb) (kb)

12 12 7 7 5 5 4 4 3 3 2

2 86

Figure 4.6. L'analyse du nombre de copies du gène SKC par Southern blot chez 31 souches d'hébélome met en évidence un profil complexe chez l’homocaryon parental hp5 des souches h1 et h7. L'ADN génomique a été digéré par l'enzyme Kpn1. Deux gels différents sont utilisés pour analyser l'ADN des 31 souches d'hébélome (noms des souches indiqués au dessus des gels). Les souches hp7 et hp5 (Cf. gel de droite) sont les deux souches monocaryotiques parentales de la souche dicaryotique HC1 (non analysée) dont sont issues (après fructification et méiose) les souches monocaryotiques h1 à h20 (nom des souches écrit en bleu; h3, h6, h9 et h12 ne sont pas analysées). Onze souches monocaryotiques d'Hebeloma cylindrosporum issues d'individus différents (le nom de ces souches est écrit en noir) et 2 souches dicaryotiques correspondant à 2 espèces d'hébélome très proches d'Hebeloma cylindrosporum (H. edurum sinuosum et H. radicosum, souche LY63 BR30 et LY63 BR29, respectivement; noms écrits en gris) sont également analysées. L'analyse des autoradiogrammes indique que SKC est un gène monocopie sauf chez la souche monocaryotique parentale hp5 et les souches descendantes h1, h10, h11, h13, h15, h16, h18 et h19, qui présentent toutes le même profil d'hybridation complexe. L'ADN génomique d'hébélomes différents d'Hebeloma cylindrosporum ainsi que l'ADN génomique de souches d'Hebeloma cylindrosporum apparentées à h1 (i.e. descendant de la souche dicaryotique HC1) ou non apparentées à h1 est analysé afin de déterminer si la présence de plusieurs copies du gène SKC est une situation fréquente. Les autoradiogrammes correspondant à ces analyses sont présentés sur la Figure 4.6. Leur examen conduit à conclure que le gène SKC est normalement présent sous la forme d'une seule copie chez l'hébélome, et que la souche HC1 et certains de ses descendants dont h1 constituent des exceptions. D'autre part, parmi les 16 descendants de HC1 on observe uniquement les deux profils déjà décrits chez h1 et h7. De plus, la répartition de ces deux profils parmi ces 16 descendants est homogène, avec 8 descendants présentant un profil de type h1 et 8 descendants présentant un profil de type h7. En conclusion, l'ensemble de ces données indique que, parmi la population d'hébélomes explorée, l'existence de plusieurs copies du gène SKC traduit une relation à un ancêtre unique.

4.2.4. Identification de clones génomiques présentant une copie du gène HcSKC Une seule banque d'ADN génomique d'Hebeloma cylindrosporum est disponible à ce jour (Jargeat et al., 2000). Elle concerne la souche monocaryotique h1, qui présente plusieurs copies du gène HcSKC. Elle est construite dans le phage λGEM12 (Promega). La longueur moyenne des inserts est voisine de 14 kb. Après criblage d'une aliquote de la banque ayant généré 6.104 plages de lyses, susceptibles de représenter entre 10 et 50 fois la taille du génome d'Hebeloma (taille du génome estimée entre 20.106 et 70.106 paires de bases), une centaine de colonies positives sont identifiées. Onze de ces clones sont purifiés à l'homogénéité (à l'issue de deux étalements et criblages successifs). Des expériences de PCR, avec des amorces sens et antisens s'hybridant sur les extrémités de l'ADNc initial (SKC30Dir: 5'-gCTTTCgCTgCgCTTTTTTACTgAAg-3, SKC1400Rev: 5'-CCCTCCAAAgATACCATTAC AAAATCC-3') confirment la présence d'au moins une copie du gène SKC dans 10 de ces clones. Le séquençage et l'analyse in silico des produits d'amplification par PCR sur ces dix clones révèlent des différences qui ne peuvent être attribuées aux seules erreurs dans les processus d'amplification ou de séquençage. L'analyse de ces différences conduit à répartir les 10 clones en 4 sous-groupes, susceptibles de définir 4 copies différentes du gène HcSKC. Les noms des clones retenus pour représenter ces 4 copies sont Hc-h1-VIC, Hc-h1-VIB, Hc-h1-V1 et Hc-h1-II1. Des expériences de PCR, avec les amorces SKC30Dir et SKC1400Rev, effectuées sur l'ADN génomique de l'espèce Hebeloma edurum sinuosum et de la souche h7 d'Hebeloma cylindrosporum permettent d'amplifier des fragments d'ADN. Le séquençage de ces produits confirme qu'ils correspondent à la région ciblée du gène SKC chez

87 H. edurum sinuosum et h7. Un alignement multiple des séquences ainsi amplifiées chez H. edurum sinuosum et h7 et des séquences obtenues pour la région correspondante dans les clones Hc-h1-VIC, Hc-h1-VIB, Hc-h1-V1 et Hc-h1-II1 provenant de la souche h1, ainsi que de la région correspondante de l'ADNc initial, est présenté sur la Figure 4.7. L'analyse de l'alignement présenté sur la Figure 4.7 conduit aux conclusions suivantes: (1) La séquence de l'ADNc initial HcSKCi correspond à la séquence codante du clone génomique Hc-h1-II1. Cette copie du gène SKC est appelée HcSKC1 dans la suite du manuscrit. (2) Le niveau de conservation des séquences est très fort. Il n’y a pas de rupture de l'ORF dans la région étudiée. Des délétions ou insertions de nucléotides par rapport à la séquence de l'ADNc HcSKC1 sont présentes mais elles apparaissent toujours en nombre multiple de 3, contrairement aux délétions ou insertions observées dans les introns, qui ne sont pas systématiquement des multiples de 3. De plus, la majorité des mutations dans les régions codantes concerne le 3ème nucléotide des codons (261 des 316 mutations répertoriées). Enfin, une proportion importante de ces mutations sont silencieuses (mutations indiquées en bleu sur l'alignement; soit 246 sur 316 mutations observées). L'ensemble de ces observations suggère que les 4 copies du gène SKC identifiées par les clones Hc-h1-VIC, Hc-h1-VIB, Hc-h1-V1 et Hc-h1-II1 chez la souche h1 d'Hebeloma cylindrosporum sont fonctionnelles. (3) La position des introns est strictement conservée dans les 6 séquences génomiques alignées sur la Figure 4.7. Il est intéressant de noter que ces positions sont également conservées chez un autre basidiomycète supérieur, le coprin (Coprinopsis cinerea), dont le génome a été récemment séquencé (Cf. point (8) du paragraphe 4.2.7. et Figure 4.14). (4) La différence la plus facilement identifiable entre les 6 séquences génomiques identifiées concerne la taille du 5ème intron. Chez H. edurum sinuosum et la souche h7 d'H. cylindrosporum, cette taille est respectivement de 256 et 146 nt. Concernant les clones génomiques identifiés chez la souche h1, la taille est de 52 nt dans le clone Hc-h1-VIC, 157 nt dans le clone Hc-h1-VIB, et de 287 nt dans les deux clones Hc-h1-V1 et Hc-h1-II1. Des amplifications par PCR sur l’ADN génomique de h1 ciblant une région incluant le 5ème intron produisent des fragments d'amplification présentant 3 tailles différentes (après migration sur gel d’agarose; données non montrées). De plus, l'évaluation des différences de taille entre ces 3 fragments fournit des valeurs proches de 50, 150 et 290 nt. En conclusion, ces données indiquent que le génome de la souche h1 ne contient pas d'autre copie du gène SKC se distinguant par la longueur du 5ème intron que celles identifiées par les 4 clones Hc-h1-VIC, Hc-h1-VIB, Hc-h1-V1 et Hc-h1-II1.

88 He CCCAC---AATCCCCCAATGATAATAATGACCCATTTCCTGTGTCGGCTTCGTACGAAGACGAGTCGATCGCCTTACACCCACTATGGAA Hc-h7 CCCACCACAATCTCCCAATGACAATAACGACTCATTTCCTGTGTCGGCGTCGTACGAAGACGAGTCGATCGCCTTACATCCACTATGGAA Hc-h1-VIC CCCACCACAATCTCCCAATGACAATAACGACTCATTTCCTGTGTCGGCGTCGTACGAAGACGAGTCGATCACCTTACATCCACTATGGAA Hc-h1-VIB TCCACCACAATCTCCCAATGACAATAACGACTCATTTCCTGTGTCGGCGTCGTACGAAGACGAGTCGATCGCCCTACATCCACTATGGAA Hc-h1-V1 CCCACCACAATCTCCAAATGACAACAACGACTCATTTCCTGTGTCGGCGTCGTACGAAGACGAGTCGATCGCCTTACATCCACTATGGAA Hc-h1-II1 CCCACCACAATCTCCCAATGACAATAACGACTCATTTCCTGTGTCGGCGTCGTACGAAGACGAGTCGATCGCCTTACATCCACTATGGAA HcSKCi CCCACCACAATCTCCCAATGACAATAACGACTCATTTCCTGTGTCGGCGTCGTACGAAGACGAGTCGATCGCCTTACATCCACTATGGAA PPQSPNDNNDSFPVSASYEDESIALHPLWK

He ACGCCAGCTCTTCCAACTTATGGAACAGCCTACCTCGTCAAATTCGGCTTTCGTGATACAGATGTTCTCTACTTTTCTTATTGTCTTCTC Hc-h7 ACGCCAGCTTTTCAAGCTCATGGAGCAGCCTACCTCGTCAAATTCGGCGTTCGTGATACAGATGTTCTCGACATTTCTTATTGTCTTCTC Hc-h1-VIC ACGCCAGCTTTTCAAGCTCATGGAGCAGCCTACCTCGTCAAATTCGGCGTTCGTGATACAGATGTTCTCGACATTTCTTATTGTCTTCTC Hc-h1-VIB ACGCCAGCTTTTCAAGCTCATGGAACAGCCTACCTCGTCAAATTCGGCGTTCGTGATACAGATGTTCTCGACCTTTCTTATTGTCTTCTC Hc-h1-V1 ACGCCAGCTTTTCAAGCTCATGGAGCAGCCTACCTCGTCAAATTCGGCGTTCGTGATACAAATGTTCTCGACTTTTCTTATTGTCTTCTC Hc-h1-II1 ACGCCAGCTTTTCAAGCTCATGGAGCAGCCTACCTCGTCAAATTCGGCGTTCGTGATACAGATGTTCTCGACATTTCTTATTGTCTTCTC HcSKCi ACGCCAGCTTTTCAAGCTCATGGAGCAGCCTACCTCGTCAAATTCGGCGTTCGTGATACAGATGTTCTCGACATTTCTTATTGTCTTCTC RQLFKLMEQPTSSNSAFVIQMFSTFLIVFS

He GGCGCTCGTTACGGTACTTGAAACAGTTCCGGCTGTGCACTCGATATCGACGAGGGTTTGGTTTGGGTTGGAGACGAGTGTGGTTGCGTT Hc-h7 GGCGCTCGTTACGGTACTTGAAACAGTTCCAGCTGTTCATTCAATATCGACGAGGGTTTGGTTCGGGGTGGAGACGAGTGTGGTTGCATT Hc-h1-VIC GGCGCTCGTTACGGTACTTGAAACAGTTCCAGCTGTTCATTCAATATCGACGAGGGTTTGGTTCGGGGTGGAGACGAGTATCGTTGCATT Hc-h1-VIB GGCGCTCGTTACAGTGCTTGAAACAGTTCTAGCTGTTCATTCAATATCGACGAGGGTTTGGTTCGGAGTGGAGACGAGTATCGTTGCATT Hc-h1-V1 GGCGCTCGTTACGGTCCTTGAAACGGTTCCGGCTGTACATTCAATATCGACGAGGGTTTGGTTCGGGGTGGAGACGAGTATCGTTGCATT Hc-h1-II1 GGCGCTCGTTACGGTACTTGAAACAGTTCCAGCTGTTCATTCAATATCGACGAGGGTTTGGTTCGGGGTGGAGACGAGTGTGGTTGCATT HcSKCi GGCGCTCGTTACGGTACTTGAAACAGTTCCAGCTGTTCATTCAATATCGACGAGGGTTTGGTTCGGGGTGGAGACGAGTGTGGTTGCATT ALVTVLETVPAVHSISTRVWFGVETSVVAL

He GTTTACGGTGGAATATACTGCGCGATGTGTTGCGTGGAGTACCACCTGGATGAGCCTTTTTCGCTGGATGATCTgtgagtggcttgaaat Hc-h7 GTTTACGGTGGAATATATTGCGCGATGTCTTGCATGGAGTACGACATGGATGAGCCTTTTCCGATGGATGATTTgtgagcg-cttcatat Hc-h1-VIC ATTTACGGTGGAATATATTGCGCGATGTCTTGCATGGAGTACGACATGGATGAGCCTTTTCCGATGGATGATTTgtgagcg-ctttacat Hc-h1-VIB GTTCACGGTGGAATATATTGCGCGATGTCTTGCGTGGAGTACGACATGGATGAGTCTTTTTCGTTGGATGATTTgtgagcg-ctctacat Hc-h1-V1 GTTTACGGTGGAATATATTGCGCGATGTCTTGCGTGGAGTACGACTTGGATGAGCCTTTTCCGATGGATGATTTgtgagcg-ctttacat Hc-h1-II1 GTTTACGGTGGAATATATTGCGCGATGTCTTGCATGGAGTACGACATGGATGAGCCTTTTCCGATGGATGATTTgtgagcg-cttcatat HcSKCi GTTTACGGTGGAATATATTGCGCGATGTCTTGCATGGAGTACGACATGGATGAGCCTTTTCCGATGGATGATTT------FTVEYIARCLAWSTTWMSLFRWMIS

He ctctttctttctttccctgaactcatgtggtcgacatcagCTTTCTACGGAGTGATCGATCTTCTGTCAGTGCTGCCGTACTATCTGGAA Hc-h7 ctctgtttttttctccttgaactcatatggccgacgttagCTTTCTACGGAGTCATCGATCTTTTGTCAGTGCTGCCGTACTATCTGGAG Hc-h1-VIC ttctgctttttt-tccttgagctcatgcgggtgac--cagCGTTCTACGGAGTCATCGATCTTTTGTCAGTGCTGCCGTACTATCTGGAG Hc-h1-VIB ctctgctttttt-tccttgagctcatgcggttgac--cagCTTTCTACGGAGTCATCGATCTTTTGTCAGTGCTGCCGTACTATCTGGAG Hc-h1-V1 ctctgtttttttctccttgaactcatatggccgacgttagCTTTCTACGGAGTCATCGATCTTTTGTCAGTGCTGCCGTACTATCTGGAG Hc-h1-II1 ctctgtttttttctccttgaactcatatggccgacgttagCTTTCTACGGAGTCATCGATCTTTTGTCAGTGCTGCCGTACTATCTGGAG HcSKCi ------CTTTCTACGGAGTCATCGATCTTTTGTCAGTGCTGCCGTACTATCTGGAG i#1 FYGVIDLLSVLPYYLE

He TTAATGTTCTTACAAGATACTgtgagtttttcattggaatctaactaaatttctgacatggttattattatttcagTCAGTCTACTTCAG Hc-h7 TTGATGTTCTTACAAGATACAgtgagtttt-aaccaaaatttgtgtgcggaact--caccgttataattattccagTCAGTTTACTTCAG Hc-h1-VIC TTGATGTTCTTACAAGATACCgtgagttt--gaccaaactttgtggagggacct--caccgttataattatttcagTCAGTTTACTTCAG Hc-h1-VIB TTGATGTTTTTACAAGATACCgtgagtttt-aaccaaactttgagtagtgagct--caccgttataatcatttcagTCAGTTTACTTCAG Hc-h1-V1 TTGATGTTCTTACAAGATACCgtgagttta-aaccaaactttgtggagggaact--cac-gttataatcattccagTCAGTTTACTTCAG Hc-h1-II1 TTGATGTTCTTACAAGATACAgtgagtttt-aaccaaaatttgtgtggggaact--caccgttataattattccagTCAGTTTACTTCAG HcSKCi TTGATGTTCTTACAAGATACA------TCAGTTTACTTCAG LMFLQDT i#2 SVYFR

He ATTCTCAATTCTTCGCATGTTTCGTCTCCTTCGGGTGTTTCGGCCATTCCGCTACAACCACACAATTCTACTgtgagcgt--cgctgata Hc-h7 ATTCTCTATTCTTCGAATGTTTCGTCTCCTGCGGGTATTTCGGCCATTCCGTTACAACCACACAATTCTCCTgtgagtgt--tggtaatt Hc-h1-VIC ATTCTCTATTCTTCGAATGTTTCGTCTCCTGCGGGTATTTCGGCCATTCCGCTACAACCACACAATTCTACTgtaagcgt--ttccaatc Hc-h1-VIB ATTCTCTATTCTTCGAATGTTTCGTCTCCTGCGGGTATTTCGGCCATTCCGTTACAACCACACAATTCTACTgtaagcgaagctccaatc Hc-h1-V1 GTTCTCTATTCTTCGAATGTTTCGTCTCCTGCGGGTATTTCGGCCATTCCGTTACAACCACACAATTCTCCTgtgagtgt--tggtagtt Hc-h1-II1 ATTCTCTATTCTTCGAATGTTTCGTCTCCTGCGGGTATTTCGGCCATTCCGTTACAACCACACAATTCTCCTgtgagtgt--tggtagtt HcSKCi ATTCTCTATTCTTCGAATGTTTCGTCTCCTGCGGGTATTTCGGCCATTCCGTTACAACCACACAATTCTCCT------FSILRMFRLLRVFRPFRYNHTILL

He ttcagttccgcttatacaattgacgcgacctat----tttagCACCATTGAGGTCATGTACCTCTCAGTACGCCGTTCGCAACACGCCCT Hc-h7 tttgcttctctttacacaattgacacggcttgtttcattcagCACGATGGAGGTCATGTACCTCTCAGTACGCCGTTCACAACACGCCCT Hc-h1-VIC ttcaataccatttatacaaatgacctggct-----catttagCACGATGGAGGTCATGTACCTCTCAGTACGCCGTTCACAACACGCCCT Hc-h1-VIB ttcaataccatttacacaaatgacctggct-----catttagCACGATGGAGGTCATGTACCTCTCAGTACGCCGTTCACAACACGCCCT Hc-h1-V1 tttgcttctgtttacacaattgacaccgcttgt----ttcagCACGATGGAGGTCATGTACCTCTCAGTACGCCGTTCACAACACGCCCT Hc-h1-II1 tttgcttctgtttacacaattgacaccgcttgt----ttcagCACGATGGAGGTCATGTACCTCTCAGTACGCCGTTCACAACACGCCCT HcSKCi ------CACGATGGAGGTCATGTACCTCTCAGTACGCCGTTCACAACACGCCCT i#3 TMEVMYLSVRRSQHAL

89 He ACTCGCCATTGGGTTCTTCGTCATTATGATCCTCACCGTGTTCAGCACGTTATTgtgcgtctactcctacttgcttctacc-ccctccga Hc-h7 ACTTGCCATTGGATTCTTCGTCATGATGATCCTCACCGTGTTCAGCACGTTATTgtgtgtataaccc-acgtgtctccataaccctcgaa Hc-h1-VIC ACTTGCCATTGGGTTCTTCGTCATGATGATCCTCACCGTGTTCAGCACGTTATTgtgcgtatacgcc-gcgtgtttacacc-agctcgca Hc-h1-VIB GCTTGCCATTGGATTCTTCGTCATGATGATCCTCACCGTGTTCAGCACGTTATTgtgcgtatacgcc-gcgtgtttacacc-agctcgcg Hc-h1-V1 ACTTGCCATTGGATTCTTCGTCATGATGATCCTCACCGTGTTCAGCACGTTATTgtgcgtatacccc-acgtgtctccata-ccctcgaa Hc-h1-II1 ACTTGCCATTGGATTCTTCGTCATGATGATCCTCACCGTGTTCAGCACGTTATTgtgcgtatacccc-acgtgtctccata-ccctcgaa HcSKCi ACTTGCCATTGGATTCTTCGTCATGATGATCCTCACCGTGTTCAGCACGTTATT------LAIGFFVMMILTVFSTLL i#4

He actaaggaaccttcttccagATATTTTGCAGAAGGAGGAACGTGGGACGAGTGGTTGGGTACATTCATCATTGCGGATGGCGTCCCACCA Hc-h7 attgagctattttg--ctagGTATTTTGCAGAAAGAGGAACGTGGGACGAGTTGCTGGGTACCTTCATCAATGCGGATGGTGACCCTACA Hc-h1-VIC actgaattaccttg--ccagGTATTTTGCGGAAAGAGGAACATGGGACGAGTTGTTGGGTACATTCATCAATGCAGATGGTGACCCGACC Hc-h1-VIB attgagttaccttg--ctagATATTTTGCAGAAAGAGGGACGTGGGACGAGTTGTTGGGTACCTTCATCAATGCGGATGGTGACCCTACA Hc-h1-V1 agtgagctattttg--ctagGTATTTTGCAGAAAGAGGAACGTGGGACGAGTTGCTGGGTACCTTCATCAATGCGGATGGTGACCCTACA Hc-h1-II1 agtgagctattttg--ctagGTATTTTGCAGAAAGAGGAACGTGGGACGAGTTGCTGGGTACCTTCATCAATGCGGATGGTGACCCTACA HcSKCi ------GTATTTTGCAGAAAGAGGAACGTGGGACGAGTTGCTGGGTACCTTCATCAATGCGGATGGTGACCCTACA YFAERGTWDELLGTFINADGDPT

He CAGTTTTCAgtggagttaaac----cattattgtaccattt--atcaactcggccatcactcggccttgtggacttgcttgtcccacatc Hc-h7 CAGTTTTCAgtgagttaaaattcggtattattgtcccatttgaatcaattcggccgtcgcctgcctccggcttggtgaatgtgccgaat- Hc-h1-VIC CAATTTTCAgtgcgttaaagt------attttcctcctc------Hc-h1-VIB CAGTTTTCAgtgagttaaaattcggtactattgtcccatttgaatcagttcggccgtcacggtgaccaagttctccaccttatccaccgt Hc-h1-V1 CAGTTTTCAgtgagttaaaattcggtattattgtcccatttgaatcaattcggccgtcgcctgcctccggcttggtgaatgtgccgaaag Hc-h1-II1 CAGTTTTCAgtgagttaaaattcggtattattgtcccatttgaatcaattcggccgtcgcctgcctccggcttggtgaatgtgccgaaag HcSKCi CAGTTTTCA------QFS

He ccctgaatattcgggcggttttatgggcggttttggaacttccagagccgctggatcgttgtcccgggtctcccgcatagcaaggtggcc Hc-h7 cggttggttgtactgcatgatct------Hc-h1-VIC ------Hc-h1-VIB ccctttcccccagaatgaattaat------Hc-h1-V1 cggttggttgtactgcatgatcttgacggttttggggactattttggatgcttccgagcgctcggatcgccatgctgccccccagtacac Hc-h1-II1 cggttggttgtactgcatgatcttgacggttttggggactattttggatgcttccgagcgctcggatcgccatgctgccccccagtacac HcSKCi ------i#5

He gcagtcaaaaattcgtccaccttgtcccctgtcccttccccccag------ccaaatcgaaccctctgtt------Hc-h7 ------atcttgttcttctgtta Hc-h1-VIC ------ttaaat------Hc-h1-VIB ------ttaaatggtaccttgttcttatgtta Hc-h1-V1 catatcaggcactgaccaaggtctccactttgtccaccgtccctgttcctcgagatgaattaatttaaatggtaccttgttcttctgtta Hc-h1-II1 catatcaggcactgaccaaggtctccactttgtccaccgtccctgttcctcgagatgaattaatttaaatggtaccttgttcttctgtta HcSKCi ------

He aactcaatattgacctcttttttgcagTCCATTCCCGCTGCGGCGTGGTTTGTCCTCGTCAgtgagttcaccttcccacccatccaaatg Hc-h7 aactcgatattgacttctcttgc-cagTCCATTCCTGCTGCGGCTTGGTTCGTCCTCGTCAgtaagtacacctcct---tcactgaagtt Hc-h1-VIC ----caatattgatggcttcttc-cagTCCATTCCCGCTGCGGCGTGGTTCGTTCTCGTCAgtgagtacacctcctg--cctatgctatt Hc-h1-VIB aactcgatattgacctcttcttc-cagTCCATTCCCGCTGCGGCTTGGTTCGTCCTCGTCAgtaagtacacctcct---tcactgaagtt Hc-h1-V1 aactcgatattgacttctctttc-cagTCCATTCCTGCTGCGGCTTGGTTCGTCCTCGTCAgtaagtacacctcct---tcactaaagtt Hc-h1-II1 aactcgatattgacttctctttc-cagTCCATTCCTGCTGCGGCTTGGTTCGTCCTCGTCAgtaagtacacctcct---tcactaaagtt HcSKCi ------TCCATTCCTGCTGCGGCTTGGTTCGTCCTCGTCA------SIPAAAWFVLVT

He tgtatcattaaat-----gcccgcaacagCGATCACGACCGTCGGATACGGAGAAATTACCCCGCGATCTTTCCTCGGTCGACTCATCAC Hc-h7 atttatattaaat-----gcctgccatagCGATCACGACCGTCGGATACGGAGAAATTACACCCCGATCCTTTCTTGGTCGACTCATCAC Hc-h1-VIC tttcaaattaaattccccgcccaccatagCGATCACGACCGTCGGATACGGAGAAATTACACCGCGATCCTTTCTCGGTCGACTCATCAC Hc-h1-VIB attcatattaaat-----gcctgtcatagCGATCACGACCGTCGGATACGGAGAAATTACGCCGCGATCCTTTCTCGGTCGACTCATCAC Hc-h1-V1 atttatattaaat-----gcctgtcatagCGATCACGACCGTCGGATACGGAGAAATTACACCGCGATCCTTTCTCGGTCGACTCATCAC Hc-h1-II1 atttatattaaat-----gcctgtcatagCGATCACGACCGTCGGATACGGAGAAATTACACCGCGATCCTTTCTCGGTCGACTCATCAC HcSKCi ------CGATCACGACCGTCGGATACGGAGAAATTACACCGCGATCCTTTCTCGGTCGACTCATCAC i#6 ITTVGYGEITPRSFLGRLIT

He ATTGCCCATCCTGGTGTTTGGCCTCCTCTTAATCACACTACCGAGCTTTGTGCTAGGGCGCGAATTTAGCCACGTGTGGGAGAAGATGAA Hc-h7 GCTCCCCATCCTTGTGTTCGGCCTCCTATTAATCACTCTACCTAGTTTCGTCCTTGGACGCGAATTCAGTCACGTATGGGAGAAGATGAA Hc-h1-VIC GCTGCCCATCCTGGTCTTTGGCCTCCTCTTAATTACACTACCGAGTTTCGTCCTTGGGCGCGAATTTAGCCACGTATGGGAGAAAATGAA Hc-h1-VIB GCTGCCCATCCTTGTGTTCGGCCTCCTCTTAATCACTCTACCTAGTTTCGTCCTCGGGCGTGAATTCAGTCACGTATGGGAGAAAATGAA Hc-h1-V1 GCTGCCCATCCTTGTGTTCGGGCTCCTCTTAATTACACTGCCGAGTTTCGTCCTTGGGCGCGAATTTAGTCACGTTTGGGAGAAAATGAA Hc-h1-II1 GCTGCCCATCCTTGTGTTCGGGCTCCTCTTAATTACACTGCCGAGTTTCGTCCTTGGGCGCGAATTTAGTCACGTTTGGGAGAAAATGAA HcSKCi GCTGCCCATCCTTGTGTTCGGGCTCCTCTTAATTACACTGCCGAGTTTCGTCCTTGGGCGCGAATTTAGTCACGTTTGGGAGAAAATGAA LPILVFGLLLITLPSFVLGREFSHVWEKMN

90 He CTCGGATCGGAAGGAGGGAGAAGATGTAGGCGCTGGT------GGGAGTCGAAGGGCTGCAGGGATACCAAGCGCCACTGC Hc-h7 CTCGGATCGGAAGGAGGGAGAAGATACAGGTGCTGGT------AGTGAAGGAGGAAGTCGAAGCGCCACAGGGATGCCAAGCGCGTCCGC Hc-h1-VIC CTCGGATCGCAAGGAGGAAGAAGATGCGGGTGCAGGCGATGCTGGTGGAGGAGGGAGCCGAAGCGCCGCAGGGATACCGAGTGCGTCTGC Hc-h1-VIB TTCGGATCGGAAGGAGGGAGAAGATGCAGGTGCTGGT------GGTGAAGGAGGAAGTCGCAGCCCTACAGGGATGCCGAGTGCATCCGC Hc-h1-V1 TTCGGATCGGAAGGAGGGAGAAGATGCAGGTGCTGGC------GGTGAAGGAGGAAGTCGCAGCCCTACAGGGATGCCGAGTGCATCCGC Hc-h1-II1 TTCGGATCGGAAGGAGGGAGAAGATGCAGGTGCTGGC------GGTGAAGGAGGAAGTCGCAGCCCTACAGGGATGCCGAGTGCATCCGC HcSKCi TTCGGATCGGAAGGAGGGAGAAGATGCAGGTGCTGGC------GGTGAAGGAGGAAGTCGCAGCCCTACAGGGATGCCGAGTGCATCCGC SDRKEGEDAGAG GEGGSRSPTGMPSASA

He AGGGCGATCAGCTCGACCACCACGCTCCTCGCGAATAATACGCCCCGCTGAGGATACCGACGATCCGTACGGTCCTTCGTCGTTTCATTA Hc-h7 AGGGAGATCAGCTCGACCTCCACGCTCCTCGCGAATACCACGCTCCGGGGAGGATACCGAGGATCCTTATGGGCCTTCATCGTTTTATTA Hc-h1-VIC AGGGCGCTCCGCAAGACCGCCACGCTCCTCGCGAATACCACGCTCCGGGGAGGATACCGAGGATCCTTATGGCCCTTCGTCATTTTATTA Hc-h1-VIB AGGGAGATCAGCGCGACCGCCACGGTCTTCTCGAATATCACGCTCCGGGGAGGATACCGAGGATCCCTACGGGCCTTCATCGTTTTATTA Hc-h1-V1 AGGGAGATCAGCTCGACCTCCACGCTCCTCGCGAATATCACGCTCTGGGGAGGATACCGAGGATCCTTATGGGCCTTCATCGTTTTATTA Hc-h1-II1 AGGGAGATCAGCTCGACCTCCACGCTCCTCGCGAATATCACGCTCTGGGGAGGATACCGAGGATCCTTATGGGCCTTCATCGTTTTATTA HcSKCi AGGGAGATCAGCTCGACCTCCACGCTCCTCGCGAATATCACGCTCTGGGGAGGATACCGAGGATCCTTATGGGCCTTCATCGTTTTATTA GRSARPPRSSRISRSGEDTEDPYGPSSFYY

He TTCCCCCGCTGGGTACTCGTCCCGCAGGCCAGATTGGGAGAGACCTTTTGGTGGTGGC------GCGGCGGCGGACTTGACGAATATGAA Hc-h7 CTCCCCCGCTGGGTACTCGTCCCGCAGGCCAGATTTGGAAAGGCCGTTTGGTGGT---GTGGCAGCTGCGAGGGACTTGACTAACTTGAA Hc-h1-VIC TTCCCCCGCTGGCTATTCGTCTCGCAGGCCCGATTGGGACAGACCGTTTGGTGGT---GTGGCAATGGCGAGGGACTTGACTAACTTGAA Hc-h1-VIB CTCCCCCGCTGGGTACTCGTCCCGCAGGCCCGATTGGGAAAGGCCGTTTGGTGGTGGTGTGGCAGCGGCGAGGGACTTGACCAATATGAA Hc-h1-V1 CTCCCCCGCTGGCTATTCGTCTCGCAGGCCAGATTGGGAAAGGCCGTTTGGTGGT---GTGGCAGCTGCGAGGGACTTGACTAACTTGAA Hc-h1-II1 CTCCCCCGCTGGCTATTCGTCTCGCAGGCCAGATTGGGAAAGGCCGTTTGGTGGT---GTGGCAGCTGCGAGGGACTTGACTAACTTGAA HcSKCi CTCCCCCGCTGGCTATTCGTCTCGCAGGCCAGATTGGGAAAGGCCGTTTGGTGGT---GTGGCAGCTGCGAGGGACTTGACTAACTTGAA SPAGYSSRRPDWERPFGG VAAARDLTNLK

He GTTGGCACAGAATCAGACGGAGTTGAGTAAGCAGATTGAGGAATTGGCGGGGACGGTGGAGGTACAGGGGAGGTTGTTGAGGAGATTGTT Hc-h7 GTTGGCGCAAAACCAAACGGAGCTGAGTAGACAGATAGAGGAGTTGGCCGGGACGGTCGAGGTTCAAGGGAGGTTGTTGAGGAGATTGTT Hc-h1-VIC GTTGGCGCAAAACCAGACCGAGCTGAGTAGACAGATAGAGGAGTTGGCGGGGACGGTCGAGGTCCAAGGGAGGTTGTTGAGGAGGTTATT Hc-h1-VIB GCTGGCGCAAAACCAAACGGAATTGAGTAGACAGATAGAGGAGTTGGCGGGGACGGTGGAGGTCCAAGGGAGGTTGTTGAGGAGATTGTT Hc-h1-V1 GTTGGCGCAAAACCAAACGGAGCTGAGTAGACAGATAGAGGAGTTGGCCGGGACGGTCGAGGTCCAAGGGAGGTTGTTGAGGAGATTGTT Hc-h1-II1 GTTGGCGCAAAACCAAACGGAGCTGAGTAGACAGATAGAGGAGTTGGCCGGGACGGTCGAGGTCCAAGGGAGGTTGTTGAGGAGATTGTT HcSKCi GTTGGCGCAAAACCAAACGGAGCTGAGTAGACAGATAGAGGAGTTGGCCGGGACGGTCGAGGTCCAAGGGAGGTTGTTGAGGAGATTGTT LAQNQTELSRQIEELAGTVEVQGRLLRRLL

He GG------Hc-h7 GGAGAAACTAGATTCTTCGACGAGTGAGGTGGGCTTGGTGGATTCGAAGGTGGCTGGAGAAGCTAGCTAACCTTCAACTTGGCATGGAAG Hc-h1-VIC GGAGAAATTGGATTCTTCGACGAGTGAGGTTGGGTTGGTGGATCCGAAGGTGGCTGAGGACGGTAGCTAGCCTT------AG Hc-h1-VIB GGAGAAATTGGATGCTTCGACGAGTGAGGTGGGGTTGGTGGATTCGAAGGTGGCTGAGGACGGTAGCTAGCCTT------AG Hc-h1-V1 GGAGAAACTAGATTCTTCGACGAGTGATGTGGGGTTGTTAGATTCGAAGGTAGCTGGAGAAGCTAGCTAACCTT------A Hc-h1-II1 GGAGAAACTAGATTCTTCGACGAGTGATGTGGGGTTGTTAGATTCGAAGGTAGCTGGAGAAGCTAGCTAACCTT------A HcSKCi GGAGAAACTAGATTCTTCGACGAGTGATGTGGGGTTGTTAGATTCGAAGGTAGCTGGAGAAGCTAGCTAACCTT------A EKLDSSTSDVGLLDSKVAGEAS*

He ------Hc-h7 GGTTTGGGGATCTTTTTTCCTATATTTATGGAGACATTGGGATATCACTAGGATTTTGTAATGGTATCTTTGGAGGG Hc-h1-VIC GGTTGGGGGATCTTTTTTTCTATATTTATGGAGACATTGGGATATCACTAGGATTTTGTAATGGTATCTTTGGAGGG Hc-h1-VIB GGTTGGGGGATCTTTTTTTCTATATTTATGGAGACATTGGGATATCGCTAGGATTTTGTAATGGTATCTTTGGAGGG Hc-h1-V1 GGGTTGGGGATCTTTTTTT-TATATTTATGGAGACAATGGGATATCGCTAGGATTTTGTAATGGTATCTTTGGAGGG Hc-h1-II1 GGGTTGGGGATCTTTTTTT-TATATTTATGGAGACAATGGGATATCGCTAGGATTTTGTAATGGTCTCTTTGGAGGG HcSKCi GGGTTGGGGATCTTTTTTT-TATATTTATGGAGACAATGGGATATCGCTAGGATTTTGTAATGGTATCTTTGGAGGG

Figure 4.7. Alignement des séquences de gènes SKC identifiées dans la souche h1 d'Hebeloma cylindrosporum. Le criblage d'une banque génomique préparée à partir de la souche h1 permet d'identifier 4 séquences différentes correspondant au gène SKC: Hc-h1-VIC, Hc-h1-VIB, Hc-h1-V1 et Hc-h1-II1 (séquences présentées dans l'alignement). Des expériences de PCR sur ADN génomique ciblant le gène SKC permettent d'amplifier la séquence appelée Hc-h7 chez la souche h7 d'H. cylindrosporum, et la séquence appelée He d'un homologue de SKC chez l'espèce H. edurum sinuosum (souche dicaryotique LY63 BR30; Cf. Figure 4.6). Ces deux séquences sont alignées avec les régions correspondantes des clones génomiques Hc-h1-VIC, Hc-h1-VIB, Hc-h1-V1 et Hc-h1-II1 et de l'ADNc initial HcSKCi. Les régions codantes des clones génomiques (par référence à l'ADNc HcSKCi) sont écrites en majuscules et les séquences introniques en minuscules. La séquence protéique déduite de l'ADNc est donnée sur la dernière ligne. La séquence de HcSKCi sert de référence dans l'alignement pour analyser les différences nucléotidiques. Les différences identifiables dans les exons des autres séquences sont notées à l'aide du code suivant. En rouge: mutations provoquant une modification de l'acide aminé. En bleu: mutations silencieuses. Lorsque ces mutations sont situées sur le 3ème nucléotide du codon, le résidu correspondant est écrit en gras.

91 (5) Les deux clones génomiques Hc-h1-V1 et Hc-h1-II1 ont des séquences très proches. Les différences s'observent essentiellement dans les 360 premiers nucléotides de la région alignée. Neuf des 11 différences apparaissant dans cette région concernent le 3ème nucléotide d'un codon et correspondent à des mutations silencieuses. Les deux autres différences s'observent au sein d'un même codon: GTG dans Hc-h1-II1, comme dans la séquence référence HcSKCi, et ATC dans Hc-h1-V1. Cette mutation change une valine en isoleucine (deux acides aminés du même groupe). Ce codon muté ATC se retrouve également (à la même position) dans les 2 autres clones génomiques Hc-h1-VIC, Hc-h1-VIB. Dans leur ensemble, ces observations appuient l'hypothèse que les deux clones Hc-h1-V1 et Hc-h1-II1 identifient effectivement deux copies différentes du gène HcSKC.

4.2.5. Analyse phylogénétique des copies du gène HcSKC identifiées chez la souche h1 Les résultats présentés dans le paragraphe précédent nous ont conduits à conclure qu'au moins 4 copies du gène HcSKC sont identifiées dans la souche h1, et que ces copies se distinguent plus particulièrement par la longueur du 5ème des 6 introns du gène, qui varie de 52 à 287 nt. Les 5 autres introns ont des longueurs très conservées d'une copie à l'autre. Nous avons utilisé les différences de séquence observées d'une copie à l'autre dans ces 5 introns pour analyser les relations phylogénétiques entre les 4 copies du gène. Nous avons également pris en compte dans cette analyse les deux copies He et Hc-h7 identifiées chez H. edurum sinuosum et la souche h7. L'arbre phylogénétique ainsi obtenu est présenté sur la Figure 4.8. Son examen conduit aux conclusions suivantes. (1) Les copies du gène HcSKC définies par les clones Hc-h1-V1 et Hc-h1-II1 sont très proches l'une de l'autre, en accord avec les analyses faites ci-dessus (Cf. point 4 du paragraphe précédent). Il est intéressant de noter que le clone Hc-h7, qui identifie la copie unique du gène HcSKC présente chez la souche h7, est toujours très proche de ces deux séquences. (2) Les deux autres séquences identifiées chez h1, Hc-h1-VIB et Hc-h1-VIC, sont elles aussi très proches l'une de l'autre, au moins lorsque l'arbre des relations phylogénétiques est construit à partir des introns 1, 2, 3 et 4. Elles sont par contre beaucoup plus éloignées dans l’arbre construit à partir de l’intron 6. De plus, elles se distinguent très nettement par la taille de leur 5ème intron (52 nt dans Hc-h1-VIC, et 157 nt dans le clone Hc-h1-VIB). Prises dans leur ensemble, ces données indiquent que les séquences introniques peuvent évoluer, à l'échelle d'un même gène, de façon très différente d'un intron à l'autre. Une explication serait que les introns qui évoluent lentement soient soumis à une certaine pression de sélection.

92 93 4.2.6. Analyse du gène HcSKC1

Nous avons indiqué dans le paragraphe 4.2.4. ci-dessus que, parmi les 4 clones génomiques identifiés, le clone Hc-h1-II1 correspond à l'ADNc initial HcSKCi. La digestion du phage Hc-h1-II1 par NotI libère 2 fragments d'ADN fongique, de 6 et 15 kb. L'analyse par PCR indique que la copie du gène SKC est présente dans le plus long de ces 2 fragments. Après clonage de ce fragment dans pBS, la région correspondant au gène HcSKC1 est séquencée sur une longueur voisine de 3400 nt. La Figure 4.9 présente une analyse de la séquence ainsi obtenue. Son examen révèle la présence d'un codon ATG situé 189 résidus (63 codons potentiels) en amont du premier ATG de la phase ouverte de lecture identifiée dans l'ADNc initial HcSKCi. Cet ATG pourrait donc être le codon "start" effectif du canal SKC (voir paragraphe ci-dessous). La structure exon-intron du gène HcSKC1 est présentée sur la Figure 4.10A. Le gène présente 6 introns. Mis à part l'intron 5 qui possède une taille de 287 paires de bases et constitue le caractère le plus variable entre les différentes copies identifiées du gène HcSKC, les autres introns ont une taille très homogène, voisine de 50 paires de bases (Figure 4.10B). Sur la base des données disponibles (Corratgé, 1999; Jargeat, 1999; Tatry, 2003), il semble que l'existence d'introns en nombre relativement important et de taille relativement homogène, proche de 50 à 60 nt, soit une caractéristique relativement fréquente des gènes d'Hebeloma cylindrosprum. La séquence codante de HcSKC1 contient 51% de GC, et celle des introns 44% de GC. Cette teneur moyenne en GC des séquences introniques intègre des différences importantes d'un intron à l'autre, de 30% (intron 6) à 50% (intron 4) (Figure 4.10C). Chacun des introns 1, 3, 4 et 5 présente une teneur en GC qui ne se démarque pas de celle de l'un au moins des exons qui le flanquent (Figure 4.10C). Les séquences flanquantes des introns sont indiquées sur la Figure 4.10D. La C séquence consensuelle est GTGAGT en 5’, et C /TAG en 3’, ce qui est en accord avec les résultats obtenus chez Hebeloma cylindrosporum par Jargeat (1999) et Tatry (2003), et correspond également aux consensus observés chez l'homme (Stephens & Schneider, 1992).

4.2.7. Recherche d'un ADNc HcSKC1 complet

Trois observations suggèrent que l'ADNc initial HcSKCi pourrait ne pas contenir la totalité de la phase codante du gène. (1) Le premier codon ATG présent dans la phase ouverte de lecture identifiable dans l’ADNc initial (Cf. Figure 4.2A) se situe en aval d’une séquence de 168 nucléotides. Cette séquence ne présente pas de codon stop en phase. Elle est donc susceptible d'allonger la phase de lecture en amont du premier ATG présent de 56 codons.

94 (2) Dans la séquence polypeptidique déduite, la méthionine codée par ce premier ATG ne se situe que 9 acides aminés en amont du premier domaine transmembranaire. Si cet ATG est effectivement le codon initiateur, cela signifie que le domaine N-terminal cytosolique du polypeptide HcSKC1 est relativement court. A titre de comparaison, chez Arabidopsis, le canal Shaker présentant la région N-terminale la plus courte est SKOR, avec 16 acides aminés. Dans les canaux Shaker animaux, la région N-terminale cytosolique est plus longue. (3) Enfin, comme cela a déjà été indiqué ci-dessus dans le paragraphe 4.2.6., l'analyse du clone génomique HcSKC1 révèle la présence d'un codon ATG susceptible d'allonger la phase ouverte de lecture de 63 codons. Cet ATG pourrait donc être le codon "start" effectif du canal SKC. La question de l'identité de l'ATG initiateur d'HcSKC1 a été abordée de 8 façons différentes.

(1) Analyse de la taille des transcrits HcSKC par northern blot. La taille des transcrits HcSKC extraits de la souche D2 est déterminée par northern blot après migration et transfert des ARN totaux sur un gel d’agarose dénaturant. Le transcrit EF1-α est utilisé dans une expérience parallèle contrôle. L'autoradiogramme obtenu pour HcSKC1 présente une seule bande, dont la taille est d’approximativement 1600 nt (Figure 4.11A). L'autoradiogramme obtenu pour EF1-α présente également une seule bande, à une taille voisine de 1600 nt (Figure 4.11B). L'analyse de la ressource d'étiquettes que nous avons produite révèle la présence d'une trentaine d'étiquettes correspondant à EF1-α, dont l'assemblage in silico conduit à un transcrit d'une longueur maximale de 1600 nt, en accord avec la taille déterminée par northern blot. Dans leur ensemble, ces résultats indiquent que: - Les différentes copies du gène HcSKC présentes dans la souche D2 produisent dans nos conditions des transcrits qui ont tous sensiblement la même taille, voisine de 1600 nt. - La taille de l'ADNc initial HcSKCi étant de 1450 nt, cet ADNc correspond à une copie tronquée du transcrit mais l'ADNc complet n'est probablement pas plus long que 1600 nt. La région manquante en 5' dans HcSKCi a donc une longueur égale à environ 150 nt au plus.

(2) Recherche d'autres étiquettes HcSKC dans la ressource produite. Nous avons analysé in silico notre ressource d'étiquettes dans le but d'identifier d'autres clones correspondant à HcSKC. Une seule étiquette a pu être ainsi repérée (clone 038E03). Elle est insérée dans le vecteur de clonage en sens inverse de celui de l'ADNc initial HcSKCi. Son séquençage complet révèle une stricte identité à HcSKCi, avec cependant 8 nt supplémentaires en 5' (Figure 4.12A). L'analyse de cette courte séquence supplémentaire

95 ACTTTCGGTTAAATACCCTATGGCAGTGCGAACACTGTTCCAAAGTCGGGAAATGTGTCATCATGTGGCGAATACGCCATCGGGATGAGA 90 CCACCCTCTTGCACTTAAACCCTTTCGACTCGAAAGGACACGCAGGACGGATAGCTGCCGTGTGTATCCTAAGATGACTTCGAAATGCTT 180 TCTTGCAAGAAAACACAGCACCGCAAGAGGCAACGGTACACTGAACCTCGATGCAAGGAGAACCATCGGGACCGAAATAAACTTTGAAGG 270 GAAAACTGCGGAGGTAATTCTTGGACTCTTCGCAATCCAACAGCGCAGCCTGGGCCGGGGTCGGTATCTGGGGCACATTCGAAGGGTTTG 360 ACGAGGGCGGCGGCTTGGCCCAATCACCTTCAAAAACGAAGGGCAGACGTTCAAGTTCAAAGTCAAGCATCTAGGAAATGCGTTTGAGTA 450 TGGTATGGAACTGAGATCAGCCATTGAGCTTACTGTGGTTATAGGGCGATAGTTCGAGGTGGTGCTAGAGTGGTTAATGGCGACACAACC 540 TGCTAGGTAAGTAGACCTTGAAGCTCCTTTTATACTTCAAATTTTTATCCCTTATTGTTTACACAAAATGAAACCACTGGCAACGACGTT 630 CCCTTGAGCGTATGGATTAGGTCTGAGCGGGACCAAGCACGGTGGCCGTTCCTGAAATGCCGATCCTTCTTATTATGGGTCTCCCTGACC 720 ACCGGGTGTCATGACATCGATGGTCCAAGTATGGTACACACCTCGCAATGCAATTCCTGACAATGTGGATGTTAGCGAGGGAAATGACAG 810 GCCAACGCCGGCGGTTCGCTTGATAGAATCAGTAGCACCAAAATATGAATCAATTATGAAGTTAGTTAGGCGCCCAACTCCGAATGGAAC 900 TAAGGACATACACATATGTTCGAGTTTCTACCGAGATTTTCATTGAAGTAATTCGGTCTTCCGAGCGACATGATTTGCTTGACGGTTCAA 990 TATTCCGGCTCTGTCGCAATGCTCTCAATTCGGGTTTCGGTGTAAATTTCTTTGCCCAACCTTTTTCATTCGCCCCCGCCCCCCTGTATT 1080 TTTAGGGGGAGATAAGGTGAAATTTAGATGGCGACGGTGGCAGAAAATCAAGTCCTTAATTGTGTTCCCAATAATAAGGAAGTTGTTCAT 1170 CGTTGTTGAATTCTCCTAAGTCCCAACTATCTGCTTCCCATATCTTTGAAAACCCCTTGGACCCAGACTTTTTAGTGAAATAAGAGGGGT 1260 ATGACTTACCGAGGGTCGATTGTATAGGCGAGATTGACAAATTTCACATTATAACCCGGATGACGGTTGAGGCCAATGGCAAAAAGAGCA 1350

CCGTGGGAACATTGATGGCAATGATTTTCGGCGTTGTTTGTGTGCACGTTGCTTGATGGCCTCCGCCTCGACCATCGAACTTTCAAGACT 1440 MASASTIELSRL12

CAGGCGACCGCCCCCGCTTTCGCTGCGCTTTTTTACTGAAGAACGCCCACCACAATCTCCCAATGACAATAACGACTCATTTCCTGTGTC 1530 RRPPPLSLRFFTEERPPQSPNDNNDSFPVS42

GGCGTCGTACGAAGACGAGTCGATCGCCTTACATCCACTATGGAAACGCCAGCTTTTCAAGCTCATGGAGCAGCCTACCTCGTCAAATTC 1620 ASYEDESIALHPLWKRQLFKLM EQPTSSNS72

GGCGTTCGTGATACAGATGTTCTCGACATTTCTTATTGTCTTCTCGGCGCTCGTTACGGTACTTGAAACAGTTCCAGCTGTTCATTCAAT 1710 AFVIQMFSTFLIVFSALVTVLETVPAVHSI102

ATCGACGAGGGTTTGGTTCGGGGTGGAGACGAGTGTGGTTGCATTGTTTACGGTGGAATATATTGCGCGATGTCTTGCATGGAGTACGAC 1800 STRVWFGVETSVVALFTVEYIARCLAWSTT132

ATGGATGAGCCTTTTCCGATGGATGATTTgtgagcgcttcatatctctgtttttttctccttgaactcatatggccgacgttagCTTTCT 1890 WMSLFRWMIS i#1 FY144

ACGGAGTCATCGATCTTTTGTCAGTGCTGCCGTACTATCTGGAGTTGATGTTCTTACAAGATACAgtgagttttaaccaaaatttgtgtg 1980 GVIDLLSVLPYYLELMFLQDT 165 gggaactcaccgttataattattccagTCAGTTTACTTCAGATTCTCTATTCTTCGAATGTTTCGTCTCCTGCGGGTATTTCGGCCATTC 2070 i#2 SVYFRFSILRMFRLLRVFRPF 186

CGTTACAACCACACAATTCTCCTgtgagtgttggtagtttttgcttctgtttacacaattgacaccgcttgtttcagCACGATGGAGGTC 2160 RYNHTILL i#3 TMEV 198

ATGTACCTCTCAGTACGCCGTTCACAACACGCCCTACTTGCCATTGGATTCTTCGTCATGATGATCCTCACCGTGTTCAGCACGTTATTg 2250 MYLSVRRSQHALLAIGFFVMMILTVFSTLL 228 tgcgtataccccacgtgtctccataccctcgaaagtgagctattttgctagGTATTTTGCAGAAAGAGGAACGTGGGACGAGTTGCTGGG 2340 i#4 YFAERGTWDELLG241

TACCTTCATCAATGCGGATGGTGACCCTACACAGTTTTCAgtgagttaaaattcggtattattgtcccatttgaatcaattcggccgtcg 2430 TFINADGDPTQFS 254 cctgcctccggcttggtgaatgtgccgaaagcggttggttgtactgcatgatcttgacggttttggggactattttggatgcttccgagc 2520 i#5 gctcggatcgccatgctgccccccagtacaccatatcaggcactgaccaaggtctccactttgtccaccgtccctgttcctcgagatgaa 2610 ttaatttaaatggtaccttgttcttctgttaaactcgatattgacttctctttccagTCCATTCCTGCTGCGGCTTGGTTCGTCCTCGTC 2700 SIPAAAWFVLV 265

AgtaagtacacctccttcactaaagttatttatattaaatgcctgtcatagCGATCACGACCGTCGGATACGGAGAAATTACACCGCGAT 2790 T i#6 ITTVGYGEITPRS279

CCTTTCTCGGTCGACTCATCACGCTGCCCATCCTTGTGTTCGGGCTCCTCTTAATTACACTGCCGAGTTTCGTCCTTGGGCGCGAATTTA 2880 FLGRLITLPILVFGLLLITLPSFVLGREFS309

GTCACGTTTGGGAGAAAATGAATTCGGATCGGAAGGAGGGAGAAGATGCAGGTGCTGGCGGTGAAGGAGGAAGTCGCAGCCCTACAGGGA 2970 HVWEKMNSDRKEGEDAGAGGEGGSRSPTGM339

TGCCGAGTGCATCCGCAGGGAGATCAGCTCGACCTCCACGCTCCTCGCGAATATCACGCTCTGGGGAGGATACCGAGGATCCTTATGGGC 3060 PSASAGRSARPPRSSRISRSGEDTEDPYGP369

CTTCATCGTTTTATTACTCCCCCGCTGGCTATTCGTCTCGCAGGCCAGATTGGGAAAGGCCGTTTGGTGGTGTGGCAGCTGCGAGGGACT 3150 SSFYYSPAGYSSRRPDWERPFGGVAAARDL399

96 TGACTAACTTGAAGTTGGCGCAAAACCAAACGGAGCTGAGTAGACAGATAGAGGAGTTGGCCGGGACGGTCGAGGTCCAAGGGAGGTTGT 3240 TNLKLAQNQTELSRQIEELAGTVEVQGRLL429

TGAGGAGATTGTTGGAGAAACTAGATTCTTCGACGAGTGATGTGGGGTTGTTAGATTCGAAGGTAGCTGGAGAAGCTAGCTAAccttagg 3330 RRLLEKLDSSTSDVGLLDSKVAGEAS* 455 gttggggatcttttttttatatttatggagacaatgggatatcgctaggattttgtaatggtctctttggagggaagcttggg 3413

Figure 4.9. Séquence du gène HcSKC1. La séquence présentée est celle du clone génomique Hc-h1-II1, obtenue après sous clonage et séquençage de l'insert du phage (Cf. paragraphe 4.2.6.). Ce clone génomique correspond à l'étiquette et à l'ADNc initiaux (Cf. Figure 4.7). La séquence située en amont du premier nucléotide présent dans l’ADNc initial est identifié en caractères majuscules et italiques. L'analyse de cette région révèle la présence d'un codon ATG en phase avec le cadre de lecture de l'ADNc, susceptible de rallonger la séquence codante de l'ADNc de 7 codons (écrits en caractères et gras) et de constituer le codon initiateur de la traduction (Cf. Figure 4.12). Les séquences des exons sont écrites en lettres majuscules droites et celles des introns en minuscules droites. Six introns sont identifiés par comparaison de la séquence du gène avec l'ADNc. Ils sont numérotés de 1 à 6. La séquence transcrite non traduite en 3' est indiquée en caractères minuscules gras et droits. La séquence de l'extrémité 3' écrite en caractères minuscules gras et italiques est présente dans l'ADNc initial mais n'a pas de correspondance dans le clone Hc-h1-II1, l'insert contenu dans le phage s'arrêtant au niveau de l'extrémité de la séquence écrite en caractères minuscules gras et droits. La séquence polypeptidique déduite est fournie sous la séquence codante avec le code à une lettre. Le codon stop est indiqué par un astérisque. La séquence en 5', surlignée en gris, est susceptible de correspondre à une portion de phase ouverte de lecture appartenant à un autre gène que HcSKC1 et en sens inverse de celle de HcSKC1: Blastx détecte des similarités de séquence, mais relativement faibles (E_value voisine de 0,001), entre cette région et des gènes de fonction inconnue chez différents organismes dont le poisson Tetraodon nigroviridis.

97 A A ATG (?)1kb Stop

B 300 250 200 150 100

Taille de l'intron (nt) de l'intron Taille 50 0 i1 i2 i3 i4 i5 i6 Numéro de l'intron C 60

Pourcentage en GC 10

0 e1i1 e2 i2 e3 i3 e4 i4 e5 i5 e6 i6 e7 Numéros des exons et introns

D Intron 1 GTGAGCG...TTAG Intron 2 GTGAGTT...CCAG Intron 3 GTGAGTG...TCAG Intron 4 GTGCGTA...CTAG Intron 5 GTGAGTT...CCAG Intron 6 GTAAGTA...ATAG

98 Figure 4.10. Caractérisation moléculaire du gène HcSKC1. A: Structure du gène HcSKC1. Les exons sont indiqués par des rectangles pleins et les introns sont représentés par un trait épais. Le rectangle gris correspond à l'extension de la taille du premier exon lorsque l'on utilise le premier ATG identifié sur le clone génomique (Cf. Figure 4.9). Cet ATG initiateur potentiel et le premier ATG en aval (qui constitue le premier ATG en phase dans l'ADNc initial HcSKCi; Cf. Figure 4.2A) sont indiqués par des flèches. B: Taille des introns du gène. Les 5 introns en position 1, 2, 3, 4 et 6 ont des tailles très proches et voisines de 50 nt. L'intron en position 5 se distingue par une taille nettement plus grande, avec environ 290 nt. La taille de cet intron diffère fortement entre les différentes copies du gène HcSKC identifiés chez les souches h1 et h7 d'H. cylindrosporum et la souche LY63 BR30 d'H. edurum sinuosum (Cf. paragraphe 4.2.4.), alors que celle des autres introns est relativement conservée. C: Pourcentage en GC pour chacun des introns et exons. Le pourcentage en GC est légèrement plus élevé pour les exons que pour les introns. Cela se traduit dans le pourcentage global en GC des 7 exons et des 6 introns, qui est respectivement de 51 et 44%. D: Extrémités des introns. Les sites donneurs GT et accepteur AG sont parfaitement conservés sur l'ensemble des introns. Les nucléotides consensus (présents dans la moitié au moins des positions correspondantes) sont écrits en caractères gras.

99 A HcSKC

Taille 8,5 (nt) y = -0,70x + 9,55

4400 8

2370

1350 7,5

Ln (taille en nucléotides) Ln (taille 1600 nt

7 240 01234 Distance de migration (cm)

B HcEF1-α

Taille 8,5 (nt) y = -0,67x + 9,44

4400 8

2370

1350 7,5

Ln (taille en nucléotides) Ln (taille 1600 nt

7 240 01234 Distance de migration (cm)

Figure 4.11. Détermination de la taille des transcrits HcSKC par northern blot. Dix microgrammes d'ARN totaux de la souche D2 sont transférés sur membrane de nitrocellulose (après migration sur gel dénaturant). Deux membranes identiques sont hybridées avec soit une sonde HcSKC (A) soit une sonde HcEF1-α utilisé comme contrôle (B). Chaque panneau présente, de gauche à droite, la membrane de nitrocellulose après transfert, l'autoradiogramme qui révèle la présence des transcrits et le graphe qui permet de déterminer la taille du transcrit. L'analyse des graphes révèle une taille voisine de 1600 nucléotides pour les transcrits HcSKC et HcEF1-α .

100 révèle qu'elle pourrait rajouter au cadre de lecture potentiel de l'ADNc deux codons, ACC et ATC, codant le dipeptide T-I.

(3) Identification par PCR de l'extrémité 5' des clones HcSKC présents dans la banque d'ADNc. Nous avons réalisé une expérience de PCR sur la banque d’ADNc (Lambilliotte et al., 2004) comme matrice, avec une amorce s'hybridant sur le plasmide (pFL61; R1: 5'-CTgCATAAAggCATTAAAAAgAggAgCg-3' pour la bordure droite et L1: 5'-CTTCTAACCAAggggTggTTTAgTTTAg-3' pour la bordure gauche) en bordure du site de clonage et une amorce antisens s’hybridant dans la région 5’ de l’ADNc HcSKCi (SKC150Rev: 5'-CTgCTCCATgAgCTTgAAAAgCTgg-3'). Après migration sur gel, une bande très nette et de forte intensité est visualisée. La taille du fragment ainsi identifié n’est pas significativement différente de celle obtenue avec le clone contrôle (clone 009A07 dans pFL61; Cf. Figure 4.2A) correspondant à HcSKCi. La partie supérieure de la bande obtenue par rapport au sens de migration sur le gel (susceptible de contenir les produits d'amplification de plus grande longueur) est extraite. Après clonage, 3 fragments sont séquencés. Aucun d'entre eux ne correspond exactement à l'ADNc initial et au gène HcSKC1. Ces 3 clones présentent une séquence strictement identique sur les régions qu'ils possèdent en commun, indiquant qu'ils proviennent tous les 3 de la même copie du gène HcSKC, mais ils diffèrent par leur longueur en 5'. L'alignement du plus long de ces clones avec l'ADNc initial fait apparaître une extension en 5' de 41 nt. La séquence de cette extension (présentée dans la Figure 4.12B) sera analysée dans le point (6) ci-dessous.

(4) Recherche d'un ADNc complet par RACE-PCR. Des expériences de RACE-PCR sont effectuées sur des ARN totaux ou des ARN messagers (polyA) extraits de la souche D2. Deux amplifications PCR successives sont réalisées, la seconde utilisant un couple d'amorces (SKC150Rev: 5'-CTgCTCCATgAgCTTgAAAAgCTgg-3' et AP2: 5'-CTATAggg CTCgAgCggC-3') plus internes que la première (SKC200Rev: 5'-CAATAAgAAATg TCgAgAACATCTgTATCA-3' et AP1: 5'-ggATCCTAATACgACTCACTATAgggC-3'). Une seule bande est visible après dépôt des produits d'amplification sur gel et migration. Seule la partie supérieure de cette bande est prélevée et extraite. Après clonage, une dizaine de clones sont séquencés. Leur analyse révèle qu'ils correspondent tous au transcrit du gène HcSKC1. Le plus long de ces clones permet de rallonger la région 5' du transcrit HcSKC1 de 6 nt par rapport au clone 038E03 (Cf. ci-dessus), et de 14 nt par rapport à l'ADNc initial (Figure 4.12A). Par rapport à l'ADNc initial, cette séquence supplémentaire pourrait rajouter 4 codons au cadre de lecture potentiel, codant le motif polypeptidique A-S-T-I.

(5) Recherche d'un ADNc par RLM-RACE. La méthode de RLM-RACE (Ambion) permet en théorie d’amplifier uniquement les ADNc complets en 5' (pourvus de leur coiffe). De la même façon que pour la RACE-PCR, deux amplifications successives sont réalisées, avec

101 102 les mêmes amorces ciblant SKC (SKC200Rev puis SKC150Rev) et les amorces ciblant l'adaptateur fournies avec le kit (5'RaceOuter: 5'-gCTgATggCgATgAATgAACACTg-3' puis 5'RaceInner: 5'-CgCggATCCgAACACTgCgTTTgCTggCTTTgATg-3'). L'utilisation de cette méthode avec des ARN totaux extraits de la souche h1 pour identifier l'extrémité 5' du transcrit HcSKC1 nous a permis de rallonger la séquence de l'ADNc initial de 26 nt. Cette séquence supplémentaire pourrait rajouter 8 codons au cadre de lecture potentiel, codant le motif polypeptidique L-M-A-S-A-S-T-I (Figure 4.12A). La méthionine présente en seconde position dans ce motif pourrait donc correspondre à l'ATG initiateur du transcrit.

(6) Analyse de l'extrémité 5' du transcrit d'un second gène HcSKC. L'analyse des différents produits d'amplification séquencés à l'issue des expériences de PCR sur la banque d'ADNc et de RLM-RACE permet d'identifier deux clones correspondant à une copie du gène HcSKC différente de HcSKC1 (Figure 4.12B). Ces deux clones présentent strictement la même séquence sur les régions qu'ils on en commun. Ils pourraient donc correspondre à des transcrits d'une même copie du gène SKC. Ils se distinguent de HcSKC1 en particulier par les deux substitutions surlignées en bleu sur la Figure 4.12B. Ces deux substitutions ne s'observent pas dans les deux copies du gène SKC contenues dans les clones génomiques Hc-h1-VIB et Hc-h1-VIC. Elles ne sont présentes que dans le clone génomique Hc-h1-V1 (Cf. Figure 4.7). La région 5' de ce clone est en cours de séquençage. Ce second transcrit (sous sa forme la plus longue) est appelé HcSKC2. Lorsqu'il est aligné avec l'ADNc initial HcSKCi, HcSKC2 présente une extension en 5' de 41 nt (et de 15 nt par rapport au clone obtenu par RLM-RACE). L'analyse de la séquence formée par ces 41 nt révèle les éléments de structure suivants. - Cette séquence de 41nt est en phase (sans codon stop) avec la séquence qui la suit et qui code potentiellement le canal. - Les 18 nucléotides en 3' de cette séquence sont strictement conservés dans la région correspondante du clone HcSKC1 obtenu par RLM-RACE. Ils pourraient donc coder un motif polypeptidique A-S-A-S-T-I. - Les 4 nucléotides immédiatement en amont de cette séquence de 18 nt sont ATCG. Cela signifie que le codon ATG correspondant à la méthionine du motif M-A-S-A-S-T-I codé potentiellement par l'extrémité 5' du clone HcSKC1 identifié par RLM-RACE n'a pas de contrepartie dans l'ADNc HcSKC2. Tout se passe comme si l'insertion d'un résidu C au sein du codon ATG (pour donner ATCG) avait décalé le cadre de lecture. - La séquence (19 nt) présente en amont de ces 4 résidus ne présente pas de contrepartie dans le gène HcSKC1, mais inclut un motif de 12 résidus strictement conservés dans les gènes Hc-h1-VIB et Hc-h1-VIC. Ce motif pourrait donc être commun aux 3 gènes Hc-h1-VIB, Hc-h1-VIC et Hc-h1-V1 puisque ce dernier gène (en cours de séquençage) est probablement celui qui produit le transcrit HcSKC2.

103 (7) Analyses in silico de la région 5' des copies HcSKC1, Hc-h1-VIB et Hc-h1-VIC du gène SKC. La séquence en 5' de chacun des gènes HcSKC1, Hc-h1-VIB et Hc-h1-VIC est déterminée et analysée sur une longueur de 1 kb au moins en amont de l'ATG susceptible de correspondre au codon initiateur dans le gène HcSKC1 (ou du triplet correspondant dans les deux autres gènes). La Figure 4.13A présente une analyse concernant les 60 premiers nucléotides immédiatement en amont de cet ATG. Sur cette région, et les 27 nt qui la suivent, les séquences des deux gènes Hc-h1-VIB et Hc-h1-VIC s'alignent exactement entre eux, mais présentent des différences avec HcSKC1. Une différence essentielle s'observe au niveau de l'ATG initiateur potentiel de HcSKC1. Cet ATG (codant potentiellement le M du motif M-A-S-A-S-T-I) n'a pas de contrepartie dans Hc-h1-VIB et Hc-h1-VIC. Tout se passe comme si une délétion avait supprimé cet ATG, en décalant de plus le cadre de lecture (Figure 4.13A). La séquence nucléotidique en amont dans le cadre de lecture initial ne présente plus d'ATG, et ce cadre de lecture potentiel s'interrompt rapidement (présence d'un codon STOP à une vingtaine de nucléotides en amont) (Figure 4.13A). Il est troublant de constater que, sur la phase décalée, la séquence nucléotidique code potentiellement un motif M-A-S-S (autrement dit, une contrepartie au 3 résidus M-A-S du motif M-A-S-A-S-T-I identifiable dans l'analyse d'HcSKC1). De plus la séquence nucléotidique correspondant à ce motif M-A-S-S correspond aux 12 nucléotides strictement conservés dans cette région entre Hc-h1-VIB, Hc-h1-VIC et la quatrième copie de SKC, Hc-h1-V1. La Figure 4.13B compare les séquences des 3 gènes sur la région correspondant à environ 1 kb en amont de l'ATG initiateur potentiel de HcSKC1. Elle révèle que ces séquences sont très différentes d'un gène à l'autre, alors que les séquences en aval sont très fortement conservées (Cf. Figure 4.7). Seuls les gènes Hc-h1-VIB et Hc-h1-VIC présentent un certain niveau de conservation dans la région en amont de cet ATG "frontière", avec 5 zones de similarité détectables (Figure 4.13B).

(8) Analyse in silico de la région 5' du gène HcSKC1: recherche de similarités avec des gènes SKC identifiables chez d'autres champignons. Le génome d'une levure basidiomycète, Cryptococcus neoformans (pathogène opportuniste de l'homme) et celui d'un champignon basidiomycète filamenteux saprophyte, Coprinopsis cinerea, appartenant comme Hebeloma cylindrosporum aux Agaricales, ont été séquencés récemment (http://www.broad.mit.edu/annotation/fungi/cryptococcus_neoformans/ et http://www.broad.mit.edu/annotation/fungi/coprinus_cinereus/). L'annotation automatique du génome de C. neoformans identifie un gène (gi:50259918) codant un canal potassique Shaker homologue de HcSKC1. L'analyse du génome de C. cinerea identifie également un homologue d'HcSKC1. Nous avons aligné les séquences polypeptidiques de ces 3 canaux (Figure 4.14). L'alignement révèle la présence de motifs très conservés entre les 3 séquences en amont de la méthionine correspondant au premier ATG en phase

104 105 * HcSKC 1 ------MASASTIELSRLRR------PPPLS CcSKC 1 ------MGESVELFESRTR------PAPLD CnSKC 1 MPTNHAEQYELPAFPSSPEAGPSRLPRPQRRRASTWTKSRTLTLHPTTSAANLLFSAPSG

HcSKC 20 ----LRFFTEERPPQSPNDNND------SFPVSASYED------CcSKC 19 TTTTARRFTEEERPPSPRDLYE------VFPPSNSFDD------CnSKC 61 AFPATRQRHGRTRPQSNTDQSEEPRLHRATFLSEDPYDDSEEVDLPDFGHILGFNDEGED * HcSKC 48 --ESI-ALHPLWKRQLFKLMEQPTSSNSAFVIQMFSTFLIVFSALVTVLETVPAVHS--I CcSKC 51 --DVIYSIRPTWKRNLHFLLERPTTSQAAFVVHVFTTFLIVVSAIVTVLETVPAFHS--I CnSKC 121 HFAVASGMRTRWKRKLYLLMEEPASGREAFFVHIIVTGAIIFSAILTTLSTMPAFHMEPI S1

HcSKC 103 STRVWFGVETSVVALFTVEYIARCLAWSTTWMSLFRWMISFYGVIDLLSVLPYYLELMFL CcSKC 107 PLRIWFGMETTLVALFTIEYIARCVAWSFSWNALFHWVISFYGIIDLLSVLPYYIELALQ CnSKC 181 IIKALFGLDTTIVVLFTIEYLARSLAHSGSWAQYYSWATSFFGLLDLVAILPYYIEVAQN S2 S3

HcSKC 163 QDTSVYFRFSILRMFRLLRVFRPFRYNHTILLTMEVMYLSVRRSQHALLAIGFFVMMILT CcSKC 167 QDTSEFFRFSILRMFRLLRVFRPFRYNHTILMTIEVMYLSVQRSQHALLAIGFFVIMMLT CnSKC 241 EDTTILFRFSILRTFRLLRVFRAFKYQNQMLLTIEVMYVAVRRSRDALWALTFFIILVLV S4 S5

HcSKC 223 VFSTLLYFAERGTWDELLGTFINADGDPTQFSSIPAAAWFVLVTITTVGYGEITPRSFLG CcSKC 227 VFSTLLYFSERGSWDDVLNTFINSEGDPSQFSSIPAAAWFV-VTITTVGYGEITPRSFLG CnSKC 301 LFSTLIYFAERGTWDPSLSAFIDSDGDPSAFDSIPRTAWFSLVTMSTVGYGEVVPKSFLG Pore

HcSKC 283 RLITLPILVFGLLLITLPSFVLGREFSHVWEKMNSDR------KEGEDAGAGGEG CcSKC 286 RLITIPILVFGLLLITLPSFVLGREFSLVWHSMQKKV------RSS-NPTLSSLF CnSKC 361 KLLTIPLLMFGLLLIALPSFVLGRNFAIVFDAMTRQLPKNVSSRMPTPRESIEQTRTAQA S6

HcSKC 332 GSRSPTGMPSASAGRSARPPRSSRISRSGEDTEDPYGPSS-FYYSPAGYSSRRPDWERPF CcSKC 334 TDTFPYQKRREAAGASTSDPRSASRDSSDAILFGPYNPATPFMYPPMHIPISS------CnSKC 421 STDNIPLLPVSSQNTQTATPNGPSLSRPRSASPFPASGTVDQRAAFGNAPRMWQGGIDGT

HcSKC 391 GGVAAARDLTNLKLAQNQTELSRQIEELAGTVEVQGRLLRRLLEKL----DSS--TSDVG CcSKC 387 ---SASRDLTNMKLAQNQTELSHQIDELKGIVEEQGKLIGRLVDLL----EGRGYSSAVN CnSKC 481 GETKRERDLTNTKLAKNQLVLFEQIDALRQTIDKQGEMLARLTEMLNVKDKGKGPEKSKG

HcSKC 445 LLDSKVAGEAS--- CcSKC 440 GKGKEKERMGS--- CnSKC 541 LQEDHFALGDSGEE

106 Figure 4.14. Alignement des séquences prédites de HcSKC1 et de deux autres canaux fongiques. La séquence proposée pour HcSKC1 est celle déterminée par le premier ATG identifiable dans l'ADNc reconstitué par RLM-RACE (Cf. Figure 4.12; méthionine du motif M-A-S-A-S-T-I-E). Cette méthionine, et la méthionine suivante (qui correspond au premier ATG en phase dans l'ADNc initial) sont indiquées par un astérisque. La séquence de Cryptococcus neoformans est déposée dans NR (Juillet 2004) sous l'identifiant Geninfo gi:50259918. La séquence polypeptidique CcSKC1 est déduite de la séquence génomique non publiée de Coprinopsis cinerea. La séquence d'ADN codante est déterminée manuellement (par nous même) à partir de l'alignement des trois phases de lectures avec HcSKC, un épissage in silico respectant le consensus classique (les introns ont pour extrémités GT et AG, en 5’ et 3’ respectivement) et une optimisation de l'alignement avec HcSKC. L'alignement est réalisé avec Clustalw (http://www.ebi.ac.uk/clustalw/index.html) puis mis en forme avec le logitiel Boxshade (http://www.ch.embnet.org/software/ BOX_form.html). Les fonds noirs ou gris réfèrent respectivement à des acides aminés identiques ou similaires. La localisation des introns par rapport à la séquence codante est indiqué par des triangles au dessus de l’alignement des séquences pour HcSKC et CcSKC et en dessous pour CnSKC. Les triangles vides identifient des introns situés entre deux codons, et les triangles pleins identifient des introns interrompant un codon. Les gènes SKC d'H. cylindropsorum et de C. cinerea présentent une structure intron-exon strictement identique, avec la même localisation des introns au nucléotide près. Les séquences des 6 segments transmembranaires potentiels et du pore (Cf. Figure 4.2A et B) sont soulignées.

107 identifiable dans l'ADNc initial HcSKCi. De plus, l'alignement place la méthionine du motif N-terminal M-A-S-A-S-T-I-E (méthionine correspondant au premier ATG du clone identifié par RLM-RACE) en regard d'une méthionine (potentielle) du canal de C. cinerea. Enfin, la région correspondant à la quinzaine d'acides aminés en aval de ces deux méthionines présentent un certain niveau de conservation dans les 3 séquences alignées. Dans leur ensemble, ces similarités de séquences suggèrent que la région comprise entre le premier ATG du clone identifié par RLM-RACE et le premier ATG présent dans l'ADNc initial constitue de la séquence codante. Dans le cadre de cette hypothèse, en supposant que cet ATG est l'ATG initiateur du transcrit, la région cytoplasmique N-terminale en amont du premier segment transmembranaire aurait une longueur voisine de 70 aa chez HcSKC1 et son homologue chez C. cinerea, et de 150 aa chez le canal de C. neoformans. Le clone identifié par RLM-RACE ne possède que 5 nucléotides en amont de l'ATG correspondant à la méthionine du motif M-A-S-A-S-T-I-E. Cette longueur est insuffisante, dans le cadre de l'hypothèse présentée ci-dessus, pour permettre une initiation efficace du processus de traduction (Cf. Discussion). Autrement dit, la séquence non traduite identifiée du transcrit HcSKC1 (par le clone de RLM-RACE) serait encore incomplète en 5'.

4.2.8. Expression du gène HcSKC chez le champignon cultivé in vitro: effet de la disponibilité de K+ sur l'accumulation du transcrit Les souches monocaryotiques h1 et h7 et la souche dicaryotique D2 sont cultivées sur milieu liquide standard, en présence de K+ 4 mM ou en quasi-absence de cet ion (retrait des sels de potassium du milieu standard et ajout éventuel d'un chélateur de K+ à une concentration variable). Après extraction, les ARN totaux sont hybridés avec un sonde HcSKC1, puis avec une sonde HcEF1-α utilisée comme contrôle. Un autoradiogramme représentatif de 3 expériences différentes est montré sur la Figure 4.15. Quelle que soit la souche, le niveau d'accumulation du transcrit semble un peu moins élevé en présence qu'en absence de K+, mais les différences sont peu marquées. Une modification de la concentration de Na+ ou du pH du milieu de culture n'affecte pas non plus de façon notable le niveau d'accumulation du transcrit (données non montrées).

4.2.9. Essais d'expression fonctionnelle de HcSKC1 en système hétérologue

L'ovocyte de xénope constitue le système d'expression le plus classiquement utilisé pour caractériser des canaux sur le plan fonctionnel. Les séquences de la phase ouverte de lecture d'HcSKC1 démarrant au premier ATG soit de l'ADNc initial soit de l'ADNc obtenu par RLM-RACE sont clonées dans des vecteurs d'expression adapté à l'ovocyte de xénope. Deux vecteurs différents ont été testés: pCI (Promega) et pGEMHE (Liman et al., 1992). Dans le cas de pCI, la séquence

108 M M M M M µ µ µ µ µ

0 0 0 0 0 0 0 0 0 0 5 1 5 1 5

B B B B B P P P P P T T T T T A

& & & & &

K K K K K K K K K K K

milieu + - - - + - - - + - -

souche h1 h7 D2

HcSKC

HcEF1α

B 2

1 signal normalisé signal

Figure 4.15. Analyse par northern blot de l’effet de la disponibilité du potassium dans le milieu de culture sur l’accumulation des transcrits HcSKC chez le champignon isolé cultivé in vitro. Les trois souches h1, h7 et D2 d’Hebeloma cylindrosporum sont cultivées sur milieu P.O.M. pendant 15 jours. Les thalles sont alors transférés et cultivés pendant 4 jours sur l’un des 4 milieux suivant. Milieu + K: milieu P.O.M., dans lequel K+ (ajouté sous forme de KCl, -1 KH2PO4 et KOH) est présent à une concentration voisine de 4 mmol.L . Milieu –K: milieu + -1 P.O.M. dépourvu de K (KCl et KH2PO4 remplacés par 1 mmol.L de (NH4)HPO4). Milieux - K & TPB 500 et 100 µM: milieu - K additionné de 500 ou de 100 µmol.L-1 d'un chélateur de K+ appelé TPB (tetraphénylborate). A: Autoradiogrammes. Dix microgrammes d’ARN totaux sont hybridés avec une sonde HcSKC (autoradiogramme du haut). La membrane est ensuite dé-hybridée et re-hybridée avec la sonde HcEF1-α (autoradiogramme du bas). B: Quantification des signaux. Les signaux d’hybridation sont quantifiés à l’aide du logiciel ImageQuant (Amersham Biosciences). Pour chaque piste, l’intensité du signal obtenue avec la sonde HcSKC est rapportée à celle obtenue avec HcEF1-α. Ce rapport est ensuite normalisé par le rapport obtenu pour la souche h7 en présence de K+.

109 exogène est placée en aval du promoteur du cytomegalovirus (CMV) reconnu directement par la machinerie transcriptionnelle de l'ovocyte. La construction est injectée directement sous forme d'ADN plasmidique. Dans le cas de pGEMHE, la séquence est préalablement transcrite in vitro. Elle est placée en aval du promoteur de la T7 polymerase. Plusieurs injections dans des lots d'ovocytes indépendants avec des constructions utilisant pCI ou pGEMHE ont été effectuées, et les courants analysés par la technique du voltage-clamp à deux électrodes. Dans tous les cas, les ovocytes ne présentaient aucun courant exogène par rapport à des ovocytes contrôle (expériences réalisées par Sabine Zimmermann et Claire Corratgé dans l'équipe). La signification de cette absence d'expression fonctionnelle ne peut pas encore être discutée, et d'autres expériences sont prévues.

4.3. Discussion

4.3.1. HcSKC code une sous-unité de canal potassique proche de la sous-famille Shaker animale

L'analyse de la séquence d'HcSKC1 l'identifie clairement comme un membre de la superfamille Shaker, avec en particulier le domaine pore très conservé et le motif G-Y-G-E, signature des canaux sélectifs de K+, au sein du pore. Les canaux de la superfamille Shaker sont caractérisés par la présence d'une région hydrophobe constituée de 6 segments transmembranaires S1 à S6. Les régions de part et d'autre de ce cœur hydrophobe, qui constitue le canal sensu stricto, sont cytoplasmiques. Dans les canaux Shaker animaux, ces régions sont impliquées dans la régulation de l'activité du canal. La Figure 4.16 présente le profil d'hydrophobicité d'HcSKC1, en alignement avec les profils d'hydrophobicité d'un canal Shaker animal (Kv2.1, du xénope) et d'un canal Shaker végétal (AKT1 d'Arabidopsis). Cet alignement montre qu'HcSKC1 présente la structure hydrophobe caractéristique des polypeptides Shaker, mais que ses régions cytoplasmiques N- et C-terminales sont réduites par rapports au Shaker animal ou végétal. Autrement dit, le canal Shaker fongique HcSKC s'individualise clairement par rapport à ses homologues animaux et végétaux. La forte réduction de sa région cytoplasmique C-terminale pourrait traduire des mécanismes de régulation originaux.

4.3.2. Des gènes orthologues d'HcSKC existent chez d'autres espèces fongiques basidiomycètes

Des canaux de la superfamille Shaker sont caractérisés chez de nombreux organismes, procaryotes et eucaryotes animaux ou végétaux. La structure Shaker (6 segments transmembranaires S1 à S6 et un domaine pore identifiable par un motif signature G-Y-G-[DE], présent entre S5 et S6) est donc très répandue et conservée dans les différents règnes. Curieusement, le génome du premier organisme eucaryote séquencé, la

110 111 levure S. cerevisiae, ne présente pas de gène apparenté à la famille Shaker. Le seul canal potassique identifié chez cet organisme appartient à la famille TOK, qui est caractérisée par la présence d'un cœur hydrophobe constitué de 8 segments transmembranaires et de deux domaines pore, agencés en 2 modules: un premier module correspondant à la structure d'un Shaker, suivi d'un module constitué de deux segments transmembranaires encadrant un domaine pore. Les domaines pores de ces canaux sont très apparentés au domaine pore des canaux Shaker, avec en particulier la présence du motif poinçon G-Y-G-[DE]. D'autres structures de canaux potassiques existent chez les animaux et les plantes (Cf. Figure 4.1). Les canaux de type IRK présentent deux segments transmembranaires encadrant un pore, et les canaux de type TWIK/KCO présentent cette même structure répétée deux fois en tandem. Tous ces canaux présentent un domaine pore de type Shaker, avec son motif G-Y-G-[DE]. Les génomes d'une trentaine d'espèces fongiques sont aujourd'hui séquencés ou en cours de séquençage (http://www.ncbi.nlm.nih.gov/sutils/genom_table.cgi?organism= fungi). La recherche de similarité de séquence avec celle de HcSKC dans les différents génomes fongiques par le programme tBlastn révèle la présence de séquences susceptibles de former des domaines "pore de canal potassique" chez la plupart de ces espèces. En absence d'annotations (et de banques d'ADNc séquencées), les analyses in silico que nous avons faites suggèrent que ces domaines pore n'appartiendraient pas à la famille Shaker mais à la famille TOK. Dans ce contexte, nous nous sommes plus particulièrement intéressés aux 3 champignons basidiomycètes dont les génomes sont totalement séquencés: Coprinopsis cinerea (aussi appelé Coprinus cinereus; http://www.broad.mit.edu/ annotation/fungi/coprinus_cinereus/), Phanerochaete chrysosporium (Martinez et al., 2004) et Cryptococcus neoformans dont le génome est annoté (www.broad.mit.edu/annotation/fungi/cryptococcus_neoformans/). Ces 3 espèces présentent une copie (et une seule) d'un gène homologue de HcSKC1. Par contre, le génome du basidiomycète Ustilago maydis semble être dépourvu de gène Shaker. Enfin, aucun des ascomycètes dont le génome est complètement ou largement séquencé à ce jour, tels Neurospora crassa et Aspergillus nidulans, ne présente de canaux de type Shaker. La possession de ce type de canaux pourrait donc constituer un trait distinctif de quelques ordres de basidiomycètes.

4.3.3. Le gène HcSKC a été dupliqué plusieurs fois dans une souche ancestrale du monocaryon h1

La présence de plusieurs copies du gène SKC dans le génome de la souche h1 d'Hebeloma cylindrosporum (Cf. paragraphe 4.2.3., Figures 4.6 et 4.7) constitue une exception puisque la totalité des autres souches et espèces d'hébélomes analysées (à

112 l'exception des souches parentes de h1), ainsi que les espèces C. cinerea, P. chrysosporium et C. neoformans (Cf. ci-dessus) ne possèdent qu'une copie du gène SKC. L'analyse suggère que ces copies sont actives, et deux transcrits différents sont d'ores et déjà identifiés. Il est probable que les évènements de duplications qui ont généré cette complexité ont eu lieu relativement récemment. La séquence codante des différentes copies de ce gène apparaît comme extrêmement conservée mais une brusque transition dans le niveau de conservation se produit en 5' au niveau de la région codant potentiellement le motif M-A-S-A-S-T-I-E. En amont de cette région, les séquences deviennent très divergentes. Cette transition signifie peut-être que cette région du gène constitue l'extrémité de la phase codante en 5'.

4.3.4. Des incertitudes existent encore concernant la séquence 5' du transcrit et de la région N-terminale du polypeptide La présence de plusieurs copies du gène SKC dans la souche h1 a compliqué la caractérisation de ce gène. Concernant l'extrémité 5' du transcrit HcSKC1, il faut cependant noter que l'ATG correspondant à la méthionine du motif M-A-S-A-S-T-I-E n'a pas d'équivalent dans le second transcrit identifié, HcSKC2 (Cf. Figure 4.12). Bien que ce transcrit soit plus long qu'HcSKC1 d'au moins 15 nucléotides en 5', il ne présente aucun ATG dans cette région. D'autre part, dans le clone correspondant au transcrit HcSKC1 le plus long que nous avons obtenu (par RLM-RACE), l'ATG du motif M-A-S-A-S-T-I-E n'est précédé que de 5 nucléotides. Une telle position, très proche de l'extrémité 5', n'est en théorie pas susceptible d'initier efficacement la traduction (Kozak, 1991). Il est possible cependant qu'une structure secondaire du transcrit en aval favorise la traduction (Kozak, 1991). Dans ce contexte, notre hypothèse de travail est que la méthionine du motif M-A-S-A-S-T-I-E correspond à l'ATG initiateur du transcrit (Figure 4.17), mais il est clair que cette hypothèse reste à confirmer. Enfin, il est possible que les difficultés que nous avons eues dans l'identification de la région 5' des transcrits, la structure inhabituelle du transcrit HcSKC1 (si le clone obtenu par RLM-RACE correspond effectivement a un transcrit complet), et le fort niveau de variation des séquences des différentes copies dans la région correspondant au M-A-S-A-S-T-I-E traduisent l'existence de mécanismes de régulation originaux, intervenant spécifiquement dans la souche h1. Cette hypothèse pourra être testée en exprimant par transgénèse des fusions avec un gène rapporteur si le développement du programme de recherche sur le rôle du gène HcSKC dans la physiologie du champignon et la relation symbiotique conduit à s'intéresser particulièrement à des mécanismes de régulation.

113 1 gcttgATGGCCTCCGCCTCGACCATCGAACTTTCAAGACTCAGGCGACCGCCCCCGCTTTCGCTGCGCTTTTTTACTGAAGAACGCCCAC 90 1 MASASTIELSRLRRPPPLSLRFFTEERPP29

91 CACAATCTCCCAATGACAATAACGACTCATTTCCTGTGTCGGCGTCGTACGAAGACGAGTCGATCGCCTTACATCCACTATGGAAACGCC 180 30QSPNDNNDSFPVSASYEDESIALHPLWKRQ59

181 AGCTTTTCAAGCTCATGGAGCAGCCTACCTCGTCAAATTCGGCGTTCGTGATACAGATGTTCTCGACATTTCTTATTGTCTTCTCGGCGC 270 60LFKLM EQPTSSNSAFVIQMFSTFLIVFSAL89

271 TCGTTACGGTACTTGAAACAGTTCCAGCTGTTCATTCAATATCGACGAGGGTTTGGTTCGGGGTGGAGACGAGTGTGGTTGCATTGTTTA 360 90VTVLETVPAVHSISTRVWFGVETSVVALFT119

361 CGGTGGAATATATTGCGCGATGTCTTGCATGGAGTACGACATGGATGAGCCTTTTCCGATGGATGATTTCTTTCTACGGAGTCATCGATC 450 120VEYIARCLAWSTTWMSLFRWMISFYGVIDL149

451 TTTTGTCAGTGCTGCCGTACTATCTGGAGTTGATGTTCTTACAAGATACATCAGTTTACTTCAGATTCTCTATTCTTCGAATGTTTCGTC 540 150LSVLPYYLELMFLQDTSVYFRFSILRMFRL179

541 TCCTGCGGGTATTTCGGCCATTCCGTTACAACCACACAATTCTCCTCACGATGGAGGTCATGTACCTCTCAGTACGCCGTTCACAACACG 630 180LRVFRPFRYNHTILLTMEVMYLSVRRSQHA209

631 CCCTACTTGCCATTGGATTCTTCGTCATGATGATCCTCACCGTGTTCAGCACGTTATTGTATTTTGCAGAAAGAGGAACGTGGGACGAGT 720 210LLAIGFFVMMILTVFSTLLYFAERGTWDEL239

721 TGCTGGGTACCTTCATCAATGCGGATGGTGACCCTACACAGTTTTCATCCATTCCTGCTGCGGCTTGGTTCGTCCTCGTCACGATCACGA 810 240LGTFINADGDPTQFSSIPAAAWFVLVTITT269

811 CCGTCGGATACGGAGAAATTACACCGCGATCCTTTCTCGGTCGACTCATCACGCTGCCCATCCTTGTGTTCGGGCTCCTCTTAATTACAC 900 270VGYGEITPRSFLGRLITLPILVFGLLLITL299

901 TGCCGAGTTTCGTCCTTGGGCGCGAATTTAGTCACGTTTGGGAGAAAATGAATTCGGATCGGAAGGAGGGAGAAGATGCAGGTGCTGGCG 990 300PSFVLGREFSHVWEKMNSDRKEGEDAGAGG329

991 GTGAAGGAGGAAGTCGCAGCCCTACAGGGATGCCGAGTGCATCCGCAGGGAGATCAGCTCGACCTCCACGCTCCTCGCGAATATCACGCT 1080 330EGGSRSPTGMPSASAGRSARPPRSSRISRS359

1081 CTGGGGAGGATACCGAGGATCCTTATGGGCCTTCATCGTTTTATTACTCCCCCGCTGGCTATTCGTCTCGCAGGCCAGATTGGGAAAGGC 1170 360GEDTEDPYGPSSFYYSPAGYSSRRPDWERP389

1171 CGTTTGGTGGTGTGGCAGCTGCGAGGGACTTGACTAACTTGAAGTTGGCGCAAAACCAAACGGAGCTGAGTAGACAGATAGAGGAGTTGG 1260 390FGGVAAARDLTNLKLAQNQTELSRQIEELA419

1261 CCGGGACGGTCGAGGTCCAAGGGAGGTTGTTGAGGAGATTGTTGGAGAAACTAGATTCTTCGACGAGTGATGTGGGGTTGTTAGATTCGA 1350 420GTVEVQGRLLRRLLEKLDSSTSDVGLLDSK449

1351 AGGTAGCTGGAGAAGCTAGCTAAccttagggttggggatcttttttttatatttatggagacaatgggatatcgctaggattttgtaatg 1440 450VAGEAS* 455

1441 gtatctttggaggggcgaatataaataatacctacc 1476

Figure 4.17. Séquence de l'ADNc reconstitué par RACE-PCR. Une expérience de RACE-PCR visant à compléter la région 5' de l'ADNc initial permet d'amplifier une séquence soulignée en tirets, correspondant exactement à la région 5' du gène HcSKC décrit par la Figure 4.9, et à la région 5' de l'ADNc initial (zone de recouvrement indiquée par le surlignage en jaune). La présence dans la séquence amplifiée par RLM-PCR d'un codon ATG (indiqué en caractères gras) en phase avec le cadre de lecture de l'ADNc initial rallonge la séquence codante de l'ADNc de 7 codons (séquence polypeptidique correspondante écrite en bleu). Le codon stop est indiqué par un astérisque.

114 4.3.5. Conclusion et perspectives Les analyses de séquences indiquent que le gène HcSKC1 est particulièrement proche des premiers membres de la famille Shaker identifiés chez les animaux, qui constituent des canaux de type rectifiant sortant, autorisant un efflux de potassium sous l'effet d'une dépolarisation de la membrane. Il est raisonnable d'imaginer que cette proximité, au niveau de la séquence, traduit les mêmes caractéristiques fonctionnelles. HcSKC1 pourrait donc constituer un système de sécrétion de K+, et cette sécrétion pourrait se faire en direction de la plante hôte. En conclusion, HcSKC1 pourrait constituer le premier modèle d'étude, au niveau moléculaire, de la fonction de transfert d'ions minéraux nutritifs du champignon symbiotique vers la plante hôte. Dans ce contexte, les deux objectifs prioritaires, qui découlent immédiatement des résultats déjà disponibles, sont de parvenir à des certitudes concernant la séquence 5' des transcrits codés par les différentes copies d'HcSKC, et d'obtenir une description des caractéristiques fonctionnelles des canaux correspondants, après expression en système hétérologue. Au delà, il nous faudra aussi préciser la localisation au niveau cellulaire et subcellulaire de ces canaux (e.g. par hybridation ou PCR in situ, ou par expression de constructions utilisant la GFP en fusion avec le canal), et si possible caractériser le phénotype de mutants affectés dans l'expression de ce canal (par ARN-interférence, ou disruption du gène par un ADN-T).

115 116 5. Chapitre 5

Conclusion générale et perspectives

De nombreuses observations écophysiologiques et physiologiques indiquent que la mycorhization joue un rôle déterminant dans les écosystèmes forestiers, en particulier en améliorant la nutrition minérale de la plante hôte. Malgré l'importance biologique de ce phénomène, les mécanismes moléculaires supportant les échanges de signaux et de solutés nutritifs entre les 2 partenaires de la symbiose sont encore très peu connus. Ces dernières années ont vu cependant se développer les outils et ressources nécessaires à l'étude des mécanismes de la symbiose mycorhizienne par des approches de génétique moléculaire et fonctionnelle. De plus, l'adaptation aux champignons des techniques moléculaires telles que l'hybridation et la PCR in situ, l'inactivation de gène par ARN-interférence, les constructions de gènes rapporteurs et la transgénèse, devrait faire entrer la recherche sur la symbiose ectomycorhizienne dans une nouvelle ère. Il est clair que la réunion de l'ensemble de ces ressources, outils et nouvelles technologies va permettre d'orienter les études de plus en plus efficacement vers la compréhension des mécanismes de communication entre les deux organismes (reconnaissance et interaction, orientation du développement pour la mise en place de la structure symbiotique), et des mécanismes d'échange de nutriments et de leur régulation en fonction des conditions environnementales, édaphiques et climatiques. La production de la ressource d'étiquettes d'Hebeloma cylindrosporum, en collaboration avec le Laboratoire Génome et Développement des Plantes de Perpignan, participe clairement au développement préliminaire des outils nécessaires à ce type d'étude. La collection d'étiquettes et les analyses bioinformatiques effectuées, rendues accessibles sur le site de Génoplante-Info, ouvrent ainsi de nombreuses perspectives, à court et moyen terme. Dans le domaine des transports membranaires qui nous intéresse directement, nous avons identifié deux transporteurs de K+, un de type TRK et un de type Shaker. Le premier système est actuellement étudié dans l'équipe par Claire Corratgé et Sabine Zimmermann. Son aptitude à participer à la fonction d'absorption de potassium a été démontrée à la fois par complémentation d'une souche mutant de levure déficiente pour le transport de K+, et par analyse électrophysiologique après expression dans l'ovocyte de xénope. Le second système de transport de potassium identifié est celui produit par le

117 gène HcSKC (Cf. chapitre 4). Le fait que ce gène code un canal potassique ne fait pratiquement aucun doute au vu de sa séquence et de la conservation des motifs spécifiques "poinçons" de la superfamille Shaker. Nous n'avons pas encore pu obtenir de donnée fonctionnelle en système hétérologue, mais il est raisonnable de penser qu'il s'agit d'un canal de type sortant (séquence plus proche des canaux rectifiants sortant que des canaux entrants; Cf. Figure 4.4), permettant donc une excrétion de K+. Notre hypothèse de travail est que ces deux systèmes pourraient jouer un rôle dans la nutrition potassique du champignon et de la plante hôte, le premier en participant au prélèvement de K+ par les hyphes dans le sol, et le second en participant à la sécrétion de cet ion au niveau du réseau de Hartig en direction de la plante. Nous pourrions donc ainsi disposer de deux systèmes de transport permettant d'analyser l'intégration des fonctions de prélèvement et de sécrétion chez le champignon. La ressource d'étiquettes nous a également permis d'identifier des systèmes de transport de phosphate (étudiés par Claude Plassard, UMR Rhizosphère et Symbiose, en collaboration avec notre équipe) (Tatry, 2003). D'autres systèmes de transport identifiés par cette ressource sont également étudiés, comme par exemple des système impliqués dans le transport d'acides aminés ou d'oligopeptides (Daniel Wipf, communication personnelle).

Au delà des travaux qui sont en cours, la banque d'étiquettes et son analyse bioinformatique ouvrent des perspectives intéressantes en termes d'analyse du génome et de la régulation de son expression chez les champignons ectomycorhiziens. Une perspective majeure est effectivement l'analyse des génomes de ces champignons. Hebeloma cylindrosporum fera probablement partie des espèces modèles utilisées dans les études de la symbiose ectomycorhizienne, et il est raisonnable d'imaginer que son génome sera séquencé à terme. Les étiquettes produites et les contigs que nous avons définis seront alors particulièrement utiles pour l'annotation du génome. Il semble en effet que la présence de nombreux introns de petite taille, compliquant l'analyse in silico du génome, soit une caractéristique structurale de cette espèce, probablement partagée par les autres basidiomycètes. Dans le même ordre d'idée, un projet visant à séquencer le génome du champignon ectomycorhizien Laccaria bicolor est en cours. Une première séquence du génome est espérée dans le courant de l'année 2005. Il est probable que les étiquettes et contigs d'Hebeloma seront utiles à l'annotation de la séquence de ce génome. En retour, ce travail d'annotation du génome de Laccaria bicolor améliorera l'annotation des étiquettes d'Hebeloma. La banque d'étiquettes constitue également une ressource permettant de démarrer l'étude du transcriptome du champignon et les régulations de l'expression des gènes accompagnant l'établissement de la symbiose, ainsi que l'adaptation aux conditions environnementales et la communication avec la plante hôte. D'ores et déjà, des

118 expériences pourraient être faites pour obtenir une vue globale des modifications (d'une partie) du transcriptome entre différents individus (e.g. mutant sur expresseur d'auxine ou myc-), ou entre différentes conditions de culture (e.g. carence). Il est clair cependant que le développement de telles approches réclame implicitement la poursuite du programme de production d'étiquettes, en particulier à partir d'ARNm provenant d'ectomycorhizes.

* *

A plus long terme encore, il est probable que la biologie de la symbiose mycorhizienne s'intéressera à expliquer au niveau moléculaire les différences de statut, symbiotique ou saprophytique, d'espèces fongiques phylogénétiquement très proches. Dans ce domaine, la comparaison des génomes et transcriptomes de champignons ectomycorhiziens comme Hebeloma cylindrosporum ou saprophytes comme Coprinopsis cinerea, dont le génome est séquencé, constituera probablement une source importante d'information et d'hypothèses de travail. Cela pourra mener le biologiste à analyser ensuite le continuum entre mutualisme et parasitisme, et la palette des mécanismes moléculaires en jeu. On peut espérer que le développement des connaissances dans ce domaine conduira, sur le plan de la recherche appliquée, à des possibilités de sélection et d'amélioration de souches ectomycorhiziennes particulièrement intéressantes pour le développement des plantes hôtes et la productivité des écosystèmes forestiers.

119 120 6. Références bibliographiques

Ache P, Becker D, Ivashikina N, Dietrich P, Roelfsema MR, Hedrich R. 2000. GORK, a delayed outward rectifier expressed in guard cells of Arabidopsis thaliana, is a K+-selective, K+-sensing ion channel. FEBS Letters 486: 93-98. Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ. 1990. Basic Local Alignment Search Tool. Journal of Molecular Biology 215: 403-410. Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W, Lipman DJ. 1997. Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Research 25: 3389-3402. Anderson JA, Huprikar SS, Kochian LV, Lucas WJ, Gaber RF. 1992. Functional expression of a probable Arabidopsis thaliana potassium channel in Saccharomyces cerevisiae. Proceedings of the National Academy of Sciences of the United States of America 89: 3736-3740. Banuelos MA, Klein RD, Alexander-Bowman SJ, Rodriguez-Navarro A. 1995. A potassium transporter of the yeast Schwanniomyces occidentalis homologous to the Kup system of Escherichia coli has a high concentrative capacity. The EMBO Journal 14: 3021- 3027. Barber SA. 1984. Soil nutrient bioavailability. A mechanistic approach. New York USA: John Wiley & Sons Inc. Barrett-Lennard EG, Robson AD, Greenway H. 1982. Effect of phosphorus deficiency and water deficit on phosphatase activities from wheat leaves. Journal of Experimental Botany 33: 682-693. Becker D, Hoth S, Ache P, Wenkel S, Roelfsema MR, Meyerhoff O, Hartung W, Hedrich R. 2003. Regulation of the ABA-sensitive Arabidopsis potassium channel gene GORK in response to water stress. FEBS Letters 554: 119-126. Berthomieu P, Conejero G, Nublat A, Brackenbury WJ, Lambert C, Savio C, Uozumi N, Oiki S, Yamada K, Cellier F, Gosti F, Simonneau T, Essah PA, Tester M, Very AA, Sentenac H, Casse F. 2003. Functional analysis of AtHKT1 in Arabidopsis shows that Na+ recirculation by the phloem is crucial for salt tolerance. The EMBO Journal 22: 2004-2014.

Bertl A, Reid JD, Sentenac H, Slayman CL. 1997. Functional comparison of plant inward-rectifier channels expressed in yeast. Journal of Experimental Botany 48: 405-413.

Burger C, Ribera AB. 1996. Xenopus spinal neurons express Kv2 potassium channel transcripts during embryonic development. The Journal of Neuroscience 16: 1412-1421. Chalot M, Javelle A, Blaudez D, Lambilliote R, Cooke R, Sentenac H, Wipf D, Botton B. 2002. An update on nutrient transport process in ectomycorrhizas. Plant and Soil 244: 165-175.

121 Clarkson DT, Hanson JB. 1980. The mineral nutrition of higher plants. Annual Review of Plant Physiology 31: 239-298. Clarkson DT. 1985. Factors affecting mineral nutrient acquisition by plants. Annual Review of Plant Physiology 36: 77-115. Corratgé C. 1999. Identification et caractérisation d'un transporteur de la famille TRK chez le champignon ectomycorhizien Hebeloma cylindrosporum. Rapport de DEA, 24 pp., Université de Montpellier 2. Czempinski K, Zimmermann S, Ehrhardt T, Müller-Röber B. 1997. New structure and function in plant K+ channels: KCO1, an outward rectifier with a steep Ca2+ dependency. The EMBO Journal 16: 2565-2575. Czempinski K, Gaedeke N, Zimmermann S, Müller-Röber B. 1999. Molecular mechanisms and regulation of plant ion channels. Journal of Experimental Botany 50: 955- 966. Czempinski K, Frachisse JM, Maurel C, Barbier-Brygoo H, Müller-Röber B. 2002. Vacuolar membrane localization of the Arabidopsis "two-pore" K+ channel KCO1. The Plant Journal 29: 809-820. Debaud JC, Gay G. 1987. In vitro fruiting under controlled conditions of the ectomycorrhizal fungus Hebeloma cylindrosporum associated with Pinus pinaster. New Phytologist 105: 429-435. Doyle DA, Cabral JM, Pfuetzner RA, Kuo AL, Gulbis JM, Cohen SL, Chait BT, Mackinnon R. 1998. The structure of the potassium channel: Molecular basis of K+ conduction and selectivity. Science 280: 69-77. Dreyer I, Horeau C, Lemaillet G, Zimmermann S, Bush DR, Rodriguez-Navarro A, Schachtman DP, Spalding EP, Sentenac H, Gaber RF. 1999. Identification and characterization of plant transporters using heterologous expression systems. Journal of Experimental Botany 50: 1073-1087. Dreyer I, Michard E, Lacombe B, Thibaud J-B. 2001. A plant Shaker-like K+ channel switches between two distinct gating modes resulting in either inward-rectifying or "leak" current. FEBS Letters 505: 233-239. Durall DM, Jones MD, Tinker PB. 1994. Allocation of 14C-carbon in ectomycorrhizal willow. New Phytologist 128: 109-114. Durell SR, Guy HR. 1999. Structural models of the KtrB, TrkH, and Trk1, 2 symporters based on the structure of the KcsA K+ channel. Biophysical Journal 77: 789- 807.

Eisenman G. 1961. On the elementary atomic origin of equilibrium ionic specificity. A. Kleinzeller, Dans eds Membrane transport and metabolism. London: London Academic, p.163-179.

Epstein E, Rains DW, Elzam OE. 1963. Resolution of dual mechanisms of potassium absorption by barley roots. Proceedings of the National Academy of Sciences of the United States of America 89: 3736-3740. Ewing B, Hillier L, Wendl MC, Green P. 1998. Base-calling of automated sequencer traces using phred. I. Accuracy assessment. Genome Research 8: 175-185. Fu HH, Luan S. 1998. AtKuP1: a dual-affinity K+ transporter from Aradidopsis. The Plant Cell 10: 63-73.

122 Gaber RF, Styles CA, Fink GR. 1988. TRK1 encodes a plasma membrane protein required for high-affinity potassium transport in Saccharomyces cerevisiae. Molecular and Cellular Biology 8: 2848-2859. Gassmann W, Rubio F, Schroeder JI. 1996. Alkali cation selectivity of the wheat root high-affinity potassium transporter HKT1. The Plant Journal 10: 869-882. Gaymard F, Cerutti M, Horeau C, Lemaillet G, Urbach S, Ravallec M, Devauchelle G, Sentenac H, Thibaud JB. 1996. The baculovirus/insect cell system as an alternative to Xenopus oocytes. First characterization of the AKT1 K+ channel from Arabidopsis thaliana. Journal of Biological Chemistry 271: 22863-22870. Gaymard F, Pilot G, Lacombe B, Bouchez D, Bruneau D, Boucherez J, Michaux- Ferriere N, Thibaud JB, Sentenac H. 1998. Identification and disruption of a plant shaker-like outward channel involved in K+ release into the xylem sap. Cell 94: 647-655. Glémet E, Codani JJ. 1997. LASSAP, a LArge Scale Sequence compArison Package. Computer Applied Bioscience 13: 137-143. Harley JL, Smith SE. 1983. Physiology of ectomycorrhizas. Nutrient uptake. Dans eds Mycorrhizal symbiosis. London: Academic press, p.201-230. Harley JL. 1984. The mycorrhizal symbiosis. In Intercellular interactions. Berlin: Springer-Verlag. Hirsch RE, Lewis BD, Spalding EP, Sussman MR. 1998. A role for the AKT1 potassium channel in plant nutrition. Science 280: 918-921. Hosy E, Vavasseur A, Mouline K, Dreyer I, Gaymard F, Poree F, Boucherez J, Lebaudy A, Bouchez D, Very AA, Simonneau T, Thibaud JB, Sentenac H. 2003. The Arabidopsis outward K+ channel GORK is involved in regulation of stomatal movements and plant transpiration. Proceedings of the National Academy of Sciences of the United States of America 100: 5549-5554. Huang X, Madan A. 1999. CAP3: A DNA sequence assembly program. Genome Research 9: 868-877. Ichida AM, Pei Z-M, Baizabal-Aguirre VM, Turner KJ, Schroeder JI. 1997. Expression of a Cs+-resistant guard cell K+ channel confers Cs+-resistant, light-induced stomatal opening in transgenic Arabidopsis. The Plant Cell 9: 1843-1857. Jan LY, Jan YN. 1997. Cloned potassium channels from eukaryotes and prokaryotes. Annual Review of Neuroscience 20: 91-123. Jargeat P. 1999. Caractérisation et manipulation génétique de la voie d'assimilation du nitrate du champignon symbiotique Hebeloma cylindrosporum. Thèse de Doctorat, 164 pp., Université Claude Bernard.

Jargeat P, Gay G, Debaud JC, Marmeisse R. 2000. Transcription of a nitrate reductase gene isolated from the symbiotic basidiomycete fungus Hebeloma cylindrosporum does not require induction by nitrate. Molecular and General Genetics 263: 948-956.

Jargeat P, Rekangalt D, Verner MC, Gay G, Debaud JC, Marmeisse R, Fraissinet-Tachet L. 2003. Characterisation and expression analysis of a nitrate transporter and nitrite reductase genes, two members of a gene cluster for nitrate assimilation from the symbiotic basidiomycete Hebeloma cylindrosporum. Current Genetics 43: 199-205.

123 Javelle A, Morel M, Rodriguez-Pastrana BR, Botton B, Andre B, Marini AM, Brun A, Chalot M. 2003. Molecular characterization, function and regulation of ammonium transporters (Amt) and ammonium-metabolizing enzymes (GS, NADP-GDH) in the ectomycorrhizal fungus Hebeloma cylindrosporum. Molecular Microbiology 47: 411-430. Jongmans AG, Van Breemen N, Landström U, Van Hees PAW, Finlay RD, Srinivasan M, Unestam T, Giesler R, Melkerud PA, Olsson M. 1997. Rock-eating fungi. Nature 389: 682-683. Ketchum KA, Joiner WJ, Sellers AJ, Kaczmarek LK, Goldstein SAN. 1995. A new family of outwardly rectifying potassium channel proteins with two pore domains in tandem. Nature 376: 690-695. Kim EJ, Kwak JM, Uozumi N, Schroeder JI. 1998. AtKUP1: an Arabidopsis gene encoding high-affinity potassium transport activity. The Plant Cell 10: 51-62. Ko CH, Gaber RF. 1991. TRK1 and TRK2 encode structurally related K+ transporters in Saccharomyces cerevisiae. Molecular and Cellular Biology 11: 4266-4273. Kochian LV, Lucas WJ. 1988. Potassium transport in roots. Advances in Botanical Research 15: 136-151. Kozak M. 1991. A short leader sequence impairs the fidelity of initiation by eukaryotic ribosomes. Gene Expression 1: 111-115. Kubo Y, Baldwin TJ, Jan YN, Jan LY. 1993. Primary structure and functional expression of a mouse inward rectifier potassium channel. Nature 362: 127-133. Lacombe B, Pilot G, Michard E, Gaymard F, Sentenac H, Thibaud J-B. 2000. A shaker-like K+ channel with weak rectification is expressed in both source and sink phloem tissues of Arabidopsis. The Plant Cell 12: 837-851. Lambilliotte R, Cooke R, Samson D, Fizames C, Gaymard F, Plassard C, Tatry M-V, Berger C, Laudie M, Legeai F, Karsenty E, Delseny M, Zimmermann S, Sentenac H. 2004. Large-scale identification of genes in the fungus Hebeloma cylindrosporum paves the way to molecular analyses of ectomycorrhizal symbiosis. New Phytologist 164: 505-513. Le Tacon F. 1985. Les mycorhizes: une coopération entre plantes et champignons. La Recherche 166: 624-632. Lesage F, Guillemare E, Fink M, Duprat F, Lazdunski M, Romey G, Barhanin J. 1996. TWIK-1, a ubiquitous human weakly inward rectifying K+ channel with a novel structure. The EMBO Journal 15: 1004-1011. Lichtenberg-Fraté H, Reid JD, Heyer M, Hofer M. 1996. The SpTRK gene encodes a potassium-specific transport protein TKHp in Schizosaccharomyces pombe. Journal of Membrane Biology 152: 169-181.

Liman ER, Tytgat J, Hess P. 1992. Subunit stoichiometry of a mammalian K+ channel determined by construction of multimeric cDNAs. Neuron 9: 861-871.

Maathuis FJM, Sanders D. 1994. Mechanism of high-affinity potassium uptake in roots of Arabidopsis thaliana. Proceedings of the National Academy of Sciences of the United States of America 91: 9272-9276. Maathuis FJM, Sanders D. 1996. Mechanisms of potassium absorption by higher plant roots. Physiologia Plantarum 96: 158-168.

124 Marmeisse R, Guidot A, Gay G, Lambilliotte R, Sentenac H, Combier J-P, Melayah D, Fraissinet-Tachet L, Debaud JC. 2004. Hebeloma cylindrosporum - a model species to study ectomycorrhizal symbiosis from gene to ecosystem. New Phytologist 163: 481-498. Marschner H, Dell B. 1994. Nutrient uptake in mycorrhizal symbiosis. Plant and Soil 159: 89-102. Marten I, Hoth S, Deeken R, Ache P, Ketchum KA, Hoshi T, Hedrich R. 1999. AKT3, a phloem-localized K+ channel, is blocked by protons. Proceedings of the National Academy of Sciences of the United States of America 96: 7581-7586. Martinez D, Larrondo LF, Putnam N, Gelpke MD, Huang K, Chapman J, Helfenbein KG, Ramaiya P, Detter JC, Larimer F, Coutinho PM, Henrissat B, Berka R, Cullen D, Rokhsar D. 2004. Genome sequence of the lignocellulose degrading fungus Phanerochaete chrysosporium strain RP78. Nature Biotechnology 22: 695-700. Mäser P, Eckelman B, Vaidyanathan R, Horie T, Fairbairn DJ, Kubo M, Yamagami M, Yamaguchi K, Nishimura M, Uozumi N, Robertson W, Sussman MR, Schroeder JI. 2002. Altered shoot/root Na+ distribution and bifurcating salt sensitivity in Arabidopsis by genetic disruption of the Na+ transporter AtHKT1. FEBS Letters 531: 157- 161. Minet M, Dufour ME, Lacroute F. 1992. Complementation of Saccharomyces cerevisiae auxotrophic mutants by Arabidopsis thaliana cDNAs. The Plant Journal 2: 417- 422. Montanini B, Moretto N, Soragni E, Percudani R, Ottonello S. 2002. A high- affinity ammonium transporter from the mycorrhizal ascomycete Tuber borchii. Fungal Genetics and Biology 36: 22-34. Morizet J, Mingeau M. 1976. Influence des facteurs du milieu sur l'absorption hydrique (étude effectuée sur tomate décapitée en exudation). I. Facteurs nutritionnels. Annales Agronomiques 27: 183-205. Mouline K, Very AA, Gaymard F, Boucherez J, Pilot G, Devec M, Bouchez D, Thibaud JB, Sentenac H. 2002. Pollen tube development and competitive ability are impared by disruption of a shaker K+ channel in Arabidopsis. Genes and Development 16: 339-350. Paris F, Bonnaud P, Ranger J, Lapeyrie F. 1995. In vitro weathering of phlogopite by ectomycorrhizal fungi. I. Effect of K+ and Mg2+ deficiency on phyllosilicate evolution. Plant and Soil 177: 191-201. Penning de Vries FWT. 1975. The cost of maintenance processes in plant cells. Annals of Botany 39: 77-92.

Pilot G, Gaymard F, Mouline K, Chérel I, Sentenac H. 2003. Regulated expression of Arabidopsis Shaker K+ channel genes involved in K+ uptake and distribution in the plant. Plant Molecular Biology 51: 773-787.

Quattrocki EA, Marshall J, Kaczmarek LK. 1994. A Shab potassium channel contributes to action potential broadening in peptidergic neurons. Neuron 12: 73-86.

Quintero FJ, Blatt MR. 1997. A new family of K+ transporters from Arabidopsis that are conserved across phyla. FEBS Letters 415: 206-211. Rapior S, Andary C, Mousain D. 1987. Cortinarius section orellani: isolation and culture of Cortinarius orellanus. Transactions of British Mycological Society B9: 41-44.

125 Reid CPP, Kidd FA, Ekwebelam SA. 1983. Nitrogen nutrition, photosynthesis and carbon allocation in ectomycorrhizal pine. Plant and Soil 71: 415-432. Roberts SK. 2003. TOK homologue in Neurospora crassa: first cloning and functional characterization of an ion channel in a filamentous fungus. Eukaryotic Cell 2: 181-190. Rodriguez-Navarro A, Ramos J. 1984. Dual system for potassium transport in Saccharomyces cerevisiae. Journal of Bacteriology 159: 940-945. Rodriguez-Navarro A, Blatt MR, Slayman CL. 1986. A potassium-proton symport in Neurospora crassa. The Journal of General Physiology 87: 649-674. Rubio F, Gassmann W, Schroeder JI. 1995. Sodium-driven potassium uptake by the plant potassium transporter HKT1 and mutations confering salt tolerance. Science 270: 1660-1663. Rygiewicz PT, Bledsoe CS. 1984. Mycorrhizal effects on potassium fluxes by northwest coniferous seedlings. Plant Physiology 76: 918-923. Rygiewicz PT, Andersen CP. 1994. Mycorrhizae alter quality and quantity of carbon allocated below ground. Nature 369: 58-60. Santa-Maria GE, Rubio F, Dubcovsky J, Rodriguez-Navarro A. 1997. The HAK1 gene of barley is a member of a large gene family and encodes a high-affinity potassium transporter. The Plant Cell 9: 2281-2289. Schachtman DP, Schroeder JI. 1994. Structure and transport mechanism of a high- affinity potassium uptake transporter from higher plants. Nature 370: 655-658. Schiestl RH, Gietz RD. 1989. High efficiency transformation of intact yeast cells using single stranded nucleic acids as a carrier. Current Genetics 16: 339-346. Schönknecht G, Spoormaker P, Steinmeyer R, Brüggeman L, Ache P, Dutta R, Reintanz B, Godde M, Hedrich R, Palme K. 2002. KCO1 is a component of the slow- vacuolar (SV) ion channel. FEBS Letters 511: 28-32. Schroeder JI, Ward JM, Gassmann W. 1994. Perspective on the physiology and structure of inward-rectifying K+ channels in higher plants: biophysical implications for K+ uptake. Annual Review of Biophysics and Biomolecular Structure 23: 441-471. Selosse MA, Le Tacon F. 1999. Les champignons dopent la forêt. La Recherche 319: 33-35. Sentenac H, Bonneaud N, Minet M, Lacroute F, Salmon JM, Gaymard F, Grignon C. 1992. Cloning and expression in yeast of a plant potassium ion transport system. Science 256: 663-665.

Slayman CL. 1965. Electrical properties of Neurospora crassa. Effects of external cations on the intracellular potential. The Journal of General Physiology 49: 69-92.

Smith SE, Read DJ. 1997. Mycorrhizal symbiosis. San Diego, USA: Academic Press. Stein WD. 1990. Channels, carriers and pumps: an introduction to membrane transport. San Diego, USA: Academic Press.

126 Stephens RM, Schneider TD. 1992. Features of spliceosome evolution and function inferred from an analysis of the information at human splice sites. Journal of Molecular Biology 228: 1124-1136. Stotz A, Linder P. 1990. The ADE2 gene from Saccharomyces cerevisiae: sequence and new vectors. Gene 95: 91-98. Tatry MV. 2003. Analyse moléculaire des effets bénéfiques de la symbiose ectomycorhizienne sur la nutrition phosphatée de l'hôte: identification de deux systèmes de transport de Pi chez le basidiomycète Hebeloma cylindrosporum. Thèse de Doctorat, 80 pp., Université de Montpellier 2. Thomas BJ, Rothstein R. 1989. Elevated recombination rates in transcriptionally active DNA. Cell 56: 619-630. Thompson JD, Higgins DG, Gibson TJ. 1994. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Research 22: 4673-4680. Tschumper G, Carbon J. 1980. Sequence of a yeast DNA fragment containing a chromosomal replicator and the TRP1 gene. Gene 10: 157-166.

Uozomi N, Kim EJ, Rubio F, Yamagushi T, Muto S, Tsuboi A, Bakker EP, Nakamura T, Schroeder JI. 2000. The Arabidopsis HKT1 gene homolog mediates inward Na+ currents in Xenopus leavi oocytes and Na+ uptake in Saccharomyces cerevisiae. Plant Physiology 122: 1249-1259. van Kan JA, van den Ackerveken GF, de Wit PJ. 1991. Cloning and characterization of cDNA of avirulence gene avr9 of the fungal pathogen Cladosporium fulvum, causal agent of tomato leaf mold. Molecular Plant-Microbe Interactions 4: 52-59.

Véry AA, Sentenac H. 2003. Molecular mechanisms and regulation of K+ transport in higher plants. Annual Review of Plant Biology 54: 575-603. Walker NA, Sanders D, Maathuis FJM. 1996. High-affinity potassium uptake in plants. Science 273: 977-979. Wipf D, Benjdia M, Tegeder M, Frommer WB. 2002. Characterization of a general amino acid permease from Hebeloma cylindrosporum. FEBS Letters 528: 119-124. Zimmermann S, Sentenac H. 1999. Plant ion channels: from molecular structures to physiological functions. Current Opinion in Plant Biology 2: 477-482.

127

Développement d'outils et de ressources moléculaires pour l'utilisation de l'espèce Hebeloma cylindrosporum comme modèle d'étude de la symbiose ectomycorhizienne. La symbiose mycorhizienne concerne la majorité des espèces végétales et constitue un phénomène biologique majeur dans les écosystèmes terrestres. Une de ses fonctions essentielles est l'amélioration de la nutrition minérale de la plante hôte. Le partenaire fongique prélève des nutriments minéraux dans le sol et les transmet à la plante. Bien qu'ils soient au cœur de l'interaction symbiotique, les mécanismes de transport membranaire responsables de ces échanges sont encore peu caractérisés sur le plan moléculaire. Le programme dans lequel s'inscrit notre travail a pour objectif d'identifier de tels transporteurs chez le champignon ectomycorhizien Hebeloma cylindrosporum, puis de préciser la fonction que ces systèmes jouent dans les échanges de solutés avec la plante hôte. H. cylindrosporum est susceptible de devenir un modèle très intéressant parce qu'il se prête aux analyses génétiques, avec un cycle biologique entièrement maîtrisé in vitro. Notre premier objectif a été de produire une banque d'ADNc puis, par séquençage systématique et analyse in silico, une ressource d'EST ("Expressed Sequenced Tags"). Nous avons ainsi identifié environ 2700 transcrits (après assemblage in silico des séquences), et mis cette ressource ainsi que son analyse bioinformatique à la disposition de la communauté scientifique sur un site web. L'analyse bioinformatique a révélé un grand nombre de systèmes de transport membranaire potentiels au sein de cette ressource. Nous nous sommes intéressés en particulier à un gène codant un canal potassique de type Shaker, que nous avons appelé HcSKC (pour H. cylindrosporum Shaker K+ Channel). Après criblage d'une banque d'ADN génomique provenant de la souche h1 d'Hebeloma, nous avons identifié plusieurs copies de ce gène et analysé leur structure. Nous montrons que la présence de plusieurs copies d'HcSKC (qui accroît la difficulté des analyses expérimentales et bioinformatiques) est une caractéristique de la souche h1 puisque d'autres souches ainsi que d'autres espèces d'hébélomes ne présentent qu'une seule copie de ce gène. Sur la base de sa séquence, le canal codé par HcSKC est susceptible de jouer un rôle dans la sécrétion de K+ par le champignon en direction de la plante. Cette hypothèse devra être vérifiée par expression fonctionnelle en système hétérologue.

Mot clés: Symbiose, Ectomycorhize, Hebeloma cylindrosporum, Banque d'ADNc, Ressource EST, Transporteurs membranaires, Canal potassique, Shaker, Duplication de gène

Development of tools and molecular resources for studies using Hebeloma cylindrosporum species as a model of ectomycorrhizal symbiosis. Most plant species establish mycorrhizal symbiosis, which represents a major biological phenomenon in terrestrial ecosystems. Improvement of host plant mineral nutrition appears as an essential function of this interaction. The fungal partner absorbs mineral nutrients from the soil and transfers part of them to the host plant. While membrane transport systems play thereby a key role in the symbiotic interaction, very few of them are characterised on a molecular level. The objective of this project is to identify such transport systems in the ectomycorrhizal fungus Hebeloma cylindrosporum and then to characterise their function in the exchange of solutes with the plant host. Hebeloma cylindrosporum will possibly become an interesting model as genetic analysis are feasible (e.g. the whole cycle, from spore to spore, can be achieved in vitro). Our first goal was to produce a cDNA library, and then to establish, by systematic sequencing and in silico analysis, an EST database (Expressed Sequence Tag). We identified approximately 2700 transcripts after in silico clustering. This database and its analysis is accessible to the scientific community via a web site. Bioinformatic analysis revealed a large number of putative transport systems in this database. We focalised our interest on one gene encoding a Shaker potassium channel named HcSKC (for H. cylindrosporum Shaker K+ Channel). After screening of a genomic DNA library from Hebeloma h1 strain, several copies of this gene were identified and analysed regarding their structure. We show that multicopy HcSKC sequences (that hampered experimental and bioinformatic analyses) are typical of h1 strain, whereas other Hebeloma strains and species possess a single copy. Based on sequence analysis, HcSKC code for an outward channel, that might thus be involved in fungal K+ secretion towards the host plant. This hypothesis will be verified by functional expression in heterologous systems.

Key words: Symbiosis, Ectomycorrhiza, Hebeloma cylindrosporum, cDNA library, EST database, Membrane transporters, Potassium channel, Shaker, Gene duplication