Metabolic Disease
Metabolic diseases is defined by a constellation of interconnected physiological, biochemical, clinical, and metabolic factors that directly increases the risk of cardiovascular disease, type 2 diabetes mellitus, and all cause mortality. Associated conditions include hyperuricemia, fatty liver (especially in concurrent obesity) progressing to nonalcoholic fatty liver disease, polycystic ovarian syndrome (in women), erectile dysfunction (in men), and acanthosis nigricans. Metabolic disease modeling is an essential component of biomedical research and a mandatory prerequisite for the treatment of human disease. Somatic genome editing using CRISPR/Cas9 might be used to establish novel metabolic disease models.
www.MedChemExpress.com 1 Metabolic Disease Inhibitors & Modulators
(-)-(S)-Equol (-)-Fucose Cat. No.: HY-100583 (6-Desoxygalactose; L-(-)-Fucose; L-Galactomethylose) Cat. No.: HY-N1480
Bioactivity: (-)-(S)-Equol is a high affinity ligand for estrogen receptor Bioactivity: (-)-Fucose is classified as a member of the hexoses, plays a role in A and B blood group antigen substructure β with a Ki of 0.73 nM. determination, selectin-mediated leukocyte-endothelial adhesion, and host-microbe interactions.
Purity: 99.82% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg 100 mg
(-)-PX20606 trans isomer (24R)-MC 976 ((-)-PX-102 trans isomer; (-)-PX-104) Cat. No.: HY-100443B Cat. No.: HY-15267A
Bioactivity: (-)-PX20606 trans isomer is a FXR agonist with EC50s of 18 Bioactivity: (24R)-MC 976 is a Vitamin D3 derivative. and 29 nM for FXR in FRET and M1H assay, respectively.
Purity: 98.39% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg 1 mg, 2 mg
(24S)-MC 976 (R)-(+)-Etomoxir sodium salt Cat. No.: HY-15267B ((+)-Etomoxir sodium salt) Cat. No.: HY-50202A
Bioactivity: (24S)-MC 976 is a Vitamin D3 derivative. Bioactivity: (R)-(+)-Etomoxir sodium salt is the R-form of Etomoxir sodium salt. Etomoxir is a potent inhibitor of carnitine palmitoyltransferase-I ( CPT-1).
Purity: >98% Purity: 99.94% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg Size: 10mM x 1mL in Water, 5 mg, 10 mg, 50 mg
(R)-(-)-Phenylephrine (R,S)-Ivosidenib (Phenylephrine) Cat. No.: HY-B0769 ((R,S)-AG-120) Cat. No.: HY-18767A
Bioactivity: (R)-(-)-Phenylephrine is a selective α1-adrenoceptor agonist Bioactivity: (R,S)-Ivosidenib is a inhibitor of Isocitrate Dehydrogenase primarily used as a decongestant. (IDH1).
Purity: >98% Purity: 99.40% Clinical Data: Launched Clinical Data: No Development Reported Size: 200 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
(S)-2-Hydroxy-3-phenylpropanoic acid (S)-2-Hydroxysuccinic acid Cat. No.: HY-30220 Cat. No.: HY-Y1069
Bioactivity: (S)-2-Hydroxy-3-phenylpropanoic acid, a product of Bioactivity: (S)-2-Hydroxysuccinic acid is a dicarboxylic acid in naturally phenylalanine catabolism, is a NAPDH oxidase inhibitor. occurring form, contributes to the pleasantly sour taste of fruits and is used as a food additive.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg 5 g
2 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
(±)-Carnitine chloride (±)-SLV319 (DL-Carnitine chloride) Cat. No.: HY-B1453 ((±)-Ibipinabant; (±)-BMS6462) Cat. No.: HY-14791A
Bioactivity: (±)-Carnitine chloride exists in two isomers, known as D and Bioactivity: (±)-SLV319 is the racemate of SLV319. SLV319 is a potent and L. L-carnitine plays an essential role in the β-oxidation of selective cannabinoid-1 ( CB-1) receptor antagonist with an
fatty acids and also shows antioxidant, and anti-inflammatory IC50 of 22 nM. activities.
Purity: 98.0% Purity: 99.49% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 10mM x 1mL in DMSO, 5 g 5 mg, 10 mg, 50 mg, 100 mg
1,2-Distearoyl-sn-glycero-3-phosphorylethanolamine 1,5-Anhydrosorbitol (1,2-DSPE) Cat. No.: HY-112530 Cat. No.: HY-113075
Bioactivity: 1,2-Distearoyl-sn-glycero-3-phosphorylethanolamine (DSPE) is a Bioactivity: 1,5-Anhydrosorbitol is a short-term marker for glycemic phosphoethanolamine (PE) lipid that can be used in the control. synthesis of liposomes.
Purity: 97.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 100 mg
1-Deoxynojirimycin 1-Methyl-L-histidine (Duvoglustat) Cat. No.: HY-14860 Cat. No.: HY-W017006
Bioactivity: 1-Deoxynojirimycin (DNJ, Duvoglustat) is a potent Bioactivity: 1-Methyl-L-histidine is an objective indicator of meat α-glucosidase inhibitor, suppresses postprandial blood ingestion and exogenous 3-methylhistidine (3MH) intake. glucose, thereby possibly preventing diabetes mellitus.
Purity: 98.0% Purity: 98.0% Clinical Data: Phase 2 Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg 10 mg, 25 mg
1-Methyluric acid 10Z-Nonadecenoic acid Cat. No.: HY-W010031 Cat. No.: HY-113450
Bioactivity: 1-Methyluric acid acts on the urinary bladder mucosa and Bioactivity: 10Z-Nonadecenoic acid is a kind of long-chain fatty acid with increases the blood glucose, insulin, triglyceride, and anti-tumor activity. cholesterol levels.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size:
11-oxo-mogroside V 18-Hydroxycorticosterone Cat. No.: HY-N0501 Cat. No.: HY-W013179
Bioactivity: 11-oxo-mogroside V is a natural sweetener, isolated from the Bioactivity: 18-Hydroxycorticosterone is a corticosteroid and a derivative fruits of Momordica grosvenori, exhibits strong antioxidant of corticosterone, which can lead to serious electrolyte activity. It exhibits significant inhibitory effects on imbalances. - reactive oxygen species ( O2 , H2O2 and *OH) w… Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size:
www.MedChemExpress.com 3
1alpha, 24, 25-Trihydroxy VD2 1alpha, 25-Dihydroxy VD2-D6 Cat. No.: HY-15156 Cat. No.: HY-15327
Bioactivity: 1alpha, 24, 25-Trihydroxy VD2 is a vitamin D analog. Bioactivity: 1alpha, 25-Dihydroxy VD2-D6 is a deuterated form of vitamin D.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg Size: 1 mg, 5 mg
2'-Deoxyinosine 2-Hydroxy-2-methylbutanoic acid Cat. No.: HY-W008638 Cat. No.: HY-W015874
Bioactivity: 2’-deoxyadenosine inhibits the growth of human colon-carcinoma Bioactivity: 2-Hydroxy-2-methylbutanoic acid, an unusual metabolite, is cell lines and is found to be associated with purine associated with 2-hydroxyglutaric aciduria and maple syrup nucleoside phosphorylase (PNP) deficiency. urine disease.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 1 g
2-Methoxyestrone 2-Methylsuccinic acid Cat. No.: HY-113252 Cat. No.: HY-W010381
Bioactivity: 2-Methoxyestrone is a methoxylated catechol estrogen and Bioactivity: 2-Methylsuccinic acid is a normal metabolite in human fluids metabolite of estrone, with a pKa of 10.81. and the main biochemical measurable features in ethylmalonic encephalopathy.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 1 g
2-Phenylethanamine 2-Phenylpropionic acid Cat. No.: HY-W010483 Cat. No.: HY-W015608
Bioactivity: 2-Phenylethanamine is believed to function as a neuromodulator Bioactivity: 2-Phenylpropionic acid is an intermediate in or neurotransmitter. alpha-Methylstyrene metabolism.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 g Size: 10mM x 1mL in DMSO, 1 g
2-γ-Linolenoyl-1,3-dilinoleoyl-sn-glycerol 21-Hydroxypregnenolone Cat. No.: HY-U00264 Cat. No.: HY-113020
Bioactivity: 2-γ-Linolenoyl-1,3-dilinoleoyl-sn-glycerol is a triglyceride. Bioactivity: 21-Hydroxypregnenolone is an essential intermediate in corticosterone synthesis.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size:
4 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
24, 25-Dihydroxy VD2 24, 25-Dihydroxy VD3 (24,25-Dihydroxy vitamin D2) Cat. No.: HY-76801 Cat. No.: HY-76915
Bioactivity: 24, 25-Dihydroxy VD2 is a hydroxylated metabolite of Vitamin Bioactivity: 24, 25-Dihydroxy VD3 is a compound which is closely related to D2; a synthetic analog of Vitamin D. 1,25-dihydroxyvitamin D3, the active form of vitamin D3, but like vitamin D3 itself and 25-hydroxyvitamin D3 is inactive as a hormone both in vitro and in vivo.
Purity: 99.79% Purity: 98.20% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 10 mg Size: 1 mg, 5 mg
25-Hydroxy VD2-D6 3,5-Dihydroxybenzoic acid Cat. No.: HY-15328 Cat. No.: HY-W015560
Bioactivity: 25-Hydroxy VD2-D6 is a labelled metabolite of Vitamin D2. Bioactivity: 3,5-Dihydroxybenzoic acid a potential biomarker for the consumption of many food products, including beer, nuts, peanut, and pulses.
Purity: >98% Purity: 99.74% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg 5 g
3-(3-Methoxyphenyl)propionic acid 3-Amino-2-methylpropanoic acid Cat. No.: HY-W016482 Cat. No.: HY-W012974
Bioactivity: 3-(3-Methoxyphenyl)propionic acid is an organic acid, Bioactivity: 3-Amino-2-methylpropanoic acid could induce browning of white naturally occurring human metabolite and excreted in human fat and hepatic β-oxidation and is inversely correlated with urine. cardiometabolic risk factors.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 100 mg
3-Indolepropionic acid 3-Methyl-L-histidine Cat. No.: HY-W015229 Cat. No.: HY-W017007
Bioactivity: 3-Indolepropionic acid is shown to be a powerful antioxidant Bioactivity: 3-Methyl-L-histidine is a biomarker for meat consumption, and has potential in the treatment for Alzheimer’s disease. especially chicken. It is also a biomarker for the consumption of soy products.
Purity: >98% Purity: 99.85% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g 100 mg
3-Methyladipic acid 3-Methylbutanoic acid Cat. No.: HY-113277 Cat. No.: HY-W012980
Bioactivity: 3-Methyladipic acid is the final metabolite in the ω-oxidation Bioactivity: 3-Methylbutanoic acid is a natural fatty acid and known to pathway. effect on neonatal death and possible Jamaican vomiting sickness in human.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 g 1 g
www.MedChemExpress.com 5
3-Nitro-L-tyrosine 3-Nitropropanoic acid Cat. No.: HY-113248 (β-Nitropropionic acid; Bovinocidin) Cat. No.: HY-W012875
Bioactivity: 3-Nitro-L-tyrosine is a biomarker of nitrogen free radical Bioactivity: 3-Nitropropanoic acid is an irreversible inhibitor of succinate species modified proteins in systemic autoimmunogenic dehydrogenase. conditions.
Purity: >98% Purity: 99.46% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 100 mg, 500 mg
3-O-(2-Aminoethyl)-25-hydroxyvitamin D3 3b-Hydroxy-5-cholenoic acid (25-Hydroxy Vitamin D3 3,3’-Aminopropyl Ether) Cat. No.: HY-15254 Cat. No.: HY-113315
Bioactivity: 3-O-(2-Aminoethyl)-25-hydroxyvitamin D3 is a Vitamin D3 Bioactivity: 3b-Hydroxy-5-cholenoic acid is a monohydroxy bile acid of derivative. endogenous origin and could be found in children with the syndrome of hepatic ductular hypoplasia.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size:
4-(1,2-Dihydroxyethyl)benzene-1,2-diol 4-Methyl-2-oxopentanoic acid Cat. No.: HY-W010066 Cat. No.: HY-W012722
Bioactivity: 4-(1,2-Dihydroxyethyl)benzene-1,2-diol, a normal Bioactivity: 4-Methyl-2-oxopentanoic acid, an abnormal metabolite, is both norepinephrine metabolite, is found to be associated with a neurotoxin and a metabotoxin. Menkes syndrome.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size:
4μ8C 5'-Methylthioadenosine (5'-(Methylthio)-5'-deoxyadenosine; (IRE1 Inhibitor III) Cat. No.: HY-19707 5'-Deoxy-5'-(methylthio)adenosine; …) Cat. No.: HY-16938
Bioactivity: 4μ8C (IRE1 Inhibitor III) is a small-molecule inhibitor of Bioactivity: 5'-Methylthioadenosine is produced from S-adenosylmethionine IRE1α. and behaves as a powful inhibitory product.
Purity: 98.52% Purity: 97.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 25 mg
5'-N-Ethylcarboxamidoadenosine 5-Aminolevulinic acid hydrochloride (NECA) Cat. No.: HY-103173 (ALA; 5-ALA) Cat. No.: HY-N0305
Bioactivity: NECA is a nonselective adenosine receptor agonist. Bioactivity: 5-Aminolevulinic acid HCl is an intermediate in heme biosynthesis in the body and the universal precursor of tetrapyrroles. Target: Others 5-Aminolevulinic acid is a non-fluorescent prodrug that leads to intracellular accumulation of fluorescent porphyrins in malignant gliomas-a… Purity: 99.86% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Phase 4 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg 1 g, 5 g, 10 g
6 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
5-Aminovaleric acid 6-Aminocaproic acid Cat. No.: HY-W015878 (EACA; Epsilon-Amino-n-caproic Acid; 6-Aminohexanoic acid) Cat. No.: HY-B0236
Bioactivity: 5-Aminovaleric acid is believed to act as a methylene Bioactivity: 6-Aminocaproic acid is an antifibrinolytic agent that acts by homologue of gamma-aminobutyric acid (GABA) and functions as a inhibiting plasminogen activators which have fibrinolytic weak GABA agonist. properties. Target: Others 6-aminohexanoic acid is a derivative and analogue of the amino acid lysine, which makes it an effective inhibitor for enzymes that bind that… Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Launched Size: Size: 50 mg, 100 mg
6-Hydroxymelatonin 7-Methoxyisoflavone Cat. No.: HY-W011956 Cat. No.: HY-N6631
Bioactivity: 6-Hydroxymelatonin is a primary metabolic of Melatonin, Bioactivity: 7-Methoxyisoflavone is an isoflavone derivative and also an which is metabolized by cytochrome P450 (CYP) 1A2. activator of adenosine monophosphate-activated protein kinase ( AMPK).
Purity: >98% Purity: 99.81% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 100 mg
7-Methylxanthine 8-Dehydrocholesterol Cat. No.: HY-W017163 Cat. No.: HY-113435
Bioactivity: 7-Methylxanthine, a methyl derivative of xanthine, is one of Bioactivity: 8-Dehydrocholesterol elevated concentration is one of the the purine components in urinary calculi. diagnostic biochemical hallmarks of classical Smith-Lemli-Opitz syndrome (SLOS).
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 50 mg
8-Hydroxyguanosine A 922500 Cat. No.: HY-113262 (DGAT-1 Inhibitor 4a) Cat. No.: HY-10038
Bioactivity: 8-Hydroxyguanosine is a systematic marker of oxidative stress Bioactivity: A 922500 is a potent, selective, and orally bioavailable
and a marker of hydroxyl radical damage to RNA. DGAT-1 inhibitor exhibiting IC50 values of 9 and 22 nM against human and mouse DGAT-1, respectively.
Purity: >98% Purity: 98.50% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
AA26-9 ABT-046 Cat. No.: HY-18522 (DGAT-1 inhibitor) Cat. No.: HY-15197
Bioactivity: AA26-9 is a potent and broad spectrum serine hydrolase Bioactivity: ABT-046 is a potent, selective, and orally bioavailable inhibitor. Diacylglycerol acyltransferase 1 (DGAT-1 ) inhibitor (IC50= 8 nM).
Purity: 99.78% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 7
Acarbose Acarbose sulfate (BAY g 5421) Cat. No.: HY-B0089 (Bay-g 5421 sulfate) Cat. No.: HY-B0089A
Bioactivity: Acarbose is an inhibitor of alpha glucosidase, an Bioactivity: Acarbose sulfate is an inhibitor of alpha glucosidase, an anti-diabetic drug. anti-diabetic drug.
Purity: 98.0% Purity: >98% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in Water, Size: 200 mg, 1 g 200 mg, 1 g
ACAT-IN-1 cis isomer Acetaldehyde-d4 Cat. No.: HY-101648 (Tetradeuteroacetaldehyde) Cat. No.: HY-110405
Bioactivity: ACAT-IN-1 cis isomer is a potent ACAT inhibitor with an IC50 Bioactivity: Acetaldehyde-d4 is the deuterium labeled Acetaldehyde, which of 100 nM. occurrs widely in nature and is mainly used as an intermediate in the synthesis of other chemicals.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 100 mg, 500 mg
Acetohexamide ACT 178882 Cat. No.: HY-B0881 Cat. No.: HY-U00262
Bioactivity: Acetohexamide is a first-generation sulfonylurea medication Bioactivity: ACT 178882 is a new Renin inhibitor with an IC50 of 1.4 nM. used to treat diabetes mellitus type 2; stimulate the pancreas to secrete insulin.
Purity: 99.39% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 100 mg, 500 mg
ACTH 22-39 ACTH 4-11 (Adrenocorticotropic Hormone (22-39)) Cat. No.: HY-P1603 (Adrenocorticotropic Hormone (4-11), human) Cat. No.: HY-P1503
Bioactivity: ACTH (22-39) is an adrenocorticotropic hormone (ACTH) Bioactivity: ACTH (4-11), an adrenocorticotropin hormone fragment, fragment. ACTH (22-39) is the 22-39 sequence of ACTH. possesses a weak α-melanocyte stimulating hormone (α-MSH) potency only at high doses (100 and 1000 nM).
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 5 mg, 10 mg, 25 mg
Adenosine Adipic acid (Adenine riboside; D-Adenosine) Cat. No.: HY-B0228 Cat. No.: HY-W017522
Bioactivity: Adenosine is a nucleoside composed of a molecule of adenine Bioactivity: Adipic acid is found to be associated with HMG-CoA lyase attached to a ribose sugar molecule (ribofuranose) moiety via deficiency, carnitine-acylcarnitine translocase deficiency, a β-N9-glycosidic bond. Target: Nucleoside malonyl-Coa decarboxylase deficiency, and medium Chain antimetabolite/analog Adenosine plays an important role in acyl-CoA dehydrogenase deficiency, which are inborn errors of biochemical processes, such as energy transfer — as adenosine… metabolism. Purity: 99.84% Purity: 98.0% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g, 5 g 100 mg
8 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Adipokinetic Hormone (AKH) (24-32), locust AdipoRon Cat. No.: HY-P1456 Cat. No.: HY-15848
Bioactivity: Adipokinetic Hormone (AKH) (24-32), locust is a peptide Bioactivity: AdipoRon is an orally active and specific AdipoR agonist, hormone isolated from locusts. binding to AdipoR1 and AdipoR2, with Kds of 1.8 and 3.1 μM, respectively.
Purity: >98% Purity: 99.76% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg Size: 10mM x 1mL in DMSO, 10 mg, 50 mg, 100 mg
AdipoRon hydrochloride Adomeglivant Cat. No.: HY-110164 (LY2409021) Cat. No.: HY-19904
Bioactivity: AdipoRon hydrochloride is an orally active and specific AdipoR Bioactivity: Adomeglivant is a potent and selective glucagon receptor antagonist that is used in clinical trial for type 2 diabetes agonist, binding to AdipoR1 and AdipoR2, with Kds of 1.8 and 3.1 μM, respectively. mellitus.
Purity: >98% Purity: 99.55% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 5 mg, 10 mg, 25 mg, 50 mg, 100 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Adrenic Acid Adrenocorticotropic Hormone (ACTH) (1-10), human (cis-7,10,13,16-Docosatetraenoic acid) Cat. No.: HY-W013215 Cat. No.: HY-P1518
Bioactivity: Adrenic Acid is an inflammation enhancer in non-alcoholic Bioactivity: Adrenocorticotropic Hormone (ACTH) (1-10), human, an fatty liver disease. adrenocorticotropin hormone fragment, possesses a weak α-melanocyte stimulating hormone (α-MSH) potency only at high doses (100 and 1000 nM).
Purity: >98% Purity: 95.31% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg
Adrenocorticotropic Hormone (ACTH) (1-39), human Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) (1-39-Corticotropin (human)) Cat. No.: HY-P1211 (1-39-Corticotropin (human)(TFA)) Cat. No.: HY-P1211A
Bioactivity: Adrenocorticotropic Hormone (ACTH) (1-39), human is a Bioactivity: Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) is a melanocortin receptor agonist. melanocortin receptor agonist.
Purity: >98% Purity: 98.28% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500u g, 1 mg, 5 mg Size: 10mM x 1mL in DMSO, 500u g, 1 mg, 5 mg
Adrenocorticotropic Hormone (ACTH) (1-39), rat Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA (ACTH (1-39) (mouse, rat)) Cat. No.: HY-P1477 (ACTH (1-39) (mouse, rat) (TFA)) Cat. No.: HY-P1477A
Bioactivity: Adrenocorticotropic Hormone (ACTH) (1-39), rat is a potent Bioactivity: Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA) is a melanocortin 2 (MC2) receptor agonist. potent melanocortin 2 (MC2) receptor agonist.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500u g, 1 mg, 5 mg Size: 500u g, 1 mg, 5 mg
www.MedChemExpress.com 9
Adrenocorticotropic Hormone (ACTH) (18-39), human Adrenocorticotropic Hormone (ACTH) (4-10), human (CLIP (human)) Cat. No.: HY-P1476 Cat. No.: HY-P1478
Bioactivity: Adrenocorticotropic Hormone (ACTH) (18-39), human is a Bioactivity: Adrenocorticotropic Hormone (ACTH) (4-10), human is a corticotropinlike intermediate lobe peptide, which is is melanocortin 4 (MC4R) receptor agonist. produced in the melanotrophs of the intermediate lobe of the pituitary.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg Size: 5 mg, 10 mg, 25 mg
Afegostat AGL-2263 (D-Isofagomine; Isofagomine) Cat. No.: HY-14829 Cat. No.: HY-112720
Bioactivity: Afegostat was previously in phase II clinical trials for the Bioactivity: AGL-2263 is an insulin receptor (IR) blocker. treatment of Gaucher's disease. The experiment was discontinued.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size:
Alagebrium chloride ALB-127158(a) (ALT711) Cat. No.: HY-106024B Cat. No.: HY-111398
Bioactivity: Alagebrium chloride is an advanced glycation end product ( Bioactivity: ALB-127158(a) is a potent and selective melanin concentrating
AGE) inhibitor. hormone 1 ( MCH1) receptor antagonist.
Purity: 98.0% Purity: 99.32% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 200 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Aldose reductase-IN-1 Aleglitazar Cat. No.: HY-18967 (R1439; RO0728804) Cat. No.: HY-14728
Bioactivity: Aldose reductase-IN-1 is a inhibitor of aldose reductase with Bioactivity: Aleglitazar(R1439; RO-0728804) is a new dual PPAR-α/γ agonist IC50 of 28.9 pM. with IC50 of 2.8 nM/4.6 nM.
Purity: 99.86% Purity: 99.00% Clinical Data: No Development Reported Clinical Data: Phase 3 Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
Alexamorelin Met 1 Alfacalcidol ((D-Mrp)-Ala-Trp-(D-Phe)) Cat. No.: HY-P0166A (1-hydroxycholecalciferol; 1.alpha.-Hydroxyvitamin D3) Cat. No.: HY-10003
Bioactivity: Alexamorelin Met 1 is one of the metabolites of alexamorelin. Bioactivity: Alfacalcidol (1-hydroxycholecalciferol; Alpha D3;
The heptapeptide Ala-His- D-2-methyl-Trp-Ala-Trp- 1.alpha.-Hydroxyvitamin D3) is a non-selective VDR activator -Phe-Lys-NH (Alexamorelin) is a synthetic molecule which medication. IC50 value: Target: VDR activator Alfacalcidol D 2 (1-hydroxycholecalciferol; Alpha D3; 1.alpha.-Hydroxyvitamin inhibits growth hormone secretagogue binding in vitro. D3) improves mechanical bone strength and bone mass;… Purity: 99.82% Purity: 99.93% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg Size: 5 mg, 10 mg, 50 mg, 100 mg
10 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Alfacalcidol-D6 all-trans-4-Oxoretinoic acid Cat. No.: HY-15332 (all-trans 4-Keto Retinoic Acid) Cat. No.: HY-107494A
Bioactivity: Alfacalcidol-D6, a deuterated Alfacalcidol Bioactivity: all-trans-4-Oxoretinoic acid, an active metabolite of vitamin (1-hydroxycholecalciferol; Alpha D3; 1.alpha.-Hydroxyvitamin A, induces gene transcription via binding to nuclear retinoic D3), is a non-selective VDR activator medication. acid receptors (RARs).
Purity: 98.0% Purity: 94.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg Size: 10mM x 1mL in DMSO, 2 mg, 5 mg, 10 mg
Alloepipregnanolone Allopurinol Cat. No.: HY-113307 Cat. No.: HY-B0219
Bioactivity: Alloepipregnanolone, a pregnane with anesthetic, hypnotic, and Bioactivity: Allopurinol (Zyloprim) is a xanthine oxidase inhibitor with an sedative properties, interferes with the development of rapid IC50 of 7.82±0.12 μM. tolerance to the anxiolytic effect of ethanol.
Purity: >98% Purity: 99.0% Clinical Data: No Development Reported Clinical Data: Launched Size: Size: 10mM x 1mL in DMSO, 5 g, 10 g
Allylthiourea Alogliptin (Thiosinamine; N-Allylthiourea) Cat. No.: HY-B0543 (SYR-322) Cat. No.: HY-A0023A
Bioactivity: Allylthiourea is a metabolic inhibitor that selective inhibits Bioactivity: Alogliptin(SYR-322) is a potent, selective inhibitor of DPP-4 ammonia oxidation. with IC50 of <10 nM, exhibits greater than 10,000-fold selectivity over DPP-8 and DPP-9.
Purity: 99.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg, 100 mg 5 g
Alogliptin Benzoate Alverine citrate (SYR 322) Cat. No.: HY-A0023 (NSC 35459) Cat. No.: HY-B0500
Bioactivity: Alogliptin benzoate(SYR 322) is a potent, selective inhibitor Bioactivity: Alverine citrate is a 5-HT1A receptor antagonist, with an of DPP-4 with IC50 of <10 nM, exhibits greater than IC of 101 nM. 10,000-fold selectivity over DPP-8 and DPP-9. IC50 value: 50 <10 nM Target: DPP4 Alogliptin is an orally administered, anti-diabetic drug in the DPP-4 inhibitor class. A randomized… Purity: 99.93% Purity: 98.71% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 g, 10 g
Alvimopan AM-1638 (ADL 8-2698; LY 246736) Cat. No.: HY-13243 Cat. No.: HY-13467
Bioactivity: Alvimopan(LY 246736; ADL 8-2698) is a peripherally acting Bioactivity: AM-1638 is a potent and orally bioavailable GPR40/FFA1 full
mu-opioid receptor (PAM-OR, IC50= 1.7 nM) antagonist for agonist with an EC50 of 0.16 μM. accelerating gastrointestinal recovery after surgery. IC50 Value: 1.7 nM (Mu-type opioid receptor) [1] Target: mu-opioid receptor in vitro: The dissociation rate of alvimopan from the… Purity: >98% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 5 mg, 10 mg, 50 mg Size: 250 mg, 500 mg
www.MedChemExpress.com 11
AM-2394 AMG 837 Cat. No.: HY-100221 Cat. No.: HY-13967
Bioactivity: AM-2394 is a structurally distinct glucokinase activator (GKA). Bioactivity: AMG 837 is a potent GPR40 agonist(EC50=13 nM) with a superior pharmacokinetic profile and robust glucose-dependent AM-2394 activates glucokinase (GK) with an EC50 of 60 nM. stimulation of insulin secretion in rodents.
Purity: 98.71% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg 5 mg, 10 mg, 50 mg, 100 mg
AMG 837 calcium hydrate AMG 837 sodium salt Cat. No.: HY-13967B Cat. No.: HY-13967A
Bioactivity: AMG 837 calcium hydrate is a potent GPR40 agonist(EC50=13 nM) Bioactivity: AMG 837 sodium salt is a potent GPR40 agonist(EC50=13 nM) with with a superior pharmacokinetic profile and robust a superior pharmacokinetic profile and robust glucose-dependent stimulation of insulin secretion in rodents. glucose-dependent stimulation of insulin secretion in rodents. IC50 value: 13 nM (EC50) [1] Target: GPR40 agonist AMG 837 displayed the expected two-fold increase in potency on GPR4… Purity: 98.01% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg 5 mg, 10 mg, 50 mg
AMG-3969 Amiloride Cat. No.: HY-12411 (MK-870) Cat. No.: HY-B0285
Bioactivity: AMG-3969 is a potent glucokinase-glucokinase regulatory Bioactivity: Amiloride is a relatively selective inhibitor of the
protein interaction ( GK-GKRP) disruptor with an IC50 of 4 epithelial sodium channel (ENaC), used in the management nM. of hypertension and congestive heart failure.
Purity: 99.63% Purity: >98% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 100 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
Amiloride hydrochloride Amlexanox (MK-870 hydrochloride) Cat. No.: HY-B0285A (AA673; Amoxanox; CHX3673) Cat. No.: HY-B0713
Bioactivity: Amiloride (hydrochloride) is an epithelial sodium channel Bioactivity: AmLexanox is a specific inhibitor of IKKε and TBK1, and (ENaC) inhibitor and a competitive inhibitor of inhibits the IKKε and TBK1 activity determined by MBP
Urokinase-type plasminogen activator ( uPA). phosphorylation with an IC50 of approximately 1-2 μM.
Purity: 98.0% Purity: 99.32% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg, 500 mg 10 mg, 50 mg, 100 mg
AMPK activator 1 Ampkinone Cat. No.: HY-U00292 Cat. No.: HY-12831
Bioactivity: AMPK activator 1 is an AMPK activator extracted from patent Bioactivity: Ampkinone is an indirect AMP-activated protein kinase (
WO2013116491A1, compound No.1-75, has an EC50 of <0.1μM. AMPK) activator.
Purity: 98.0% Purity: 99.31% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 2 mg, 5 mg, 10 mg
12 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Amylin (8-37), rat Amylin, amide, human (Amylin (8-37) (mouse, rat)) Cat. No.: HY-P1473 (DAP amide, human) Cat. No.: HY-P1070
Bioactivity: Amylin (8-37), rat is a truncated analog of native Amylin that Bioactivity: Amylin, amide, human, a 37-amino acid polypeptide, is a selectively inhibits insulin-related glucose uptake and pancreatic hormone cosecreted with insulin that exerts unique glycogen deposition in muscle tissue. Amylin (8-37), rat is a roles in metabolism and glucose homeostasis. weak amylin receptor ( AMY) antagonist.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500u g, 1 mg, 5 mg Size: 500u g, 1 mg, 5 mg
Amylin, amide, rat Anagliptin (Amylin (rat)) Cat. No.: HY-P1464 (SK-0403) Cat. No.: HY-14877
Bioactivity: Amylin, amide, rat is a potent and high affinity ligand of Bioactivity: Anagliptin is a highly selective, potent inhibitor of
Amylin receptor AMY1 and AMY3 receptors and variably dipeptidyl peptidase 4 (DPP-4), with an IC50 of 3.8 nM, and of AMY2 receptors; binding studies are generally used for the less selective at DPP-8/9 ( IC , 68, 60 nM, respectively). latter receptor. 50
Purity: >98% Purity: 97.96% Clinical Data: No Development Reported Clinical Data: Launched Size: 500u g, 1 mg, 5 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
Androst-4-ene-3,17-diol, dipropanoate, (3β,17β)- Androsterone (Androst-4-ene-3β,17β-diol, dipropionate) Cat. No.: HY-U00272 (5α-Androstan-3α-ol-17-one) Cat. No.: HY-N0933
Bioactivity: Androst-4-ene-3,17-diol, dipropanoate, (3β,17β)- is the Bioactivity: Androsterone is a metabolic product of testosterone and can dipropanoate of 4-Androstenediol, a metabolite of activate Farnesoid X Receptor ( FXR). testosterone.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 100 mg, 250 mg
AP20187 Apararenone Cat. No.: HY-13992 (MT-3995) Cat. No.: HY-109002
Bioactivity: AP20187 is a cell-permeable ligand used to dimerize Bioactivity: Apararenone (MT-3995) is a novel non-steroidal FK506-binding protein ( FKBP) fusion proteins and initiate mineralocorticoid receptor antagonists under development biological signaling cascades and gene expression or disrupt for the treatment of diabetic nephropathies and non-alcoholic protein-protein interactions. steatohepatitis.
Purity: 99.80% Purity: 98.80% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
APD597 APD668 (JNJ-38431055) Cat. No.: HY-15566 Cat. No.: HY-15565
Bioactivity: APD597 is a GPR119 agonist intended for the treatment of type Bioactivity: APD668 is a potent GPR119 agonist with EC50 of 2.7 nM and 33 2 diabetes, with EC50 of 46 nM for hGPR119. IC50 value: 46 nM nM for hGPR119 and ratGPR119 respectively. (EC50) [1] Target: hGPR119 The design and synthesis of a second generation GPR119-agonist clinical candidate for the treatment of diabetes is described. APD597 was selected for… Purity: 98.0% Purity: 99.16% Clinical Data: Phase 1 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 13
AR 231453 AR-A014418 Cat. No.: HY-15564 (AR 0133418; GSK 3β inhibitor VIII; AR 014418) Cat. No.: HY-10512
Bioactivity: AR231453 is a potent and selective small molecule agonist of Bioactivity: AR-A014418 is a selective, effective and ATP-competitive
GPR119 that enhances glucose-dependent insulin secretion and GSK3β inhibitor with an IC50 value of 104 nM, and has no glucagon-like peptide 1 (GLP-1) release; Antidiabetic agent. significant inhibition on 26 other kinases. IC50 value: Target: GPR119 in vitro: The GPR119-specific agonist AR231453 significantly increased cAMP accumulation and… Purity: 99.52% Purity: 97.22% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg 5 mg, 10 mg, 50 mg
AS1842856 Asp-AMS Cat. No.: HY-100596 Cat. No.: HY-112860
Bioactivity: AS1842856 is a potent and cell-permeable Foxo1 inhibitor with Bioactivity: Asp-AMS, an analogue of aspartyl-adenylate, is an aspartyl-tRNA
an IC50 of 30 nM. synthetase inhibitor and also a strong competitive inhibitor of the mitochondrial enzyme.
Purity: 98.09% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 25 mg 5 mg, 10 mg, 50 mg, 100 mg, 200 mg, 500 mg
Atglistatin Atorvastatin Cat. No.: HY-15859 Cat. No.: HY-B0589
Bioactivity: Atglistatin is a selective adipose triglyceride lipase ( Bioactivity: Atorvastatin is an inhibitor of HMG-CoA reductase used as a
ATGL) inhibitor with IC50 of 0.7 μM for lipolysis in vitro. cholesterol-lowering medication that blocks the production of cholesterol.
Purity: 98.06% Purity: >98% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10 mg, 50 mg 5 mg, 10 mg, 50 mg, 100 mg
ATP disodium salt (Disodium adenosine triphosphate; Adenosine AU-224 5'-triphosphate disodium salt) Cat. No.: HY-B0345A Cat. No.: HY-U00020
Bioactivity: ATP Disodium salt is a P2 purinoceptor agonist. Bioactivity: AU-224 is a benzamide derivative used as a promising gastrointestinal prokinetic agent without significant side effects.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 1 mg, 5 mg, 10 mg, 20 mg 1 g, 5 g
AVE-8134 AVE5688 Cat. No.: HY-U00014 Cat. No.: HY-100320
Bioactivity: AVE-8134 is a potent PPARα agonist, with EC50 values of 100 Bioactivity: AVE5688 is an inhibitor of glycogen phosphorylase (GP), with IC s of 430 nM and 915 nM and K s of 170 nM and 530 nM for and 3000 nM for human and rodent PPARα receptor, respectively. 50 d rabbit muscle glycogen phosphorylase (rmGPb and rmGPa, respectively); AVE5688 can be used for the research of type 2 diabetes. Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 1 mg, 5 mg, 10 mg
14 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
AZ-1355 AZD 4017 Cat. No.: HY-101692 Cat. No.: HY-18053
Bioactivity: AZ-1355 is an effctive lipid-lowering compound, which also Bioactivity: AZD 4017 is a potent, selective 11β-Hydroxysteroid
inhibits platelet aggregation in vivo and elevates the Dehydrogenase Type 1 (11β-HSD1) inhibitor, with an IC50 of prostaglandin I 2/thromboxane A 2 ratio in vitro. 7 nM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 250 mg, 500 mg
AZD1979 AZD7545 Cat. No.: HY-U00257 Cat. No.: HY-16082
Bioactivity: AZD1979 is a Melanin-concentrating hormone receptor 1 ( Bioactivity: AZD7545 is a novel, selective small-molecule inhibitor of PDHK2 (PDH kinase2) with an IC50 of 36.8 nM and 6.4 nM for MCHr1) antagonist with an IC50 of ~12 nM. PDHK1 and PDHK2 respectively.
Purity: >98% Purity: 99.84% Clinical Data: Phase 1 Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
AZD7687 AZP-531 Cat. No.: HY-15497 Cat. No.: HY-P0231
Bioactivity: AZD7687 is a potent and selective DGAT1 inhibitor with an IC50 Bioactivity: AZP-531 is an analogue of unacylated ghrelin designed to value of 80 nM (hDGAT1). improve glycaemic control and reduce weight. Sequence: Cyclo(Arg-Val-Gln-Ser-Pro-Glu-His-Gln).
Purity: 98.09% Purity: 96.61% Clinical Data: Phase 1 Clinical Data: Phase 1 Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 5 mg, 10 mg, 50 mg
Balaglitazone Bamaquimast (DRF 2593; NN 2344) Cat. No.: HY-16086 (F 10126; L 0042) Cat. No.: HY-101427
Bioactivity: Balaglitazone is a selective partial PPARγ agonist with an Bioactivity: Bamaquimast is an inhibitor of proton pump extracted from
EC50 of 1.351 μM for human PPARγ. patent US2005165041, example 138.
Purity: 99.21% Purity: 98.79% Clinical Data: Phase 3 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
BAY-85-8501 BD1063 dhydrochloride Cat. No.: HY-19908 Cat. No.: HY-18101A
Bioactivity: BAY-85-8501 is a selective and potent inhibitor of Human Bioactivity: BD1063 dhydrochloride is a potent and selective sigma 1
Neutrophil Elastase (HNE), with an IC50 of 65 pM. receptor antagonist.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg
www.MedChemExpress.com 15
Benzamil hydrochloride Benzbromarone (Benzylamiloride hydrochloride) Cat. No.: HY-B1546A Cat. No.: HY-B1135
Bioactivity: Benzamil hydrochloride is a specific blocker of sodium Bioactivity: Benzbromarone is a highly effective and well tolerated channel ( ENaC). non-competitive inhibitor of xanthine oxidase, used as an uricosuric agent, used in the treatment of gout.
Purity: 99.46% Purity: 99.17% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 100 mg
Beta-Sitosterol Betanin (β-Sitosterol; 22,23-Dihydrostigmasterol) Cat. No.: HY-N0171 Cat. No.: HY-112578
Bioactivity: Beta-Sitosterol weakly inhibits porcine pancreatic lipase Bioactivity: Betanin has potent antioxidative and anti-inflammatory (PPL) activity. Sitosterol is an important compound extracted - activity could inhibit peroxynitrite (ONOO ), with an IC50 from the leaves of Aloe vera. of 19.2 μM.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in Ethanol, Size: 1 g 100 mg, 1 g, 5 g
Bethanechol chloride BETP (Carbamyl-β-methylcholine chloride) Cat. No.: HY-B0406A Cat. No.: HY-103546
Bioactivity: Bethanechol Chloride is a selective muscarinic receptor Bioactivity: BETP is an agonist of glucagon-like peptide-1 (GLP-1) agonist without any effect on nicotinic receptors. receptor, with EC50s of 0.66 and 0.755 μM for human and rat GLP-1 receptor, respectively.
Purity: 95.00% Purity: 99.28% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 200 mg, 5 g 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Bexagliflozin Bezafibrate (EGT1442; EGT0001442; THR-1442) Cat. No.: HY-17604 (BM15075) Cat. No.: HY-B0637
Bioactivity: Bexagliflozin is a potent and selective SGLT2 inhibitor with Bioactivity: Bezafibrate is an agonist of PPAR, with EC50s of 50 μM, 60 IC50 value of 5.6 μM /2 nM in SGLT1 /SGLT2 respectively. μM, 20 μM for human PPARα, PPARγ and PPARδ, and 90 μM, target: SGLT2 IC50: 5.6 μM (SGLT1)/ 2 nM (SGLT2) 1) In normal 55 μM, 110 μM for murine PPARα, PPARγ and PPARδ, rats and dogs a saturable urinary glucose excretion was respectively; Bezafibrate is used as an hypolipidemic agent. produced with an ED50 of 0.38 and 0.09 mg/kg, respectively. 2)… Purity: 98.63% Purity: 99.05% Clinical Data: Phase 3 Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 2 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 100 mg
BI-78D3 BIBR 1087 SE Cat. No.: HY-10366 (Desethyl Dabigatran Etexilate) Cat. No.: HY-W004360
Bioactivity: BI-78D3 functions as a substrate competitive inhibitor of Bioactivity: BIBR 1087 SE is an intermediate metabolite of dabigatran
JNK, inhibit the JNK kinase activity ( IC50=280 nM). etexilate.
Purity: 99.69% Purity: 96.86% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 5 mg, 10 mg, 25 mg
16 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
BIIE-0246 Biotin (AR-H 053591) Cat. No.: HY-101986 (Vitamin B7; Vitamin H; D-Biotin) Cat. No.: HY-B0511
Bioactivity: BIIE-0246 is a potent and highly selective non-peptide Bioactivity: Biotin is a water-soluble, enzyme co-factor present in minute amounts in every living cell. neuropeptide Y (NPY) Y2 receptor antagonist, with an IC50 of 15 nM.
Purity: 99.0% Purity: 99.80% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 1 mg Size: 10mM x 1mL in DMSO, 1 g, 5 g
Biotin-DADOO (Biotinyl-3,6-dioxaoctanediamine; EZ-Link Bisacodyl Amine-PEO2-Biotin) Cat. No.: HY-D0980 Cat. No.: HY-B0557
Bioactivity: Biotin-DADOO is a biotinylation reagent, which can be used to Bioactivity: Bisacodyl is a stimulant laxative drug that works directly on synthesize a biotin-estradiol conjugate (i.e., the colon to produce a bowel movement. biotin-DADOO-estradiol) to develop a direct, broad range enzyme immunoassay to measure plasma estradiol concentratio…
Purity: 98.0% Purity: 98.92% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 10 mg, 50 mg 5 g
Bisindolylmaleimide I BM-131246 (GF109203X; Go 6850) Cat. No.: HY-13867 Cat. No.: HY-101758
Bioactivity: Bisindolylmaleimide I (GF109203X) is a highly selective, Bioactivity: BM-131246 is an oral antidiabetic agent. cell-permeable, and reversible protein kinase C ( PKC)
inhibitor with a Ki of 14 nM.
Purity: 98.04% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 20 mg 1 mg, 5 mg, 10 mg, 25 mg, 50 mg
BM152054 BMS-191095 Cat. No.: HY-U00259 Cat. No.: HY-14256
Bioactivity: BM152054 can promote glucose utilization in peripheral tissues Bioactivity: BMS-191095 is an activators of mitochondrial ATP-sensitive by enhancing insulin action. potassium (mitoKATP) channels.
Purity: >98% Purity: 98.19% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg
BMS-303141 BMS-309403 Cat. No.: HY-16107 Cat. No.: HY-101903
Bioactivity: BMS-303141 is a potent, cell-permeable ATP-citrate lyase ( Bioactivity: BMS-309403 is a potent, selective and cell-permeable inhibitor
ACL) inhibitor with an IC50 of 0.13 μM. of fatty acid binding protein 4 ( FABP4) with a Ki of less than 2 nM.
Purity: 98.99% Purity: 99.05% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg 5 mg, 10 mg, 25 mg
www.MedChemExpress.com 17
BMS-779788 BMS-819881 (EXEL04286652; XL-652; BMS-788) Cat. No.: HY-19919 Cat. No.: HY-12433
Bioactivity: BMS-779788 is a LXR partial agonist with IC50 values of 68 nM Bioactivity: BMS-819881 is a melaninconcentrating hormone receptor 1 ( MCHR1) antagonist, which binds rat MCHR1 with a K of 7 nM. for LXR α and 14 nM for LXR β. i BMS-819881 also is selective and potent for CYP3A4 activity
with an EC50 of 13 μM. Purity: 98.0% Purity: >98% Clinical Data: Phase 1 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 5 mg, 10 mg, 50 mg, 100 mg
Boldenone Undecylenate Bombesin Cat. No.: HY-17434 Cat. No.: HY-P0195
Bioactivity: Boldenone undecylenate(Equipoise) is a synthetic steroid which Bioactivity: Bombesin is a tetradecapeptide originally isolated from frog has a similar effect as the natural steroid testosterone; it skin; plays an important role in the release of gastrin and is frequently used in veterinary medicine, though it is also the activation of G-protein receptors. Sequence: used in humans. {Glp}-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2.
Purity: 96.33% Purity: 99.69% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 25 mg 5 mg, 10 mg, 50 mg, 100 mg
Bovinic acid Bromhexine hydrochloride Cat. No.: HY-113162 Cat. No.: HY-B0372A
Bioactivity: Bovinic acid is a conjugated linoleic acid with Bioactivity: Bromhexine Hydrochloride is a medication prescribed for coughs anticarcinogenic and anti-atherogenic activities. which works by dissolving hard phlegm. Target: Others Bromhexine is a mucolytic agent used in the treatment of respiratory disorders associated with viscid or excessive mucus. In addition, bromhexine has antioxidant properties.… Purity: >98% Purity: 99.91% Clinical Data: No Development Reported Clinical Data: Launched Size: Size: 10mM x 1mL in DMSO, 5 g, 10 g
Budesonide BVT-14225 Cat. No.: HY-13580 Cat. No.: HY-18055
Bioactivity: Budesonide is a glucocortical steroid with potent Bioactivity: BVT-14225 is a selective 11β-Hydroxysteroid dehydrogenase type
anti-inflammatory activity. 1 ( 11β-HSD1) inhibitor with an IC50 of 52 nM.
Purity: 98.0% Purity: 98.02% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg, 200 mg, 500 mg 5 mg, 10 mg, 50 mg, 100 mg
BX341 C-Peptide, dog (Bifluranol) Cat. No.: HY-U00229 (C-Peptide (dog)) Cat. No.: HY-P1475
Bioactivity: BX341 is an anti-androgen. Bioactivity: C-Peptide, dog is a component of proinsulin, released from pancreatic beta cells into blood together with insulin.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 500u g, 1 mg, 5 mg
18 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Calcifediol Calcifediol monohydrate (25-hydroxy Vitamin D3) Cat. No.: HY-32351 (25-hydroxy Vitamin D3 monohydrate) Cat. No.: HY-32351A
Bioactivity: Calcifediol is a major circulating metabolite of vitamin D3, Bioactivity: Calcifediol (monohydrate) is a major circulating metabolite of
acting as a competitive inhibitor with an apparent K i of 3.9 vitamin D3, acting as a competitive inhibitor with an apparent K of 3.9 μM, suppresses PTH secretion and mRNA (ED =2 nM). μM, suppresses PTH secretion and mRNA (ED 50=2 nM). i 50
Purity: >98% Purity: 99.75% Clinical Data: Launched Clinical Data: Launched Size: 5 mg, 100 mg Size: 5 mg, 100 mg
Calcifediol-D6 Calcitetrol Cat. No.: HY-13332 (1α, 24, 25-Trihydroxy VD3) Cat. No.: HY-15157
Bioactivity: Calcifediol-D6 is the deuterated form of Bioactivity: Calcitetrol(1α, 24, 25-Trihydroxy VD3) is the hormonally Calcifediol(25-hydroxy Vitamin D3), which is a prehormone that active form of vitamin D with three hydroxyl groups. is produced in the liver by hydroxylation of vitamin D3 (cholecalciferol) by the enzyme cholecalciferol 25-hydroxylase. Purity: >98% Purity: 97.98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg Size: 1 mg, 5 mg
Calcitriol D6 Calcitriol Derivatives Cat. No.: HY-76814 Cat. No.: HY-76802
Bioactivity: Calcitriol D6 is the deuterated form of Bioactivity: Calcitriol Derivatives is a vitamin D3 analog. v Calcitriol(1,25-Dihydroxyvitamin D3; Rocaltrol ), which is the hormonally active form of vitamin D, Calcitriol is the active metabolite of vitamin D3 that activates the vitamin D receptor (VDR). IC50 value: Target: vitamin D receptor… Purity: 98.49% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg Size: 1 mg, 5 mg
Calcitriol Impurities A Calcitriol Impurities D Cat. No.: HY-75041 Cat. No.: HY-77274
Bioactivity: Calcitriol Impurities A is the impurity of Calcitriol, Bioactivity: Calcitriol Impurities D is the impurity of Calcitriol, Calcitriol is the hormonally active form of vitamin D, Calcitriol is the hormonally active form of vitamin D, Calcitriol is the active metabolite of vitamin D3 that Calcitriol is the active metabolite of vitamin D3 that activates the vitamin D receptor (VDR). activates the vitamin D receptor (VDR).
Purity: 99.51% Purity: 95.18% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 25 mg Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg
Camostat mesylate Canagliflozin (Camostat mesilate; FOY305; FOY-S980) Cat. No.: HY-13512 (JNJ 24831754ZAE; JNJ 28431754; JNJ 28431754AAA; TA 7284)Cat. No.: HY-10451
Bioactivity: Camostat Mesylate(FOY305; FOY-S980) is a trypsin-like protease Bioactivity: Canagliflozin is a selective SGLT2 inhibitor with IC50s of 2 inhibitor. nM, 3.7 nM, and 4.4 nM for mSGLT2, rSGLT2, and hSGLT2 in CHOK cells, respectively.
Purity: 99.25% Purity: 99.61% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 19
Canagliflozin hemihydrate Candoxatril (JNJ28431754 hemihydrate; TA-7284 hemihydrate) Cat. No.: HY-I0383 (UK 79300) Cat. No.: HY-19649
Bioactivity: Canagliflozin 0.5 H2O(JNJ 28431754; TA 7284) is a highly Bioactivity: Candoxatril is a neutral endopeptidase ( NEP) inhibitor. potent and selective SGLT2 inhibitor for hSGLT2 with IC50 of 2.2 nM, exhibits 413-fold selectivity over hSGLT1. IC50 value: 2.2 nM Target: SGLT2 Canagliflozin(JNJ 24831754ZAE; JNJ 28431754; JNJ 28431754AAA; TA 7284) is an experimental drug… Purity: 99.95% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 5 mg, 10 mg, 50 mg, 100 mg, 500 mg
CAY10602 CB1 antagonist 1 Cat. No.: HY-104073 Cat. No.: HY-U00397
Bioactivity: CAY10602 is a SIRT1 activator. Bioactivity: CB1 antagonist 1 is an antagonist of CB1 receptor, used in the research of metabolic syndrome and obesity, neuroinflammatory disorders, cognitive disorders and psychosis, gastrointestinal disorders, and cardiovascular conditions. Purity: 98.56% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 5 mg, 10 mg, 50 mg, 100 mg
CCK-A receptor inhibitor 1 CDD3505 Cat. No.: HY-U00387 Cat. No.: HY-100901
Bioactivity: CCK-A receptor inhibitor 1 is a cholecystokinin A ( CCK-A) Bioactivity: CDD3505 is used for elevating high density lipoprotein cholesterol (HDL) by inducing hepatic cytochrome P450IIIA receptor inhibitor with a binging IC50 of 340 nM. (CYP3A) activity.
Purity: >98% Purity: 95.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
CDD3506 CDK8-IN-3 Cat. No.: HY-100902 Cat. No.: HY-111463
Bioactivity: CDD3506 is used for elevating high density lipoprotein Bioactivity: CDK8-IN-3 is an inhibitor of CDK8 extracted from patent cholesterol (HDL) by inducing hepatic cytochrome P450IIIA WO2016041618A1, compound example 1.7. (CYP3A) activity.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 5 mg, 10 mg, 50 mg, 100 mg
CDN1163 CE3F4 Cat. No.: HY-101455 Cat. No.: HY-108539
Bioactivity: CDN1163 is a sarco/endoplasmic reticulum Ca2+-ATPase ( Bioactivity: CE3F4 is a selective antagonist of exchange protein directly SERCA) activator. activated by cAMP ( Epac1), with IC50s of 10.7 μM and 66 μM for Epac1 and Epac2(B), respectively.
Purity: 99.12% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 25 mg 5 mg, 10 mg, 50 mg, 100 mg
20 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Cefetrizole Cerulenin Cat. No.: HY-U00266 Cat. No.: HY-A0210
Bioactivity: Ceftezole is an α-Glucosidase inhibitor with an IC50 and a Ki Bioactivity: Cerulenin, the best known natural inhibitor of fatty acid of 2.1 μM and 0.578 μM, respectively. synthase ( FAS), is an epoxide produced by the fungus Cephalosporium caeruleus.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 5 mg
Ceruletide Cetilistat (Caerulein; Cerulein) Cat. No.: HY-A0190 (ATL-962) Cat. No.: HY-14471
Bioactivity: Ceruletide, a biologically active decapeptide isolated from Bioactivity: Cetilistat is an inhibitor of pancreatic and gastrointestinal the skin of the Australian frog Hyla caerulea, is a potent lipases. It has great treatment of obesity in both diabetic cholecystokinetic agent, and acts as a cholecystokinin and non-diabetic patients. receptor agonist.
Purity: 99.96% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg 200 mg, 500 mg, 1 g, 5 g
Chenodeoxycholic Acid Chiglitazar (CDCA) Cat. No.: HY-76847 Cat. No.: HY-106266
Bioactivity: Chenodeoxycholic Acid is a hydrophobic primary bile acid that Bioactivity: Chiglitazar is a PPARα/γ dual agonist, with EC50s of 1.2, activates nuclear receptors ( FXR) involved in cholesterol 0.08, 1.7 μM for PPARα, PPARγ and PPARδ, respectively. metabolism.
Purity: 98.0% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 100 mg, 500 mg
CHIR-98014 Chitosan oligosaccharide COS Cat. No.: HY-13076 Cat. No.: HY-112108
Bioactivity: CHIR-98014 is a potent, cell-permeable GSK-3 inhibitor with Bioactivity: Chitosan oligosaccharide (COS) is an oligomer of β-(14)-linked D-glucosamine. Chitosan oligosaccharide (COS) IC50s of 0.65 and 0.58 nM for GSK-3α and GSK-3β, respectively; it shows less potent activities against cdc2 and activates AMPK and inhibits inflammatory signaling pathways erk2. including NF-κB and MAPK pathways.
Purity: 98.0% Purity: 91.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 g, 5 g 5 mg, 10 mg, 50 mg
Chlorazanil Chlorazanil hydrochloride Cat. No.: HY-B1045A Cat. No.: HY-B1045
Bioactivity: Chlorazanil is a triazine derivative and also a new Bioactivity: Chlorazanil hydrochloride is a orally effective diuretic nonmercurial diuretic agent. agent.
Purity: 95.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 50 mg 50 mg
www.MedChemExpress.com 21
Chol-5-en-24-al-3β-ol Cholestenone (Vitamin D3 derivative) Cat. No.: HY-U00424 Cat. No.: HY-113365
Bioactivity: Chol-5-en-24-al-3β-ol is a steroid compound (Vitamin D3 Bioactivity: Cholestenone is the intermediate oxidation product of derivative) extracted from patent US 4354972 A, Compound IX. cholesterol.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg, 25 mg Size: 100 mg
Cholesteryl behenate Cholesteryl linoleate (Cholesteryl docosanoate; Cholesterol behenate) Cat. No.: HY-N2339 Cat. No.: HY-W010697
Bioactivity: Cholesteryl behenate is a standard in electrospray ionization Bioactivity: Cholesteryl linoleate is shown to be the major cholesteryl tandem mass spectrometry for the analysis of cholesterol and ester contained in LDL and atherosclerotic lesions. cholesteryl esters.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg
Cholic acid Citric acid Cat. No.: HY-N0324 Cat. No.: HY-N1428
Bioactivity: Cholic acid is a major primary bile acid produced in the liver Bioactivity: Citric acid is a weak organic tricarboxylic acid found in and usually conjugated with glycine or taurine. It facilitates citrus fruits. Citric acid is a natural preservative and food fat absorption and cholesterol excretion. tartness enhancer.
Purity: 98.0% Purity: 98.0% Clinical Data: Phase 3 Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg, 1 g 100 mg
Clebopride malate Clenbuterol hydrochloride Cat. No.: HY-B1613A Cat. No.: HY-B1614
Bioactivity: Clebopride malate is a dopamine antagonist drug with Bioactivity: Clenbuterol hydrochloride is a β2 adrenergic receptor antiemetic and prokinetic properties used to treat functional agonist. It is a powerful bronchodilator withfat burning gastrointestinal disorders. properties.
Purity: 99.46% Purity: 99.23% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 25 mg, 50 mg, 100 mg, 200 mg
Clinofibrate Clofarabine (S-8527) Cat. No.: HY-13528 Cat. No.: HY-A0005
Bioactivity: Clinofibrate (S-8527) is a hypelipidemic agent and a Bioactivity: Clofarabine(Clolar; Clofarex) inhibits the enzymatic HMG-CoA reductase inhibitor. activities of ribonucleotide reductase (IC50 = 65 nM) and DNA polymerase. IC50 Value: 65 nM Target: in vitro: Clofarabine is a second generation purine nucleoside analog with antineoplastic activity. It is phosphorylated intracellularly,… Purity: 98.0% Purity: 98.0% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg, 200 mg 10 mg, 50 mg
22 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Clofibrate Clorgiline hydrochloride Cat. No.: HY-B0287 (Clorgyline hydrochloride) Cat. No.: HY-14197A
Bioactivity: Clofibrate is an agonist of PPAR, with EC50s of 50 μM, 500 Bioactivity: Clorgiline is an irreversible and selective inhibitor of μM for murine PPARα and PPARγ, and 55 μM, 500 μM for human monoamine oxidase A (MAO-A) that is used in scientific PPARα and PPARγ, respectively. research; structurally related to Pargyline.
Purity: 99.59% Purity: 99.53% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g, 5 g 10 mg, 50 mg, 100 mg
Coenzyme Q10 Complanatuside (Ubiquinone-10; CoQ10) Cat. No.: HY-N0111 Cat. No.: HY-N1444
Bioactivity: Coenzyme Q10 is an essential cofactor of the electron Bioactivity: Complanatuside is a flavonoid found in the traditional Chinese transport chain and a potent antioxidant agent. medicine Semen Astragali Complanati.
Purity: 98.0% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg, 200 mg, 500 mg, 1 g, 5 g 5 mg, 10 mg
Compound 2 Coptisine Cat. No.: HY-U00358 (Coptisin) Cat. No.: HY-N0430
Bioactivity: Compound 2 is an active compound used for the research of Bioactivity: Coptisine is an alkaloid from Chinese goldthread, and acts as
metabolic bone diseases. an efficient uncompetitive IDO inhibitor with a Ki value of 5.8
μM and an IC50 value of 6.3 μM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10 mg, 50 mg
Coptisine chloride Cort108297 Cat. No.: HY-N0736 Cat. No.: HY-15710
Bioactivity: Coptisine chloride is an alkaloid from Chinese goldthread, and Bioactivity: Cort108297 is a specific glucocorticoid receptor ( GR) acts as an efficient uncompetitive IDO inhibitor with a K i antagonist. Cort108297 has a high affinity for GRs with a Ki
value of 5.8 μM and an IC50 value of 6.3 μM. of 0.45 nM.
Purity: 99.29% Purity: 97.16% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 5 mg, 10 mg, 50 mg, 100 mg
Coumetarol (Cumetharol; Cumethoxaethane; Dicoumoxyl; CP-319340(free base) Dicumoxan; Dicumoxane; Ph 137) Cat. No.: HY-U00017 Cat. No.: HY-U00270
Bioactivity: Coumetarol is a vitamin K antagonist. Bioactivity: CP-319340 free base is a microsomal triglyceride transfer protein ( MTP) inhibitor.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
www.MedChemExpress.com 23
CP-640186 CP-640186 hydrochloride Cat. No.: HY-15259 Cat. No.: HY-15259A
Bioactivity: CP-640186 is an isozyme-nonselective acetyl-CoA carboxylase Bioactivity: CP-640186 hydrochloride is a potent and cell-permeable
(ACCase) inhibitor with IC50s of 53 nM and 61 nM for rat liver Acetyl-CoA carboxylase (ACC) inhibitor with IC50s of 53 nM and ACC1 and rat skeletal muscle ACC2 respectively; with improved 61 nM for rat liver ACC1 and rat skeletal muscle ACC2 metabolic stability vs CP-610431. IC50 value: 53 nM/61 nM (rat respectively. liver ACC1/skeletal muscle ACC2) [1] Target: acetyl-CoA… Purity: >98% Purity: 99.40% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg, 50 mg, 100 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
CP742033 CPA inhibitor (Dirlotapide; Slentrol) Cat. No.: HY-U00070 (carboxypeptidase inhibitor) Cat. No.: HY-70005
Bioactivity: CP742033 is a gut-selective inhibitor of microsomal Bioactivity: CPA inhibitor is a potent inhibitor for carboxypeptidase A triglyceride transfer protein (MTP) that reliably produces (CPA). weight loss in obese dogs.
Purity: >98% Purity: 99.90% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
CPDA Creatine Cat. No.: HY-18685 Cat. No.: HY-W010388
Bioactivity: CPDA is a novel potent SH2 domain-containing inositol Bioactivity: Creatine, an endogenous amino acid derivative, plays an phosphatase 2 (SHIP2) inhibitor that can effectively important role in cellular energy, especially in muscle and ameliorate insulin resistance in 3T3-L1 adipocytes. Target: brain. SHIP2 in vitro: CPDA was found to enhance insulin signaling. in vivo: CPDA greatly improves abnormal glucose metabolism in… Purity: 99.11% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 g
Creatinine CREBtide (NSC13123) Cat. No.: HY-B0504 Cat. No.: HY-P1595
Bioactivity: Creatinine(NSC13123) is a break-down product of creatine Bioactivity: CREBtide, a synthetic 13 amino acid peptide, has been reported phosphate in muscle, and is usually produced at a fairly as a PKA substrate. constant rate by the body. Target: Others Creatinine is a breakdown product of creatine phosphate in muscle, and is usually produced at a fairly constant rate by the body… Purity: 99.0% Purity: >98% Clinical Data: Phase 4 Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 1 mg, 5 mg, 10 mg 1 g, 5 g
Cysteamine (β-MEA; β-Mercaptoethylamine; 2-Aminoethanethiol; Cysteamine Hydrochloride (β-MEA Hydrochloride; 2-Mercaptoethylamine; Decarboxycysteine; MEA; …) Cat. No.: HY-77591A β-Mercaptoethylamine Hydrochloride; …) Cat. No.: HY-77591
Bioactivity: Cysteamine is an agent for the treatment of nephropathic Bioactivity: Cysteamine Hydrochloride is an agent for the treatment of cystinosis and an antioxidant. nephropathic cystinosis and an antioxidant. Target: Others Cysteamine has been shown to increase intracellular glutathione levels in cystinotic cells, thus restoring the altered redox state of the cells. Also increased rates of… Purity: >98% Purity: 98.0% Clinical Data: Launched Clinical Data: Launched Size: 5 g Size: 10mM x 1mL in DMSO, 5 g
24 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Cysteine Protease inhibitor (2-Pyrimidinecarbonitrile, D-(-)-Lactic acid 4-[[4'-(aminomethyl)[1,1'-biphenyl]-3-yl]oxy]-) Cat. No.: HY-17541 ((R)-2-Hydroxypropionic acid) Cat. No.: HY-111095
Bioactivity: Cysteine Protease inhibitor is an inhibitor of cysteine Bioactivity: D-(-)-Lactic acid is a normal intermediate in the fermentation protease. (oxidation, metabolism) of sugar.
Purity: 97.14% Purity: 80.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 100 mg, 500 mg 5 mg, 10 mg, 50 mg, 100 mg
D-Arabitol D-Gluconic acid Cat. No.: HY-N3686 Cat. No.: HY-Y0569
Bioactivity: Arabinitol, D- is a polyol and its accumulation may cause a Bioactivity: D-Gluconic acid is the carboxylic acid by the oxidation with neurotoxic effect in human. antiseptic and chelating properties.
Purity: >98% Purity: >98% Clinical Data: Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 g 1 g
D-Glucose 6-Phosphate D-Glutamine Cat. No.: HY-112537 Cat. No.: HY-100587
Bioactivity: D-Glucose 6-Phosphate is a glucose sugar phosphorylated at the Bioactivity: D-Glutamine is a cell-permeable D type stereoisomer of hydroxy group on carbon 6. Glutamine.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in Water, 50 mg, 100 mg
D-Mannitol D-myo-Inositol 1,4,5-trisphosphate hexapotassium salt (Mannitol; Mannite) Cat. No.: HY-N0378 (Ins(1,4,5)-P3 hexapotassium salt; …) Cat. No.: HY-103642
Bioactivity: D-Mannitol is an osmotic diuretic agent and a weak renal Bioactivity: D-myo-Inositol 1,4,5-trisphosphate hexapotassium salt is the vasodilator. Target: Others D(-)Mannitol is a sugar alcohol hexapotassium salt of D-myo-Inositol 1,4,5-trisphosphate that can be used as an inert osmotic control substance. The (1,4,5-IP3), which is a second messenger that stimulates the uptake and phosphorylation of d-mannitol is catalyzed by the discharge of calcium from the endoplasmic reticulum. mannitol-specific phosphoenolpyruvate-dependent… Purity: 98.0% Purity: 98.0% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 1 mg 5 g, 10 g
D-Xylulose Dapagliflozin Cat. No.: HY-W010256 (BMS-512148) Cat. No.: HY-10450
Bioactivity: D-xylulose is a precursor of the pentiol D-arabitol. Bioactivity: Dapagliflozin (BMS-512148) is a sodium-glucose co-transporter 2 ( SGLT2) inhibitor for the treatment of type 2 diabetes.
Purity: >98% Purity: 99.89% Clinical Data: No Development Reported Clinical Data: Launched Size: Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 25
Dapagliflozin ((2S)-1,2-propanediol, hydrate) DBPR108 (BMS-512148 (2S)-1,2-propanediol, hydrate) Cat. No.: HY-10450A Cat. No.: HY-12528
Bioactivity: Dapagliflozin (2S)-1,2-propanediol, hydrate is the Bioactivity: DBPR108 is a potent, selective, and orally bioavailable S-enantiomer of Dapagliflozin 1,2-propanediol, hydrate. dipeptide-derived inhibitor of DPP4 with IC50 of 15 nM; no Dapagliflozin inhibits sodium/glucose cotransporter 2 ( inhibition on DDP8 and DPP9. SGLT2), which results in excretion of glucose into the uri…
Purity: 99.61% Purity: 99.90% Clinical Data: Phase 4 Clinical Data: Phase 1 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
DC260126 Decanedioic acid Cat. No.: HY-101906 Cat. No.: HY-W014787
Bioactivity: DC260126, a small-molecule antagonist of GPR40. Bioactivity: Decanedioic acid, a normal urinary acid, is found to be associated with carnitine-acylcarnitine translocase deficiency and medium chain acyl-CoA dehydrogenase deficiency.
Purity: 99.70% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 5 g
Delta-Tocopherol Deoxycholic acid Cat. No.: HY-113026 (Cholanoic Acid; Desoxycholic acid) Cat. No.: HY-N0593
Bioactivity: Delta-Tocopherol is an isomer of Vitamin E. Bioactivity: Deoxycholic acid is specifically responsible for activating the G protein-coupled bile acid receptor TGR5 that stimulates brown adipose tissue (BAT) thermogenic activity.
Purity: >98% Purity: 98.0% Clinical Data: Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 100 mg, 500 mg
Deoxycholic acid sodium salt Deriglidole (Sodium deoxycholate) Cat. No.: HY-N0593A (SL 86-0715) Cat. No.: HY-101683
Bioactivity: Deoxycholic acid sodium salt is specifically responsible for Bioactivity: Deriglidole is a peripheral adrenoceptor antagonist with a
activating the G protein-coupled bile acid receptor TGR5 that high affinity for α 2-adrenoceptors. stimulates brown adipose tissue (BAT) thermogenic activity.
Purity: 98.0% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 20 mg 100 mg, 500 mg
Desmopressin Desmopressin Acetate (DDAVP) Cat. No.: HY-17370A (DDAVP) Cat. No.: HY-17370
Bioactivity: Desmopressin(DDAVP) is the synthetic analogue of the Bioactivity: Desmopressin(DDAVP) acetate is the synthetic analogue of the antidiuretic hormone arginine vasopressin. IC50 Value: Target: antidiuretic hormone arginine vasopressin. Vasopressin Receptor The antidiuretic properties of desmopressin have led to its use in polyuric conditions including primary nocturnal enuresis, nocturia, and diabetes… Purity: >98% Purity: 99.76% Clinical Data: Launched Clinical Data: Launched Size: 5 mg, 10 mg, 50 mg Size: 10mM x 1mL in DMSO, 2 mg, 5 mg, 10 mg, 50 mg
26 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Dextrose DG051 (D-Glucose; Grape sugar; Glucopyranose) Cat. No.: HY-B0389 Cat. No.: HY-10825
Bioactivity: Dextrose, a simple sugar (monosaccharide), is an important Bioactivity: DG051 is a potent leukotriene A4 hydrolase inhibitor of carbohydrate in biology. Target: Others Dextrose(D-glucose), a leukotriene B4 biosynthesis in the enzyme assay with an
simple sugar (monosaccharide), is an important carbohydrate in IC50=47 nM. biology.
Purity: 98.0% Purity: 99.65% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g, 5 g 1 mg, 5 mg
DG5128 DGAT-1 inhibitor 2 ((±)-DG5128; Midaglizole hydrochloride) Cat. No.: HY-U00165 (DGAT-1 inhibitor) Cat. No.: HY-50670
Bioactivity: DG5128 is a preferential α2-adrenoceptor antagonist. DG5128 Bioactivity: DGAT-1 inhibitor 2 is an effective inhibitor of DGAT-1;antiobesity agents. exhibits 7.4 times higher affinity ( pKi=6.28) toward α2-adrenoceptor than α1-adrenoceptor.
Purity: >98% Purity: 95.20% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
DGAT1-IN-1 Diacylglycerol acyltransferase inhibitor-1 Cat. No.: HY-12425 Cat. No.: HY-112851
Bioactivity: DGAT1-IN-1 is a potent DGAT1 inhibitor with IC50 of < 10 Bioactivity: Diacylglycerol acyltransferase inhibitor-1 is a diacylglycerol nM(cell lysate from Hep3B cells overexpressing human DGAT1). acyltransferase (DGAT1) inhibitor.
Purity: 95.14% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 25 mg, 50 mg 5 mg, 10 mg, 50 mg, 100 mg
Dihydrodaidzein Diosgenin ((±)-Dihydrodaidzein) Cat. No.: HY-N1461 Cat. No.: HY-N0177
Bioactivity: Dihydrodaidzein is one of the most prominent dietary Bioactivity: Diosgenin, a steroidal saponin, can inhibit STAT3 signaling phytoestrogens. pathway.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 50 mg
Disulfiram DL-Glyceric Acid (Tetraethylthiuram disulfide; TETD) Cat. No.: HY-B0240 Cat. No.: HY-W018035
Bioactivity: Disulfiram is a specific inhibitor of Bioactivity: DL-Glyceric Acid is a compound that is secreted excessively in aldehyde-dehydrogenase (ALDH1), used for the treatment of the urine by patients suffering from D-glyceric aciduria. chronic alcoholism by producing an acute sensitivity to alcohol.
Purity: 98.13% Purity: 97.0% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 2 M * 5 mL in Water 1 g, 5 g
www.MedChemExpress.com 27
DL-Homocystine DL-Norvaline Cat. No.: HY-W009390 (2-Aminopentanoic acid) Cat. No.: HY-W010510
Bioactivity: DL-Homocystine is the double-bonded form of homocysteine and Bioactivity: DL-Norvaline, a derivative of L-norvaline, L-norvaline is a homocysteine is recognized as an important substance in the non-competitive inhibitor of arginase. pathogenesis and pathophysiology of schizophrenia.
Purity: >98% Purity: 97.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 g 5 g
DL-O-Phosphoserine Docosanoic acid Cat. No.: HY-15130 Cat. No.: HY-W013049
Bioactivity: DL-O-Phosphoserine, a normal metabolite in human biofluid, is Bioactivity: Docosanoic acid is poorly absorbed, and a cholesterol-raising an ester of serine and phosphoric acid. saturated fatty acid in humans.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size:
Docosapentaenoic acid 22n-3 Dodecanoylcarnitine Cat. No.: HY-113159 Cat. No.: HY-113166
Bioactivity: Docosapentaenoic acid (22n-3) is a component of phospholipids Bioactivity: Dodecanoylcarnitine is present in fatty acid oxidation found in all animal cell membranes. disorders such as long-chain acyl CoA dehydrogenase deficiency, carnitine palmitoyltransferase I/II deficiency, and is also associated with celiac disease.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size:
Doxercalciferol Doxercalciferol-D3 (1.alpha.-Hydroxyvitamin D2) Cat. No.: HY-32348 Cat. No.: HY-15285
Bioactivity: Doxercalciferol is a Vitamin D2 analog, acts as an activator Bioactivity: Doxercalciferol-D3 is the deuterated form of Doxercalciferol, of Vitamin D receptor, and prevent renal disease. which is a Vitamin D2 analog that acts as a vitamin D receptor activator (VDRA).
Purity: 99.50% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 2 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg Size: 1 mg, 5 mg
DPP-IV-IN-1 Dulaglutide Cat. No.: HY-U00346 (LY2189265) Cat. No.: HY-P0120
Bioactivity: DPP-IV-IN-1 is a potent inhibitor of dipeptidyl peptidase IV Bioactivity: Dulaglutide is a glucagon-like peptide-1 ( GLP-1) receptor
(DPP-IV), a highly specific serine protease, with an IC50 of agonist. 4.6 nM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 1 mg, 5 mg, 10 mg
28 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Dutogliptin Dynasore Cat. No.: HY-10286 Cat. No.: HY-15304
Bioactivity: Dutogliptin is an orally available, potent, and selective Bioactivity: Dynasore is an inhibitor of the GTPase activity of dynamin dipeptidyl peptidase-4 ( DPP4) inhibitor. with an IC50 of 15 μM.
Purity: >98% Purity: 99.61% Clinical Data: Phase 3 Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 10 mg, 50 mg
E 64c E-5324 Cat. No.: HY-100227 Cat. No.: HY-19183
Bioactivity: E 64c is a derivative of naturally occurring epoxide inhibitor Bioactivity: E-5324 is potent inhibitor of acyl-CoA:cholesterol
of cysteine proteases, a Calcium-activated neutral protease acyltransferase ( ACAT) with IC50s of 44 to 190 nM. (CANP) inhibitor and a very weak irreversible cathepsin C inhibitor.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg, 25 mg, 50 mg Size: 1 mg, 5 mg, 10 mg
EAVRLFIEWLKNGGPSSGAPPPS Edasalonexent Cat. No.: HY-P1447 (CAT-1004) Cat. No.: HY-17630
Bioactivity: EAVRLFIEWLKNGGPSSGAPPPS is a polypeptide from patent CN Bioactivity: Edasalonexent is an orally bioavailable NF-κB inhibitor. 106029087 A. The incretin receptor ligands are derived from multiple skin toxicity Shan exosomes -3 skin of SDGTFTSDLSKQM Di EAVRLFIEWLKNGGPSSGAPPPS. Sequence: Glu-Ala-Val-Arg-Leu-Ph e-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-… Purity: 98.29% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
Elafibranor Elaidic acid (GFT505) Cat. No.: HY-16737 Cat. No.: HY-113016
Bioactivity: Elafibranor is a PPARα/δ agonist with EC50s of 45 and 175 Bioactivity: Elaidic acid is the major trans fat found in hydrogenated nM, respectively. vegetable oils and can be used as a pharmaceutical solvent.
Purity: 99.31% Purity: >98% Clinical Data: Launched Clinical Data: Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg, 100 mg
Eliglustat Eliglustat hemitartrate (Genz 99067) Cat. No.: HY-14885 (Genz-112638; Eliglustat tartrate) Cat. No.: HY-14885A
Bioactivity: Eliglustat is an specific, potent and orally active Bioactivity: Eliglustat hemitartrate is an specific, potent and orally
glucocerebroside synthase inhibitor with an IC50 of 24 nM. active glucocerebroside synthase inhibitor with an IC50 of 24 nM.
Purity: 99.95% Purity: 99.83% Clinical Data: Phase 3 Clinical Data: Phase 3 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 50 mg, 100 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 29
Elobixibat EMD638683 (A 3309; AZD 7806) Cat. No.: HY-15790 Cat. No.: HY-15193
Bioactivity: Elobixibat is a potent ileal bile acid transporter (IBAT) Bioactivity: EMD638683 is a highly selective SGK1 inhibitor with IC50 of 3 inhibitor with IC values of 0.53 ± 0.17 nM, 0.13 ± 0.03 nM, 50 μM. and 5.8 ± 1.6 nM for human IBAT, mouse IBAT, and canine IBAT.
Purity: >98% Purity: 99.74% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
EMD638683 R-Form EMD638683 S-Form Cat. No.: HY-15193A Cat. No.: HY-15193B
Bioactivity: EMD638683 R-Form is the R-form of EMD638683. EMD638683 is a Bioactivity: EMD638683 S-Form is the S-form of EMD638683. EMD638683 is a
highly selective SGK1 inhibitor with IC50 of 3 μM. highly selective SGK1 inhibitor with IC50 of 3 μM.
Purity: 99.73% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
EMIGLITATE Emixustat (BAY-o 1248) Cat. No.: HY-16194 (ACU-4429) Cat. No.: HY-19720
Bioactivity: Emiglitate (BAY o 1248) is a potent, selective and competitive Bioactivity: Emixustat, a novel visual cycle modulator, is an inhibitor of
inhibitor of α-glucoside hydrolase. the visual cycle isomerase with an IC50 value of 4.4 nM in vitro.
Purity: 98.0% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Phase 3 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 20 mg 2 mg, 5 mg, 10 mg, 50 mg, 100 mg
Emixustat hydrochloride EML 425 (ACU-4429 hydrochloride) Cat. No.: HY-19720A Cat. No.: HY-110263
Bioactivity: Emixustat hydrochloride strongly inhibits 11-cis-retinol Bioactivity: EML425 is a potent and selective CREB binding protein ( CBP)/ production with IC50 values of 232 ± 3 nM. p300 inhibitor with IC50s of 2.9 and 1.1 μM, respectively.
Purity: 99.50% Purity: >98% Clinical Data: Phase 3 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 25 mg 2 mg, 5 mg, 10 mg, 50 mg, 100 mg
Empagliflozin Enterostatin, human, mouse, rat (BI 10773) Cat. No.: HY-15409 Cat. No.: HY-P1067
Bioactivity: Empagliflozin is a selective sodium glucose cotransporter-2 ( Bioactivity: Enterostatin, human, mouse, rat is a pentapeptide that reduces
SGLT-2) inhibitor with an IC50 of 3.1 nM for human SGLT-2. fat intake.
Purity: 99.91% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg 5 mg, 10 mg, 50 mg, 100 mg
30 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
EP1013 EPAC 5376753 (F1013) Cat. No.: HY-10397 Cat. No.: HY-111446
Bioactivity: EP1013 is a broad-spectrum caspase selective inhibitor, used Bioactivity: EPAC 5376753 is an allosterically inhibitor of Epac which
in the research of type 1 diabetes. inhibits Epac1 with an IC50 of 4 µM in Swiss 3T3 cells.
Purity: 97.76% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
Epalrestat Eprotirome (ONO2235) Cat. No.: HY-66009 (KB2115) Cat. No.: HY-10473
Bioactivity: Epalrestat is an aldose reductase inhibitor for the treatment Bioactivity: Eprotirome is a liver-selective thyroid hormone receptor of diabetic neuropathy. agonist.
Purity: 98.0% Purity: 98.0% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 10 mg, 50 mg, 100 mg 1 mg
Ercalcidiol Ercalcitriol (25-hydroxy Vitamin D2) Cat. No.: HY-32349 (1α,25-Dihydroxy Vitamin D2) Cat. No.: HY-32350
Bioactivity: Ercalcidiol is a metabolite of vitamin D2, is regarded as Bioactivity: Ercalcitriol (1α,25-Dihydroxy Vitamin D2) is a active an indicator of vitamin D nutritional status. metabolite of vitamin D2. IC50 value: Target: Ercalcitriol (1α,25-Dihydroxy Vitamin D2) exhibits equipotent antirachitic activity in rats as calcitriol. Ercalcitriol(1α,25-Dihydroxy Vitamin D2) is a VDR-like Receptors Purity: 98.93% Purity: 98.17% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 25 mg Size: 1 mg, 5 mg, 10 mg, 25 mg
Erdosteine Ertiprotafib (RV 144) Cat. No.: HY-B0289 (PTP 112) Cat. No.: HY-19383
Bioactivity: Erdosteine inhibits lipopolysaccharide (LPS)-induced NF-κB Bioactivity: Ertiprotafib is an inhibitor of PTP1B, IkB kinase β (IKK-β),
activation. and a dual PPARα and PPARβ agonist, with an IC50 of 1.6 μM
for PTP1B, 400 nM for IKK-β, an EC50 of ~1 μM for PPARα/PPARβ. Purity: 99.46% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 1 g, 5 g
ETC-1002 Etebenecid (ESP-55016; Bempedoic acid) Cat. No.: HY-12357 Cat. No.: HY-B0939
Bioactivity: ETC-1002 is an activator of hepatic AMP-activated protein Bioactivity: Etebenecid is a uricosuric agents, lower uric acid levels in kinase ( AMPK). the body by increasing the elimination of uric acid by the kidneys, also inhibits penicillin tubular secretion.
Purity: 98.0% Purity: >98% Clinical Data: Phase 3 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 100 mg 5 mg, 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 31
Ethyl docosa-4,7,10,13,16,19-hexaenoate Ethyl gallate Cat. No.: HY-W011120 Cat. No.: HY-N0525
Bioactivity: Ethyl cis-4,7,10,13,16,19-Docosahexaenoate, the ethyl ester of Bioactivity: Ethyl gallate is a nonflavonoid phenolic compound and also a Docosahexaenoate (DHA), is enriched in the ethyl ester scavenger of hydrogen peroxide. fraction by the selective alcoholysis of fatty acid ethyl esters originating from tuna oil with lauryl alcohol.
Purity: 97.0% Purity: 99.53% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 50 mg 100 mg, 1 g
Ethylmalonic acid Etofibrate Cat. No.: HY-34740 Cat. No.: HY-A0127
Bioactivity: Ethylmalonic acid is non-carcinogenic potentially toxic and Bioactivity: Etofibrate is the ethandiol-1,2 diester of the nicotinic and associated with anorexia nervosa and malonyl-CoA decarboxylase clofibric acids. Etofibrate has been shown to be a potent deficiency. hypolipidemic agent in animal and human.
Purity: >98% Purity: 99.17% Clinical Data: Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g 10 mg, 25 mg
Etomoxir Evocalcet Cat. No.: HY-50202 (KHK7580) Cat. No.: HY-17613
Bioactivity: Etomoxir is a potent inhibitor of carnitine Bioactivity: Evocalcet has an activating effect on calcium sensing palmitoyltransferase-I ( CPT-1). receptor ( CaSR) extracted from patent WO 2017061621 A1, compound A.
Purity: 99.40% Purity: 98.52% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
Exendin 9-39 Exendin-4 Cat. No.: HY-P0264 (Exenatide) Cat. No.: HY-13443
Bioactivity: Exendin (9-39) is a specific and competitive glucagon-like Bioactivity: Exendin-4, a 39 amino acid peptide, is a long-acting
peptide-1 receptor antagonist. Sequence: Asp-Leu-Ser-Lys-Gln-Me glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 t-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly- nM. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys- Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2. Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-As n-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2. Purity: 96.69% Purity: 98.96% Clinical Data: Phase 4 Clinical Data: Phase 4 Size: 500u g, 1 mg, 5 mg Size: 1 mg, 5 mg, 10 mg, 25 mg
Exendin-4 Acetate FAA1 agonist-1 (Exenatide acetate) Cat. No.: HY-13443A (MDK6574) Cat. No.: HY-103083
Bioactivity: Exendin-4 acetate, a 39 amino acid peptide, is a long-acting Bioactivity: FAA1 agonist-1 is a potent free fatty acid receptor 1 (
glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 FFA1/ GPR40) agonist with a pEC50 of 7.54. nM.
Purity: 98.69% Purity: 98.97% Clinical Data: Phase 4 Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 25 mg Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
32 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Fagomine Falecalcitriol (D-Fagomine) Cat. No.: HY-13005 Cat. No.: HY-32342
Bioactivity: Fagomine is a mild glycosidase inhibitor. The Ki of the Bioactivity: Falecalcitriol(Fulstan; Hornel) is an analog of calcitriol; iminosugar Fagomine is 4.8 μM, 39 μM, and 70 μM for has a higher potency both in vivo and in vitro systems, and Amyloglucosidase (A. niger), β-Glucosidase (bovine), and longer duration of action in vivo. Isomaltase (yeast), respectively.
Purity: 98.0% Purity: 99.13% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in Water, Size: 1 mg 2 mg, 5 mg, 10 mg
Famotidine FAS-IN-1 Cat. No.: HY-B0377 Cat. No.: HY-12648
Bioactivity: Famotidine is a competitive histamine H2-receptor antagonist. Bioactivity: FAS-IN-1 is a potent inhibitor of Fatty acid synthase (FAS) Its main pharmacodynamic effect is the inhibition of gastric wtih IC50 of 10 nM, extracted from Patnet WO2012/064642Al. secretion.
Purity: 98.17% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g, 5 g 2 mg, 5 mg, 10 mg, 50 mg
Fasiglifam Febuxostat (TAK-875) Cat. No.: HY-10480 (TEI 6720; TMX 67) Cat. No.: HY-14268
Bioactivity: TAK-875 is a potent, selective and orally bioavailable GPR40 Bioactivity: Febuxostat(TEI 6720;TMX 67 ) is selective xanthine oxidase inhibitor with Ki of 0.6 nM. IC50 value: 0.6 nM (Ki) [1] agonist with EC50 of 72 nM. Target: xanthine oxidase in vitro: Febuxostat displays potent mixed-type inhibition of the activity of purified bovine milk xanthine oxidase, with Ki and Ki' values of 0.6 nM and 3.1 nM… Purity: 98.77% Purity: 99.94% Clinical Data: Phase 3 Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 2 mg, 5 mg, 10 mg, 50 mg, 100 mg, 200 mg 10 mg, 50 mg, 100 mg
Fenofibric acid FGH10019 (FNF acid) Cat. No.: HY-B0760 Cat. No.: HY-16207
Bioactivity: Fenofibric acid, an active metabolite of fenofibrate, is a Bioactivity: FGH10019 is a novel sterol regulatory element-binding protein
PPAR activitor, with EC50s of 22.4 µM, 1.47 µM, and 1.06 µM ( SREBP) inhibitor with IC50 of 1 μM. for PPARα, PPARγ and PPARδ, respectively; Fenofibric acid also
inhibits COX-2 enzyme activity, with an IC50 of 48 nM. Purity: 99.38% Purity: 99.19% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g, 5 g 5 mg, 10 mg, 50 mg, 100 mg
Fidarestat Fisetin (SNK 860) Cat. No.: HY-105185 Cat. No.: HY-N0182
Bioactivity: Fidarestat is an inhibitor of aldose reductase, with IC50s of Bioactivity: Fisetin is a natural flavonol found in many fruits and 26 nM, 33 μM, and 1.8 μM for aldose reductase, AKR1B10 and vegetables with various benefits, such as antioxidant, V301L AKR1B10, respectively; Fidarestat has the potential to anticancer, neuroprotection effects. treat diabetic disease.
Purity: >98% Purity: 98.0% Clinical Data: Launched Clinical Data: Phase 2 Size: 250 mg, 500 mg Size: 10mM x 1mL in DMSO, 100 mg, 500 mg, 1 g
www.MedChemExpress.com 33
FK-448 Free base FPH2 Cat. No.: HY-100193 (BRD-9424) Cat. No.: HY-12281
Bioactivity: FK-448 Free base is an effective and specific inhibitor of Bioactivity: FPH2 induces of functional proliferation of primary human
chymotrypsin, with an IC50 of 720 nM. hepatocytes and may lead to the development of new therapeutics for liver diseases.
Purity: >98% Purity: 99.73% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
FR194738 FR194738 free base Cat. No.: HY-100303A Cat. No.: HY-100303
Bioactivity: FR194738 is a squalene epoxidase inhibitor. FR194738 inhibits Bioactivity: FR194738 free base is a squalene epoxidase inhibitor. FR194738 squalene epoxidase activity in HepG2 cell homogenates with an inhibits squalene epoxidase activity in HepG2 cell homogenates
IC 50 of 9.8 nM. with an IC 50 of 9.8 nM.
Purity: 99.81% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 1 mg, 5 mg, 10 mg
Fructose FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Cat. No.: HY-N0395 Cat. No.: HY-P1229
Bioactivity: Fructose is a simple ketonic monosaccharide found in many Bioactivity: FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 plants, where it is often bonded to glucose to form the peptide derivative. Sequence: Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln- disaccharide sucrose. Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gl y-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser.
Purity: 98.0% Purity: 98.01% Clinical Data: Phase 4 Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 1 mg, 5 mg, 10 mg 1 g, 5 g
Fucoxanthin Fudosteine (all-trans-Fucoxanthin) Cat. No.: HY-N2302 Cat. No.: HY-B0393
Bioactivity: Fucoxanthin is a marine carotenoid and shows anti-obesity, Bioactivity: Fudosteine is a novel mucoactive agent and a MUC5AC mucin anti-diabetic, anti-oxidant, anti-inflammatory and anticancer hypersecretion inhibitor. Target: Others Fudosteine is a activities. cysteine derivative that is used as an expectorant in chronic bronchial inflammatory disorders. The administration of fudosteine during the challenge with ovalbumin prevented the… Purity: 99.17% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in Water, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 100 mg
Fumaric acid Furosemide Cat. No.: HY-W015883 Cat. No.: HY-B0135
Bioactivity: Fumaric acid, associated with fumarase deficiency, is Bioactivity: Furosemide (Lasix) is a loop diuretic inhibitor of Na+/2Cl-/K+ identified as an oncometabolite or an endogenous, cancer (NKCC) cotransporter of which used in the treatment of causing metabolite. congestive heart failure and edema.
Purity: >98% Purity: 99.83% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 g 1 g, 5 g
34 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Furosemide sodium Galantide Cat. No.: HY-B0135A Cat. No.: HY-P0262
Bioactivity: Furosemide sodium (Lasix) is a loop diuretic inhibitor of Bioactivity: Galantide is a reversible and non-specific galanin receptor Na+/2Cl-/K+ (NKCC) cotransporter of which used in the antagonist. Sequence: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu- treatment of congestive heart failure and edema. Leu-Gly-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2.
Purity: >98% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 1 g, 5 g Size: 500u g, 1 mg, 5 mg
Gallic acid Gastric Inhibitory Peptide (GIP), human (3,4,5-Trihydroxybenzoic acid) Cat. No.: HY-N0523 Cat. No.: HY-P0276
Bioactivity: Gallic acid is an antioxidant which can inhibit both COX-2 Bioactivity: Gastric Inhibitory Peptide (GIP), human is thought to act as and acetyl CoA carboxylase ( ACC). an inhibitor of gastric functions. Sequence: Tyr-Ala-Glu-Gly-T hr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln -Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-T rp-Lys-His-Asn-Ile-Thr-Gln. Purity: 99.97% Purity: 96.07% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 500u g, 1 mg, 5 mg 100 mg, 500 mg
Gastric mucin GC 14 Cat. No.: HY-B2196 Cat. No.: HY-111442
Bioactivity: Gastric mucin is a large glycoprotein which is thought to play Bioactivity: GC 14 is a thyroid hormone antagonist. a major role in the protection of the gastrointestinal tract from acid, proteases, pathogenic microorganisms, and mechanical trauma.
Purity: Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 g Size: 250 mg, 500 mg
Gemfibrozil Gemigliptin (CI-719) Cat. No.: HY-B0258 (LC15-0444) Cat. No.: HY-14892
Bioactivity: Gemfibrozil is an activator of PPAR-α, used as a Bioactivity: Gemigliptin is a highly selective dipeptidyl peptidase 4
lipid-lowering drug; Gemfibrozil is also a nonselective (DPP4) inhibitor with a KD of 7.25 nM. inhibitor of several P450 isoforms, with Ki values for CYP2C9, 2C19, 2C8, and 1A2 of 5.8, 24, 69, and 82 μM, respectively. Purity: 99.91% Purity: 98.31% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg, 500 mg 10 mg, 50 mg, 100 mg
Genipin Genz-123346 ((+)-Genipin) Cat. No.: HY-17389 Cat. No.: HY-12744A
Bioactivity: Genipin is a natural water soluble crosslinking reagent. Bioactivity: Genz-123346 is an inhibitor of GL1 synthase that blocks the
conversion of ceramide to GL1; inhibits GM1 with IC50 value of 14 nM.
Purity: 99.40% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 25 mg 50 mg, 100 mg
www.MedChemExpress.com 35
Genz-123346 free base Geraniin Cat. No.: HY-12744 Cat. No.: HY-N0472
Bioactivity: Genz-123346 (free base) is an inhibitor of GL1 synthase that Bioactivity: Geraniin is a TNF-α releasing inhibitor with numerous blocks the conversion of ceramide to GL1; inhibits GM1 with activities including anticancer, anti-inflammatory, and
IC50 value of 14 nM. anti-hyperglycemic activities, with an IC50 of 43 μM.
Purity: 99.59% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg 5 mg, 10 mg, 25 mg, 50 mg
GHRP-2 metabolite 1 GI 181771 ((D-Ala)-(D-beta-Nal)-Ala) Cat. No.: HY-P0169A Cat. No.: HY-11076
Bioactivity: GHRP-2 metabolite 1 is one of the GHRP-2 metabolites. Growth Bioactivity: GI 181771 is a cholecystokinin 1 receptor agonist investigated hormone releasing peptide -2 (GHRP-2), a peptide with six for the treatment of obesity. amino acid units (D-Ala-D-beta- + Nal-Ala-Trp-D-Phe-Lys-NH
2), is a synthetic agonist of ghrelin. GHRP-2 can significantly promote the release of growth hormone, improving… Purity: 99.96% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 25 mg Size: 250 mg, 500 mg
Ginkgolide C Glibenclamide (BN-52022; Ginkgolide-C) Cat. No.: HY-N0785 (Glyburide) Cat. No.: HY-15206
Bioactivity: Ginkgolide C is a flavone isolated from Ginkgo biloba leaves, Bioactivity: Glibenclamide(Glyburide) is a sulfonylurea compound that possessing multiple biological functions, such as decreasing modulates insulin production. IC50 value: Target: platelet aggregation and ameliorating Alzheimer disease. Sulfonylureas bind to ATP-dependent K+ channels in beta cells of the pancreas, depolarizing them and stimulating the release of Ca2+, which in turn stimulates insulin production.… Purity: 98.0% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 10 mg, 50 mg 1 g, 5 g
Glimepiride Glipizide (Glimperide) Cat. No.: HY-B0104 (CP 28720; K 4024) Cat. No.: HY-B0254
Bioactivity: Glimepiride(Amaryl) is a medium-to-long acting sulfonylurea Bioactivity: Glipizide is used to treat high blood sugar levels caused by a anti-diabetic compound with an ED50 of 182 μg/kg. type of diabetes mellitus called type 2 diabetes.
Purity: 99.80% Purity: 99.47% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g, 5 g 100 mg, 500 mg
GLP-1 moiety from Dulaglutide GLP-1(7-36) Acetate Cat. No.: HY-P1348 (Human GLP-1-(7-36)-amide Acetate) Cat. No.: HY-P0054
Bioactivity: GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Bioactivity: GLP-1(7-36) Acetate is a major intestinal hormone that Dulaglutide which is a glucagon-like peptide 1 receptor stimulates glucose-induced insulin secretion from β cells. (GLP-1) agonist, extracted from patent US 20160369010 A1. Sequence: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr- Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr- Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gl Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gl… y-Arg-NH2. Purity: 96.23% Purity: 98.42% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 1 mg, 5 mg Size: 500u g, 1 mg, 5 mg, 10 mg
36 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
GLP-2(1-33)(human) GLPG0974 (GLP-2 (human); Glucagon-like peptide 2 (human)) Cat. No.: HY-P1024 Cat. No.: HY-12940
Bioactivity: GLP-2(1-33) (human) is an enteroendocrine hormone which can Bioactivity: GLPG0974 is a free fatty acid receptor-2 (FFA2/GPR43) bind to the GLP-2 receptor and stimulate the growth of antagonist with an IC50 of 9 nM. intestinal epithelium. Sequence: His-Ala-Asp-Gly-Ser-Phe-Ser-A sp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile -Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp. Purity: 95.12% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500u g, 1 mg, 5 mg Size: 250 mg, 500 mg
Glucagon Glucagon receptor antagonists-1 (Porcine glucagon) Cat. No.: HY-P0082 Cat. No.: HY-10036
Bioactivity: Glucagon is a peptide hormone that helps regulate the blood Bioactivity: Glucagon receptor antagonists-1 is a highly potent glucagon sugar (glucose) levels in the body. receptor antagonist.
Purity: 96.85% Purity: 90.0% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg 5 mg, 10 mg, 50 mg
Glucagon receptor antagonists-2 Glucagon receptor antagonists-3 Cat. No.: HY-50158 Cat. No.: HY-50159
Bioactivity: Glucagon receptor antagonists-2 is a highly potent glucagon Bioactivity: Glucagon receptor antagonists-3 is a highly potent glucagon receptor antagonist. receptor antagonist.
Purity: 92.14% Purity: 95.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg 5 mg, 10 mg
Glucagon receptor antagonists-4 Glucagon-Like Peptide (GLP) I (7-36), amide, human Cat. No.: HY-19947 (Human GLP-1-(7-36)-amide) Cat. No.: HY-P0054A
Bioactivity: Glucagon receptor antagonists-4 is a highly potent glucagon Bioactivity: Glucagon-Like Peptide (GLP) I (7-36), amide, human is a receptor antagonist. It displays low in vivo clearance and physiological incretin hormone that stimulates insulin excellent oral bioavailability in both rats and dogs. secretion.
Purity: 98.09% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 500u g, 1 mg, 5 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
Glucagon-like peptide 1 (1-37), human Glucocorticoid receptor agonist (HuGLP-1) Cat. No.: HY-P1145 Cat. No.: HY-14234
Bioactivity: Glucagon-like peptide 1 (1-37), human is a highly potent Bioactivity: Glucocorticoid receptor agonist is a potent Glucocorticoid agonist of the GLP-1 receptor. receptor agonist. IC50 value: Target:
Purity: >98% Purity: 98.57% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500u g, 1 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg
www.MedChemExpress.com 37
Glutaric acid Glutarylcarnitine Cat. No.: HY-W008820 Cat. No.: HY-113005
Bioactivity: Glutaric acid induces oxidative stress in brain of young rats. Bioactivity: Glutarylcarnitine is the diagnostic metabolite for malonic aciduria and glutaric aciduria type I monitored in most tandem mass spectrometry newborn screening programmes.
Purity: 97.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 g
Glutathione oxidized GLX351322 (L-Glutathione oxidized; GSSG) Cat. No.: HY-D0844 Cat. No.: HY-100111
Bioactivity: Glutathione oxidized is produced by the oxidation of Bioactivity: GLX351322 is an inhibitor of NADPH oxidase 4, and inhibits glutathione which is a major intracellular antioxidant and hydrogen peroxide production from NOX4-overexpressing cells
detoxifying agent. with an IC50 of 5 μ M.
Purity: 98.30% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 250 mg, 500 mg 100 mg
Glycodeoxycholate Sodium Glycogen (Sodium glycyldeoxycholate) Cat. No.: HY-N1427 Cat. No.: HY-113511
Bioactivity: Glycodeoxycholate Sodium is a bile salt. Bioactivity: Glycogen is a glycolytic intermediates and high-energy phosphates that can serve as a form of energy storage in humans, animals, fungi, and bacteria.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size:
Glycolic acid Glycolic acid oxidase inhibitor 1 Cat. No.: HY-W015967 Cat. No.: HY-22166
Bioactivity: Glycolic Acid is an inhibitor of tyrosinase, suppressing Bioactivity: Glycolic acid oxidase inhibitor 1 is a glycolate oxidase melanin formation and lead to a lightening of skin colour. inhibitor, extracted from patent EP0021228A1, in Table IV.
Purity: >98% Purity: 99.64% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g 5 mg, 10 mg, 50 mg, 100 mg
Glycylglycine Glycyrrhizic acid Cat. No.: HY-D0889 (Glycyrrhizin) Cat. No.: HY-N0184
Bioactivity: Diglycine is the simplest of all peptides and could function Bioactivity: Glycyrrhizic acid is a triterpenoid saponinl, acting as a as a gamma-glutamyl acceptor. direct HMGB1 antagonist, with anti-tumor, anti-diabetic activities.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Phase 4 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 g 50 mg, 100 mg, 200 mg
38 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Glyhexamide GNE-617 (SQ 15860; Serbose; Subose) Cat. No.: HY-U00012 Cat. No.: HY-15766
Bioactivity: Glyhexamide is an effective hypoglycemic agent in adult Bioactivity: GNE-617 is a specific NAMPT inhibitor that inhibits the diabetics. biochemical activity of NAMPT with an IC50 of 5 nM and exhibits efficacy in xenograft models of cancer.
Purity: >98% Purity: 99.46% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 2 mg, 5 mg, 10 mg, 50 mg, 100 mg
Gosogliptin GPR120 Agonist 2 (PF-00734200; PF-734200) Cat. No.: HY-10287 Cat. No.: HY-111353
Bioactivity: Gosogliptin is a potent and selective inhibitor of dipeptidyl Bioactivity: GPR120 Agonist 2 is a GPR120 agonist extracted from patent US peptidase-IV ( DPP-IV). 20110313003 A1, example 209.
Purity: >98% Purity: 98.12% Clinical Data: Phase 3 Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
GPR120 modulator 1 GPR120 modulator 2 Cat. No.: HY-50162 Cat. No.: HY-50172
Bioactivity: GPR120 modulator 1 is useful for modulating G protein-coupled Bioactivity: GPR120 modulator 2 is useful for modulating G protein-coupled receptor 120 (GPR120). receptor 120 (GPR120).
Purity: 98.62% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg 5 mg, 10 mg, 50 mg
GPR120-IN-1 GPR40 Activator 1 Cat. No.: HY-101492 Cat. No.: HY-13971
Bioactivity: GPR120-IN-1 is a selective Gpr120 agonist with a logEC50 of Bioactivity: GPR40 Activator 1 is a potent GPR40 activator for treatment of −7.62. type 2 diabetes.
Purity: 98.01% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
GPR40 Activator 2 GPR40 Agonist 2 Cat. No.: HY-12647 Cat. No.: HY-U00395
Bioactivity: GPR40 Activator 2 is a potent GPR40 activator from patents WO Bioactivity: GPR40 Agonist 2 is a GPR40 agonist that can be used in the 2012147516 A1, WO 2012046869A1 and WO 2011078371 A1. research of diabetes, extracted from patent WO2009054479A1.
Purity: 99.63% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 5 mg, 10 mg, 50 mg
www.MedChemExpress.com 39
GRA Ex-25 Grapiprant Cat. No.: HY-50675 (CJ-023423; RQ-00000007; AAT-007) Cat. No.: HY-16781
Bioactivity: GRA Ex-25 is an inhibitor of glucagon receptor, with IC50 of Bioactivity: Grapiprant is a selective EP4 receptor antagonist whose 56 and 55 nM for rat and human glucagon receptors, physiological ligand is prostaglandin E2 (PGE2). Target: respectively. prostaglandin receptor in vitro: Grapiprant is a novel pharmacologically active ingredient, acts as a selective EP4 receptor antagonist whose physiological ligand is… Purity: 99.12% Purity: 99.68% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 2 mg, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 25 mg, 50 mg
GSK-3 inhibitor 1 GSK0660 Cat. No.: HY-13973A Cat. No.: HY-12377
Bioactivity: GSK-3 inhibitor 1 is an inhibitor of GSK-3. Bioactivity: GSK0660 is a potent antagonist of PPARβ and PPARδ, with
IC50s of both 155 nM, and is nearly inactive on PPARα and
PPARγ with IC 50s of both >10 μM.
Purity: >98% Purity: 99.27% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
GSK1292263 GSK137647A Cat. No.: HY-12066 (GSK 137647) Cat. No.: HY-19995
Bioactivity: GSK1292263 is a novel GPR119 receptor agonist used for the Bioactivity: GSK137647A is a selective FFA4 agonist, with pEC50 of 6.3, treatment of type 2 diabetes. IC50 value: Target: GPR119 in 6.2, and 6.1 for human, Mouse and Rat FFA4, respectively. vitro: GSK-1292263 is selected from 1538 compounds by using Hypo1, the Fit-Value and Estimate of GSK-1292263 that is aligned in Hypo1 are 8.8 and 7.7 (nM), respectively [1]. in… Purity: 98.77% Purity: 99.98% Clinical Data: Phase 2 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
GSK2033 GSK2330672 Cat. No.: HY-108688 (linerixibat) Cat. No.: HY-16643
Bioactivity: GSK2033 is a LXR antagonist with pIC50s of 7 and 7.4 for Bioactivity: GSK2330672 is a highly potent, nonabsorbable ASBT(apical LXRα or LXRβ, respectively. sodium-dependent bile acid transporter) inhibitor (hASBT IC50=42 ± 3 nM) which lowers glucose in an animal model of type 2 diabetes and shows excellent developability properties for evaluating the potential therapeutic utility of a… Purity: 98.83% Purity: 99.55% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
GSK376501A GSK4112 Cat. No.: HY-101746 (SR6452) Cat. No.: HY-14414
Bioactivity: GSK376501A is a selective peroxisome proliferator-activated Bioactivity: GSK4112 is a Rev-erbα agonist with EC50 of 0.4 μM, also is a receptor gamma ( PPARγ) modulator for the treatment of type 2 small molecule chemical probe for the cell biology of the diabetes mellitus. nuclear heme receptor Rev-erbα. IC50 value: 0.4 μM (EC50) Target: Rev-erbα in vitro: GSK4112 profiled as a Rev-erb agonist in cells to inhibit expression of the circadian target… Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
40 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Guaifenesin (Guaiacol glyceryl ether; Guaiphenesin; Glycerol Cat. No.: HY-P1231 guaiacolate) Cat. No.: HY-B0264
Bioactivity: GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 Bioactivity: Guaifenesin is an expectorant that also has some muscle peptide derivative. Sequence: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser- relaxing action. Target: Others Guaifenesin is thought to act Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Ly as an expectorant by increasing the volume and reducing the s-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. viscosity of secretions in the trachea and bronchi. It also stimulates the flow of respiratory tract secretions, allowing… Purity: 99.03% Purity: 97.75% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 1 g, 5 g
Guanidine hydrochloride Guanidinosuccinic acid (Guanidinium chloride; Aminoformamidine Hydrochloride) Cat. No.: HY-B0178A Cat. No.: HY-113373
Bioactivity: Guanidine HCl, the crystalline compound of strong alkalinity Bioactivity: Guanidinosuccinic acid is a nitrogenous metabolite isolated in formed by the oxidation of guanine, is a normal product of excess from serum and urine. protein metabolism and a protein denaturant.
Purity: 99.0% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 10 g, 50 g 10 mg, 50 mg, 100 mg
Guanylic acid GW 4064 (5'-GMP; E 626) Cat. No.: HY-N5134 Cat. No.: HY-50108
Bioactivity: Guanylic acid is involved in several metabolic disorders, Bioactivity: GW 4064 is a potent FXR agonist with EC50 of 65 nM. including the AICA-ribosiduria pathway, adenosine deaminase deficiency, adenine phosphoribosyltransferase deficiency (aprt), and the 2-hydroxyglutric aciduria pathway.
Purity: >98% Purity: 99.42% Clinical Data: Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg, 200 mg
GW 501516 GW-1100 (GW 1516; GSK-516) Cat. No.: HY-10838 Cat. No.: HY-50691
Bioactivity: GW 501516 is a PPARδ agonist with an EC50 of 1.1 nM. Bioactivity: GW-1100 is a selective GPR40 antagonist with a pIC50 of 6.9. GW1100 acts as a GPR40 inverse agonist.
Purity: 99.26% Purity: 95.13% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg
GW0742 GW1929 (GW610742) Cat. No.: HY-13928 Cat. No.: HY-15655
Bioactivity: GW0742 is a high affinity PPAR β/δ agonist with an IC50 of 1 Bioactivity: GW1929 is a potent PPAR-γ activator, with pK is of 8.84, < 5.5, and < 6.5 for human PPAR-γ, PPAR-α, and PPAR-δ, and nM for human PPARδ, and EC50s of 1 nM, 1.1 μM and 2 μM for pEC s of 8.56 and 8.27 for human PPAR-γ and murine human PPARδ, PPARα, and PPARγ, respectively. 50 PPAR-γ, respectively. Purity: 99.63% Purity: 99.68% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 25 mg, 50 mg
www.MedChemExpress.com 41
GW9508 H-Abu-OH Cat. No.: HY-15589 Cat. No.: HY-W010589
Bioactivity: GW9508 is a potent and selective agonist for FFA1 (GPR40) with Bioactivity: H-Abu-OH, one of the three isomers of aminobutyric acid, is pEC50 of 7.32, 100-fold selective against GPR120, stimulates elevated in the plasma of children with with Reye's syndrome, insulin secretion in a glucose-sensitive manner. tyrosinemia, homocystinuria, nonketotic hyperglycinemia, and ornithine transcarbamylase deficiency.
Purity: 99.19% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 10 mg, 50 mg, 100 mg 1 g
H-D-Trp-OH H-Gly-Pro-OH Cat. No.: HY-W012479 Cat. No.: HY-W016887
Bioactivity: H-D-Trp-OH is a D-stereoisomer of tryptophan and occasionally Bioactivity: H-Gly-Pro-OH is an end product of collagen metabolism that is found in naturally produced peptides such as the marine venom further cleaved by prolidase. peptide.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g 99 mg
H-HoArg-OH H-HoPro-OH Cat. No.: HY-W008385 Cat. No.: HY-W012734
Bioactivity: H-HoArg-OH, a homologue arginine, is a strong inhibitor of Bioactivity: H-HoPro-OH is a breakdown product of lysine, accumulates in human bone and liver alkaline phosphatase. body fluids of infants with generalized genetic peroxisomal disorders, such as Zellweger syndrome, neonatal adrenoleukodystrophy.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg 100 mg
HAEGTFTSD HAEGTFTSDVS Cat. No.: HY-P1226 Cat. No.: HY-P1224
Bioactivity: HAEGTFTSD is the first N-terminal 1-9 residues of GLP-1 Bioactivity: HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide. Sequence: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp. peptide. Sequence: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser.
Purity: 98.04% Purity: 98.31% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 1 mg, 5 mg, 10 mg
HAEGTFTSDVSSYLE HCGRP-(8-37) Cat. No.: HY-P1445 (Human α-CGRP (8-37)) Cat. No.: HY-P1014
Bioactivity: HAEGTFTSDVSSYLE is a polypeptide from patent CN 102920658 B. Bioactivity: HCGRP-(8-37) is a human calcitonin gene-related peptide GLP-I analog contains the Sequence: (hCGRP) fragment and also an antagonist of CGRP receptor. His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu. Sequence: Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly- Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Al a-Phe . Purity: 98.16% Purity: 98.28% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 500u g, 1 mg, 5 mg
42 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Heparastatin HIF-2α-IN-1 Cat. No.: HY-100899 Cat. No.: HY-19949
Bioactivity: Heparastatin is a heparanase inhibitor. Bioactivity: HIF-2α-IN-1 is a HIF-2α inhibitor has an IC50 of less than 500 nM in HIF-2α scintillation proximity assay.
Purity: >98% Purity: 99.45% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg
Hippuric acid HM30181 (2-Benzamidoacetic acid) Cat. No.: HY-W016562 (HM30181A) Cat. No.: HY-13646
Bioactivity: Hippuric Acid, an acyl glycine produced by the conjugation of Bioactivity: HM30181 is a potent and selective inhibitor of P-glycoprotein. benzoic acid and glycine, is a normal component in urine as a metabolite of aromatic compounds from food.
Purity: >98% Purity: 97.03% Clinical Data: No Development Reported Clinical Data: Phase 1 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 g 5 mg, 10 mg, 50 mg, 100 mg
Homovanillic acid HSL-IN-2 (Vanilacetic acid) Cat. No.: HY-N0384 Cat. No.: HY-102056
Bioactivity: Homovanillic acid is a dopamine metabolite found to be Bioactivity: HSL-IN-2 is a potent and selective inhibitor of Hormone
associated with aromatic L-amino acid decarboxylase Sensitive Lipase ( HSL), with an IC50 of 0.023 μM. deficiency, celiac disease, growth hormone deficiency, and sepiapterin reductase deficiency.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 100 mg
HTS01037 Hydrocarbon chain derivative 1 Cat. No.: HY-101503 (6,6'-Oxybis[2,2-dimethyl-1-hexanol]) Cat. No.: HY-U00332
Bioactivity: HTS01037 is an inhibitor of fatty acid binding; and a Bioactivity: Hydrocarbon chain derivative 1 is an active compound, with competitive antagonist of protein-protein interactions mediated inhibitory activities against lipid synthesis.
by AFABP/aP2 with a Ki of 0.67 μM.
Purity: 99.01% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 20 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Hydrochlorothiazide Hydrocortisone phosphate (HCTZ) Cat. No.: HY-B0252 (Hydrocortisone 21-phosphate) Cat. No.: HY-B1155
Bioactivity: Hydrochlorothiazide is a diuretic drug of the thiazide class. Bioactivity: Hydrocortisone phosphate is the pharmaceutical term for cortisol, which is a steroid hormone, in the glucocorticoid class of hormones, increases blood sugar through gluconeogenesis, to suppress the immune system, and to aid in the metabolism of fat, protein, and carbohydrate. Purity: 99.20% Purity: >98% Clinical Data: Launched Clinical Data: Launched Size: 5 g, 10 g Size: 50 mg
www.MedChemExpress.com 43
Hydroxocobalamin hydrochloride Hyodeoxycholic acid (Vitamin B12a hydrochloride) Cat. No.: HY-B2209A (HDCA) Cat. No.: HY-N0169
Bioactivity: Hydroxocobalamin hydrochloride (Vitamin B12a hydrochloride) is Bioactivity: Hyodeoxycholic acid is a secondary bile acid formed in the a naturally occurring vitamin B12 form found in food and used small intestine by the gut flora, and acts as a TGR5
as a dietary supplement in the treatment of vitamin B12 (GPCR19) agonist, with an EC50 of 31.6 µM in CHO cells. deficiency.
Purity: 98.0% Purity: >98% Clinical Data: Phase 4 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 100 mg 50 mg, 100 mg
Ibiglustat Ibiglustat succinate (Venglustat; GZ/SAR402671; GZ402671; SAR402671) Cat. No.: HY-16743 (Venglustat (succinate); GZ/SAR402671 (succinate)) Cat. No.: HY-16743A
Bioactivity: Ibiglustat is an inhibitor of glucosylceramide synthase Bioactivity: Ibiglustat (succinate) is a selective inhibitor of extracted from patent WO 2015089067 A1, compound example 64. glucosylceramide synthase.
Purity: 98.85% Purity: >98% Clinical Data: Phase 2 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 2 mg, 5 mg, 10 mg, 50 mg, 100 mg 2 mg, 5 mg, 10 mg, 50 mg, 100 mg
Ilaprazole Imeglimin (IY-81149) Cat. No.: HY-101664 (EMD 387008) Cat. No.: HY-14771
Bioactivity: Ilaprazole (IY-81149) is a proton pump inhibitor; inhibits Bioactivity: Imeglimin is the first antidiabetic compound that induces an + + increase in mitochondrial phospholipid composition, H /K -ATPase with an IC50 of 6.0 μM. contributing to improvements in hepatic mitochondrial function.
Purity: 98.0% Purity: >98% Clinical Data: Launched Clinical Data: Phase 2 Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg, 100 mg 2 mg, 5 mg, 10 mg, 50 mg, 100 mg
Imeglimin hydrochloride Imidacloprid (EMD 387008 hydrochloride) Cat. No.: HY-14771A Cat. No.: HY-B0838
Bioactivity: Imeglimin hydrochloride is the first antidiabetic compound Bioactivity: Imidacloprid is an effective and widely used neonicotinoid that induces an increase in mitochondrial phospholipid pesticide to control pests of cereals, vegetables, tea and composition, contributing to improvements in hepatic cotton. mitochondrial function.
Purity: 98.0% Purity: 98.27% Clinical Data: Phase 2 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 100 mg, 200 mg, 500 mg
IMIRESTAT Implitapide (AL 1576; Alcon 1576; HOE 843) Cat. No.: HY-16255 (AEGR 427) Cat. No.: HY-106130
Bioactivity: IMIRESTAT is an aldose reductase inhibitor, used for the Bioactivity: Implitapide is a microsomal triglyceride transfer protein ( treatment of diabetes. MTP) inhibitor.
Purity: 99.52% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg 1 mg, 5 mg, 10 mg, 20 mg
44 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Implitapide Racemate Impurity C of Alfacalcidol Cat. No.: HY-U00329 Cat. No.: HY-13294
Bioactivity: Implitapide Racemate is the racemate of Implitapide. Bioactivity: Impurity of Alfacalcidol. Alfacalcidol Implitapide is a microsomal triglyceride transfer protein (1-hydroxycholecalciferol; Alpha D3; 1.alpha.-Hydroxyvitamin (MTP) inhibitor. D3) is a non-selective VDR activator medication.
Purity: >98% Purity: 99.81% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 1 mg
Indeglitazar Insulin levels modulator (PPM 204) Cat. No.: HY-14817 Cat. No.: HY-112819
Bioactivity: Indeglitazar is an orally available peroxisome Bioactivity: Insulin levels modulator could be used to treat diabetes. proliferator-activated receptor ( PPAR) pan-agonist for all three PPAR subtypes alpha (α), delta (δ) and gamma (γ).
Purity: 99.42% Purity: >98% Clinical Data: Phase 2 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 1 mg, 5 mg, 10 mg, 20 mg
Insulin(cattle) Insulin(human) (Insulin from bovine pancreas) Cat. No.: HY-P1156 Cat. No.: HY-P0035
Bioactivity: Insulin cattle is a kind of polypeptide hormone that regulates Bioactivity: Insulin(human) is a peptide hormone that regulates the level glucose metabolism in pancreatic islet B-cells. of sugar (glucose) in the blood and that is produced by the beta cells of the pancreatic islets.
Purity: 98.60% Purity: 96.90% Clinical Data: No Development Reported Clinical Data: Launched Size: 10 mg, 25 mg, 50 mg, 100 mg Size: 10 mg, 25 mg, 50 mg, 100 mg
IOWH-032 Ipragliflozin Cat. No.: HY-18337 (ASP1941) Cat. No.: HY-14894
Bioactivity: IOWH-032 is a novel and potent CFTR inhibitor (IC50=1.01 uM) Bioactivity: Ipragliflozin (ASP1941) is a highly potent and selective SGLT2 in T84 and CHO-CFTR cell based assays. IC50 value: 1.01 uM inhibitor with IC50 of 2.8 nM; little and NO potency for (CHO-CFTR FLIPR) [1] Target: CFTR Profiling of iOWH032 showed SGLT1/3/4/5/6. IC50 value: 2.8 nM [1][2] Target: SGLT2 in it to be a CFTR inhibitor in T84 and CHO-CFTR cell based vitro: Ipragliflozin potently and selectively inhibited human, assays. It also demonstrated statistical significant… rat, and mouse SGLT2 at nanomolar ranges and exhibited… Purity: >98% Purity: 98.67% Clinical Data: Phase 2 Clinical Data: Phase 4 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 10 mg, 50 mg 5 mg, 10 mg, 50 mg, 100 mg, 200 mg, 500 mg
Ipragliflozin L-Proline Ipriflavone (Sugura) Cat. No.: HY-14894A Cat. No.: HY-N0094
Bioactivity: Ipragliflozin (L-Proline) is a highly potent and selective Bioactivity: Ipriflavone is a synthetic isoflavone derivative used to
SGLT2 inhibitor with an IC50 of 2.8 nM; little and NO potency suppress bone resorption. for SGLT1/3/4/5/6.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg, 50 mg Size: 10mM x 1mL in DMSO, 1 g, 5 g
www.MedChemExpress.com 45
Isoacteoside Isoastragaloside I (Isoverbascoside) Cat. No.: HY-N0022 (Isoastragaloside-I) Cat. No.: HY-N0887
Bioactivity: Isoacteoside is a natural compound which exhibit significant Bioactivity: Isoastragaloside I is a natural compound from the medicinal inhibition of advanced glycation end product formation with herb Radix Astragali; possesses the activity of elevating IC50 values of 4.6-25.7 μM, compared with those of adiponectin production. aminoguanidine (IC50=1,056 μM) and quercetin (IC50=28.4 μM) as positive controls. Purity: 97.73% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 10 mg, 50 mg, 100 mg 5 mg, 10 mg
Isomaltose Isotanshinone IIA (6-O-α-D-Glucopyranosyl-D-glucose; D-Isomaltose) Cat. No.: HY-N3018 Cat. No.: HY-N6650
Bioactivity: Isomaltose is composed of two glucose units and suitable as a Bioactivity: Isotanshinone IIA, an abietane-type diterpene metabolite, non-cariogenic sucrose replacement and is favorable in could non-competitively inhibit Protein Tyrosine Phosphatase
products for diabetics and prediabetic dispositions. 1B ( PTP1B) activity with an IC50 0f 11.4 μM.
Purity: >98% Purity: >98% Clinical Data: Clinical Data: No Development Reported Size: Size: 5 mg
Ivosidenib JD-5037 (AG-120) Cat. No.: HY-18767 Cat. No.: HY-18697
Bioactivity: Ivosidenib (AG-120) is a mutant isocitrate dehydrogenase 1 ( Bioactivity: JD-5037 is a novel, peripherally restricted CB1R antagonist IDH1) inhibitor with an IC of 12 nM for mouse IDH1 R132H. 50 with an IC50 of 1.5 nM.
Purity: 99.05% Purity: 98.05% Clinical Data: Phase 3 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
JNJ-17203212 JTT 551 Cat. No.: HY-100129 Cat. No.: HY-19779
Bioactivity: JNJ-17203212 is a novel and selective TRPV1 antagonist, with Bioactivity: JTT 551 is selective a protein tyrosine phosphatase 1B (
IC50 of 65 nM and 102 nM for human TRPV1 and rat TRPV1. PTP1B) inhibitor, with Kis of 0.22 μM and 9.3 μM for PTP1B and TCPTP (T-cell protein tyrosine phosphatase), respectively; JTT 551 can be used in the research of type 2 diabetes mellitus. Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Kaempferitrin KAT681 (Lespedin; Lespenephryl) Cat. No.: HY-N0628 (T0681) Cat. No.: HY-U00220
Bioactivity: Kaempferitrin is a natural flavonoid, possesses Bioactivity: KAT681 is a liver-selective thyromimetic. antinociceptive, anti-inflammatory, anti-diabetic, antitumoral and chemopreventive effects, and activates insulin signaling pathway.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
46 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Katacalcin KD-3010 (PDN 21) Cat. No.: HY-P0149 Cat. No.: HY-111068
Bioactivity: Katacalcin is a second potent plasma calcium-lowering peptide. Bioactivity: KD3010 is a potent, orally active, and selective PPARδ Sequence: Asp-Met-Ser-Ser-Asp-Leu-Glu-Arg-Asp-His-Arg-Pro-His- agonist. Val-Ser-Met-Pro-Gln-Asn-Ala-Asn.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500u g, 1 mg, 5 mg, 10 mg Size: 250 mg, 500 mg
Kemptide Ketohexokinase inhibitor 1 Cat. No.: HY-P0248 Cat. No.: HY-U00461
Bioactivity: Kemptide is a synthetic heptapeptide that acts as a specific Bioactivity: Ketohexokinase inhibitor 1 is an inhibitor of ketohexokinase substrate for cAMP-dependent protein kinase ( PKA). Sequence: (KHK), with IC50s of 8.4 nM and 66 nM for KHK-C and KHK-A, Leu-Arg-Arg-Ala-Ser-Leu-Gly. respectively, extracted from patent US 20170183328 A1, example 4.
Purity: 98.0% Purity: 98.09% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 25 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg
KI696 KIRA6 Cat. No.: HY-101140 Cat. No.: HY-19708
Bioactivity: KI696 is a high affinity probe that disrupts the Keap1/NRF2 Bioactivity: KIRA6 allosterically inhibits IRE1α RNase kinase activity with
interaction. an IC50 of 0.6 µM.
Purity: 99.25% Purity: 98.75% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 1 mg, 5 mg, 10 mg
KML29 KN-62 Cat. No.: HY-18977 Cat. No.: HY-13290
Bioactivity: KML29 is a potent and selective MAGL inhibitor with IC50 = Bioactivity: KN-62 is a selective and potent inhibitor of
5.9, 15, and 43 nM in human, mouse, and rat brain proteomes, calmodulin-dependent protein kinase II ( CaMK-II) with IC50 respectively. of 0.9 μM, KN-62 also displays noncompetitive antagonism at
P2X7 receptors in HEK293 cells, with an IC50 value… Purity: 99.21% Purity: 99.16% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg
KQMEEEAVRLFIEWLKNGGPSSGAPPPS KRN5 Cat. No.: HY-P1223 Cat. No.: HY-112126
Bioactivity: KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide Bioactivity: KRN5 is a Nuclear factor of activated T cells 5 (NFAT5)
derivative. Sequence: Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu- suppressor, with an IC50 of 750 nM. Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pr o-Pro-Ser.
Purity: 97.75% Purity: 98.49% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
www.MedChemExpress.com 47
KU-32 KU14R Cat. No.: HY-108248 Cat. No.: HY-15481
Bioactivity: KU-32 is a novel, novobiocin-based Hsp90 inhibitor that can Bioactivity: KU14R is a new I(3)-R antagonist, which selectively blocks the protect against neuronal cell death. insulin secretory response to imidazolines.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size: 5 mg, 10 mg
Kuromanin chloride Kuwanon A (Chrysontemin; Cyanidin 3-O-glucoside chloride) Cat. No.: HY-N0640 Cat. No.: HY-N2300
Bioactivity: Kuromanin (chloride), extracted from mulberry leaves, has been Bioactivity: Kuwanon A is a flavone derivative isolated from the root barks shown to improve blood glucose concentrations and lipid of the mulberry tree ( Morus alba L.); inhibits nitric oxide
homeostasis and to reduce obesity. production with an IC50 of 10.5 μM.
Purity: 99.26% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 2 mg, 5 mg, 10 mg, 25 mg 2 mg, 5 mg, 10 mg, 25 mg
KW-8232 free base L-(+)-Arabinose Cat. No.: HY-100304 Cat. No.: HY-W015611
Bioactivity: KW-8232 free base is an anti-osteoporotic agent, and can Bioactivity: L-(+)-Arabinose selectively inhibits intestinal sucrase reduces the biosynthesis of PGE2. activity in a noncompetitive manner and suppresses the plasma glucose increase due to sucrose ingestion.
Purity: >98% Purity: 95.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 1 g
L-165041 L-5,6,7,8-Tetrahydrofolic acid (THFA; Tetrahydrofolic acid; Cat. No.: HY-20019 Tetrahydropteroylglutamic acid) Cat. No.: HY-14520
Bioactivity: L-165041 is a cell permeable PPARδ agonist, with Kis of 6 nM Bioactivity: L-5,6,7,8-Tetrahydrofolic acid, a folic acid derivative, which and appr 730 nM for PPARδ and PPARγ, respectively, and induces is a coenzyme in many reactions, especially in the metabolism adipocyte differentiation in NIH-PPARδ cells. of amino acids and nucleic acids.
Purity: 99.14% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg, 100 mg
L-Alanine L-Arabinitol (L-2-Aminopropionic acid) Cat. No.: HY-N0229 Cat. No.: HY-W040141
Bioactivity: L-Alanine is a non-essential amino acid, involved in sugar and Bioactivity: L-Arabinitol is a potential biomarker for the comsuption of acid metabolism, increases immunity, and provides energy for the food products such as sweet potato, deerberry, moth bean, muscle tissue, brain, and central nervous system. and is also associated with Alzheimer's disease and ribose-5-phosphate isomerase deficiency.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 g 1 g
48 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
L-Ascorbic acid L-Carnitine (L-Ascorbate; Vitamin C) Cat. No.: HY-B0166 (Levocarnitine) Cat. No.: HY-B0399
Bioactivity: Ascorbic acid is a naturally occurring organic compound with Bioactivity: L-carnitine is constituent of striated muscle and liver. It is antioxidant properties. used therapeutically to stimulate gastric and pancreatic secretions and in the treatment of hyperlipoproteinemias. Target: Others L-Carnitine is an endogenous molecule involved in fatty acid metabolism, biosynthesized within the human body… Purity: 99.89% Purity: 98.0% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in Water, Size: 5 g, 10 g 1 g
L-Carnosine L-Cysteine Cat. No.: HY-W013494 Cat. No.: HY-Y0337
Bioactivity: L-Carnosine is a dipeptide of the amino acids beta-alanine and Bioactivity: L-Cysteine is a thiol-containing non-essential amino acid that histidine and has the potential to suppress many of the is oxidized to form cystine. biochemical changes that accompany aging.
Purity: >98% Purity: 97.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 1 g
L-Glutamine L-Gulono-1,4-lactone (L-Glutamic acid 5-amide) Cat. No.: HY-N0390 Cat. No.: HY-W016628
Bioactivity: L-Glutamine is a non-essential amino acid present abundantly Bioactivity: L-Gulono-1,4-lactone catalyzes the last step of the throughout the body and is involved in gastrointestinal biosynthesis of L-ascorbic (Vatamin) C in plants and animals. disorders. Target: mGluR Glutamine (abbreviated as Gln or Q) is one of the 20 amino acids encoded by the standard genetic code. It is not recognized as an essential amino acid, but may… Purity: 98.0% Purity: >98% Clinical Data: Phase 4 Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 10mM x 1mL in DMSO, 100 mg, 500 mg 1 g
L-Hexanoylcarnitine L-Hisidine Cat. No.: HY-113144 Cat. No.: HY-N0832
Bioactivity: L-Hexanoylcarnitine is an acylcarnitine and is found to be Bioactivity: L-Hisidine is an essential amino acid for infants. L-Hisidine associated with celiac disease. is an inhibitor of mitochondrial glutamine transport.
Purity: >98% Purity: 99.94% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in Water, 1 g
L-Homocitrulline L-Homocystine Cat. No.: HY-W018004 Cat. No.: HY-W011690
Bioactivity: L-Homocitrulline is metabolized to homoarginine through Bioactivity: L-Homocystine is the oxidized member of the L-homocysteine. homoargininosuccinate via the urea cycle pathway and its Homocysteine is a pro-thrombotic factor, vasodilation metabolic abnormality could lead to Lysinuric Protein impairing agent, pro-inflammatory factor and endoplasmatic Intolerance (LPI). reticulum-stress inducer used to study cardiovascular disease mechanisms. Purity: 97.0% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg 100 mg
www.MedChemExpress.com 49
L-Ornithine Hydrochloride L-Phenylalanine Cat. No.: HY-W017018 ((S)-2-Amino-3-phenylpropionic acid) Cat. No.: HY-N0215
Bioactivity: L-Ornithine Hydrochloride is a free amino acid that plays a Bioactivity: L-Phenylalanine is an antagonist at α2δ calcium channels with central role in the urea cycle and is also important for the a Ki of 980 nM. disposal of excess nitrogen.
Purity: 97.0% Purity: 98.06% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in Water, 100 mg, 500 mg 1 g
L162441 Lafutidine Cat. No.: HY-U00245 (FRG-8813) Cat. No.: HY-B0160
Bioactivity: L162441 is an Angiotensin type 1 receptor antagonist. Bioactivity: Lafutidine, a newly developed histamine H(2)-receptor antagonist, inhibits gastric acid secretion.
Purity: >98% Purity: 97.86% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 10 mg, 50 mg
Lanifibranor Lanosterol (IVA337) Cat. No.: HY-104049 Cat. No.: HY-W020033
Bioactivity: Lanifibranor is a pan peroxisome proliferator-activated Bioactivity: Lanosterol is a key triterpenoid intermediate in the biosynthesis of Cholesterol. receptor ( PPAR) agonist with EC50s of 1.5, 0.87 and 0.21 μM for human PPARα, PPARσ and PPARγ, respectively.
Purity: 98.89% Purity: >98% Clinical Data: No Development Reported Clinical Data: Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg, 100 mg
Lathosterol LCQ-908 Cat. No.: HY-113486 (Pradigastat) Cat. No.: HY-16278
Bioactivity: Lathosterol is a cholesterol-like molecule. Serum Lathosterol Bioactivity: LCQ-908 is a new generation of diacylglycerol acyltransferase concentration is an indicator of whole-body cholesterol 1 ( DGAT1) inhibitor as anti-obesity and anti-diabetic synthesis. agents.
Purity: >98% Purity: 96.39% Clinical Data: No Development Reported Clinical Data: Phase 3 Size: 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
LDL-IN-3 Leptin (22-56), human Cat. No.: HY-U00054 Cat. No.: HY-P1523
Bioactivity: LDL-IN-3 is an anti-atherosclerotic compound extracted from Bioactivity: Leptin (22-56), human is the fragment of leptin, mediated via patent WO/2005/039596A1, example C25 and patent US 6133467, several isoforms of receptors ( Ob-Rs). example 3.
Purity: >98% Purity: 95.20% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 500u g, 1 mg, 5 mg
50 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Lesinurad Lesinurad sodium (RDEA594) Cat. No.: HY-15258 (RDEA-594 sodium) Cat. No.: HY-15258A
Bioactivity: Lesinurad is a URAT1 and OAT inhibitor, is determined to be Bioactivity: Lesinurad sodium is a URAT1 and OAT inhibitor, is determined a substrate for the kidney transporters OAT1 and OAT3 with to be a substrate for the kidney transporters OAT1 and OAT3
Km values of 0.85 and 2 µM, respectively. with Km values of 0.85 and 2 µM, respectively.
Purity: 99.89% Purity: 99.92% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg, 200 mg
LGD-6972 Licochalcone C Cat. No.: HY-12525 Cat. No.: HY-N0374
Bioactivity: LGD-6972 is a glucagon receptor antagonist. Bioactivity: Licochalcone C could inhibit α-glucosidase, with IC50s of <100 nM and 92.43 μM for α-glucosidase and protein tyrosine phosphatase 1B (PTP1B), respectively.
Purity: 98.0% Purity: >98% Clinical Data: Phase 2 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
Licogliflozin Linagliptin (LIK066) Cat. No.: HY-109092 (BI 1356) Cat. No.: HY-10284
Bioactivity: Licogliflozin is a sodium glucose cotransporter ( SGLT1 and Bioactivity: Linagliptin is a highly potent, selective DPP-4 inhibitor
SGLT2) inhibitor. with IC50 of 1 nM.
Purity: 98.53% Purity: 99.62% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg, 250 mg, 1 g
Liraglutide Lith-O-Asp Cat. No.: HY-P0014 Cat. No.: HY-112415
Bioactivity: Liraglutide is a glucagon-like peptide-1 ( GLP-1) receptor Bioactivity: Lith-O-Asp is a sialytransferase (ST) inhibitor, with IC50s of agonist used clinically to treat type 2 diabetes mellitus. 12-37 μM.
Purity: 99.96% Purity: 98.0% Clinical Data: Launched Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Lithocholic acid Lixisenatide (3α-Hydroxy-5β-cholanic acid) Cat. No.: HY-B0172 Cat. No.: HY-P0119
Bioactivity: Lithocholic acid is a toxic secondary bile acid, causes Bioactivity: Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor intrahepatic cholestasis, has tumor-promoting activity. agonist that can be used in the treatment of type 2 diabetes Target: Others Lithocholic acid has been used in a study to mellitus (T2DM). Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp assess cholestasis and its action on several organs and -Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-T tissues in rats. It has also been used in a study to… rp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys… Purity: 98.00% Purity: 98.36% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in Water, 1 g, 5 g 1 mg, 5 mg, 10 mg
www.MedChemExpress.com 51
LMPTP INHIBITOR 1 dihydrochloride LMPTP INHIBITOR 1 hydrochloride Cat. No.: HY-111489B Cat. No.: HY-111489A
Bioactivity: LMPTP INHIBITOR 1 (dihydrochloride) is a selective inhibitor Bioactivity: LMPTP INHIBITOR 1 (hydrochloride) is a selective inhibitor of of low molecular weight protein tyrosine phosphatase ( low molecular weight protein tyrosine phosphatase ( LMPTP),
LMPTP), with an IC50 of 0.8 μM LMPTP-A. with an IC50 of 0.8 μM LMPTP-A.
Purity: 99.63% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
Lobetyolin Lodelaben Cat. No.: HY-N0327 (SC-39026; Declaben) Cat. No.: HY-100240
Bioactivity: Lobetyolin is derived from Codonopsis pilosula and has Bioactivity: Lodelaben is a human neutrophil elastase inhibitor with an IC50 antioxidative effect. and Ki of 0.5 and 1.5 μM, respectively.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg Size: 1 mg, 5 mg, 10 mg
Loureirin B Loxiglumide Cat. No.: HY-N1504 (CR-1505) Cat. No.: HY-B2154
Bioactivity: Loureirin B, a flavonoid extracted from Dracaena Bioactivity: Loxiglumide is a cholecystokinin ( CCK-1) receptor cochinchinensis, is an inhibitor of plasminogen activator antagonist.
inhibitor-1 (PAI-1), with an IC 50 of 26.10μM; Loureirin B
also inhibits KATP, the phosphorylation of ERK and JNK Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg Size: 10mM x 1mL in DMSO, 10 mg, 50 mg, 100 mg
LP-533401 LP-533401 hydrochloride Cat. No.: HY-15849 Cat. No.: HY-15849A
Bioactivity: LP-533401 is a Tryptophan hydroxylase 1 inhibitor that Bioactivity: LP-533401 hydrochloride is a tryptophan hydroxylase 1 regulates serotonin production in the gut. inhibitor that regulates serotonin production in the gut.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 25 mg 1 mg, 5 mg, 10 mg, 25 mg
LS2265 Lubiprostone Cat. No.: HY-100189 (RU-0211; SPI-0211) Cat. No.: HY-B0679
Bioactivity: LS2265 is a taurine derivative of fenofibrate and can induce Bioactivity: Lubiprostone(SPI-0211;RU0211) is a gastrointestinal agent used proliferation of peroxisomes in liver cells of rats. for the treatment of idiopathic chronic constipation.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 50 mg
52 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Luteinizing Hormone Releasing Hormone (LH-RH), salmon LX-4211 Cat. No.: HY-P0243 (Sotagliflozin; LP-802034) Cat. No.: HY-15516
Bioactivity: Luteinizing Hormone Releasing Hormone (LH-RH), salmon is the Bioactivity: LX-4211 is a potent dual SGLT2/1 inhibitor; Antidiabetic hypophysiotropic decapeptide synthesized in the hypothalamus agents. that plays a crucial role in the control of reproductive functions. Sequence: {Glp}-His-Trp-Ser-Tyr-Gly-Trp-Leu-Pro-Gly-NH2. Purity: >98% Purity: 99.89% Clinical Data: No Development Reported Clinical Data: Phase 3 Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg
LXR-623 LY 345899 (WAY 252623) Cat. No.: HY-10629 Cat. No.: HY-101943
Bioactivity: LXR-623 is a highly brain-penetrant LXRα-partial/ LXRβ-full Bioactivity: LY 345899 is a human cytosolic methylenetetrahydrofolate dehydrogenase/cyclohydrolase (DC301) inhibitor, with a K of agonist, with IC50 of 179 and 24 nM for LXR-β and the LXR-α i subtype, respectively. 0.018 μM.
Purity: 99.40% Purity: >98% Clinical Data: Phase 1 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 5 mg, 10 mg, 50 mg, 100 mg, 200 mg
LY2562175 LY2608204 Cat. No.: HY-103704 Cat. No.: HY-13529
Bioactivity: LY2562175 is a potent and selective FXR agonist with an Bioactivity: LY2608204 is a activator of glucokinase (GK) with EC50 of 42 nM. EC50 of 193 nM.
Purity: >98% Purity: 98.18% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 1 mg, 5 mg, 10 mg, 25 mg, 50 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
MAFP Maltotetraose (Methyl Arachidonyl Fluorophosphonate) Cat. No.: HY-103334 (Amylotetraose; Fujioligo 450; α-1,4-Tetraglucose) Cat. No.: HY-N2464
Bioactivity: MAFP (Methyl Arachidonyl Fluorophosphonate) is an selective, Bioactivity: Maltotetraose can be used as a substrate for the active-site directed and irreversible inhibitor of cPLA2 and enzyme-coupled determination of amylase activity in biological iPLA2. MAFP is also a potent irreversible inhibitor of fluids. anandamide amidase.
Purity: 98.0% Purity: 99.59% Clinical Data: No Development Reported Clinical Data: Size: 27 mM * 500 uL in Methyl Acetate, Size: 10mM x 1mL in DMSO, 27 mM * 100 uL in Methyl Acetate, 5 mg, 10 mg
Mastoparan Maxacalcitol Cat. No.: HY-P0246 (22-Oxacalcitriol) Cat. No.: HY-32339
Bioactivity: Mastoparan, a tetradecapeptide which is a component of wasp Bioactivity: Maxacalcitol (22-Oxacalcitriol) is non-calcemic vitamin D3 venom, stimulates release of prolactin from cultured rat analog and ligand of VDR-like receptors. IC50 value: Target: anterior pituitary cells. Sequence: Maxacalcitol (22-Oxacalcitriol)suppresses parathyroid hormone Ile-Asn-Leu-Lys-Ala-Leu-Ala-Ala-Leu-Ala-Lys-Lys-Ile-Leu-NH2. (PTH) mRNA expression in vitro and in vivo. Maxacalcitol exhibits similar effects to calcitriol in osteoblast-like… Purity: 98.15% Purity: 98.83 Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg, 25 mg Size: 1 mg, 5 mg, 10 mg, 25 mg
www.MedChemExpress.com 53
Maxacalcitol-D6 MB-07729 Cat. No.: HY-15329 Cat. No.: HY-16308
Bioactivity: Maxacalcitol-D6 is the deuterated form of Maxacalcitol Bioactivity: MB-07729 is a potent fructose 1,6-bisphosphatase (FBPase) (22-Oxacalcitriol), which is a non-calcemic vitamin D3 analog noncompetitive inhibitor with IC50 values of 31, 121, and 189 and VDR ligand of VDR-like receptors. nM for human, monkey, and rat, respectively.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg Size: 250 mg, 500 mg
MB-07803 MB05032 Cat. No.: HY-16309 Cat. No.: HY-16307
Bioactivity: MB07803 is an orally available prodrug of a potent, Bioactivity: MB05032 is a special and efficacious GNG inhibitor targeted noncompetitive inhibitor (MB07729) of fructose the AMP binding site of fructose 1,6-bisphosphatase (FBPase)
1,6-bisphosphatase (FBPase), with EC50 of 140 nM and t1/2 with an IC50 value of 16 nM. of 7.6±2.9 h.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
MBX 102 MBX-2982 (JNJ 39659100; Arhalofenate) Cat. No.: HY-14831 Cat. No.: HY-15291
Bioactivity: MBX 102 is a selective partial agonist of peroxisome Bioactivity: MBX-2982 is a selective, orally-available G protein-coupled proliferator-activated receptor (PPAR)-γ, used for the receptor 119 ( GPR119) agonist. treatment of type 2 diabetes.
Purity: >98% Purity: 99.39% Clinical Data: Phase 2 Clinical Data: Phase 2 Size: 1 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
MC 976 MC-4R Agonist 1 Cat. No.: HY-15267 Cat. No.: HY-U00396
Bioactivity: MC 976 is a Vitamin D3 derivative. Bioactivity: MC-4R Agonist 1 is an agonist of human melanocortin-4 receptor (MC-4R), used in the research of obesity, diabetes, and sexual dysfunction.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg Size: 1 mg, 5 mg, 10 mg
MCH-1 antagonist 1 MCHr1 antagonist 1 Cat. No.: HY-100331 Cat. No.: HY-U00353
Bioactivity: MCH-1 antagonist 1 is a potent melanin concentrating hormone ( Bioactivity: MCHr1 antagonist 1 is a selective antagonist of melanin
MCH-1) antagonist with a Ki of 2.6 nM. MCH-1 antagonist 1 concentrating hormone-1 (MCH1) receptor, with a Kb of 1 nM also inhibits CYP3A4 with an IC of 10 μM. 50 and a Ki of 4 nM at human MCH1, and may be used to reduce the body mass. Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
54 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
MCHr1 antagonist 2 McN3716 Cat. No.: HY-100321 (Methyl palmoxirate; NSC359682) Cat. No.: HY-U00159
Bioactivity: MCHr1 antagonist 2 is an antagonist of melanin Bioactivity: McN3716 is a carnitine palmitoyltransferase I ( CPT-1)
concentrating hormone receptor 1, with an IC50 of 65 nM; inhibitor.
MCHr1 antagonist 2 also inhibits hERG, with an IC50 of 4.0 nM in IMR-32 cells. Purity: >98% Purity: 95.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
Melanin Concentrating Hormone, salmon Melinamide (MCH (salmon)) Cat. No.: HY-P1525 (AC 223; DL-N-(α-Methylbenzyl)linoleamide) Cat. No.: HY-101722
Bioactivity: Melanin Concentrating Hormone, salmon is a 19-amino-acid Bioactivity: Melinamide, an amide derivative of an unsaturated long-chain neuropeptide initially identified in the pituitary gland of fatty acid, is an inhibitor of cholesterol absorption with an
teleost fish, which regulates food intake, energy balance, IC50 of 20.9 μM. sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G… Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500u g, 1 mg, 5 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
Meprednisone Metadoxine Cat. No.: HY-B0243 Cat. No.: HY-B1898
Bioactivity: Meprednisone is a glucocorticoid and a methylated derivative Bioactivity: Metadoxine blocks adipocyte differentiation in association of prednisone. Target: Glucocorticoid Receptor Meprednisone is with inhibition of the protein kinase A-cAMP response element a glucocorticoid and a methylated derivative of prednisone. binding protein (PKA-CREB) pathway. The methylprednisone to MPL area under the curve ratio decreased from 0.19 +/- 0.04 in control to 0.14 +/- 0.03 in… Purity: 99.36% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10 mg, 100 mg Size: 10mM x 1mL in DMSO, 50 mg
Methionine sulfoxide Methocarbamol Cat. No.: HY-W010104A Cat. No.: HY-B0262
Bioactivity: Methionine sulfoxide is an oxidation product of methionine Bioactivity: Methocarbamol is a central muscle relaxant used to treat with reactive oxygen species and can be regarded as a skeletal muscle spasms. biomarker of oxidative stress in vivo.
Purity: >98% Purity: 99.94% Clinical Data: Clinical Data: Launched Size: Size: 10mM x 1mL in DMSO, 100 mg, 500 mg
Methyl deacetylasperulosidate (6α-Hydroxygeniposide; Methylcobalamin Deacetylasperulosidic acid methyl ester) Cat. No.: HY-N1503 Cat. No.: HY-B0586
Bioactivity: Methyl deacetylasperulosidate is an iridoid isolated from Bioactivity: Methylcobalamin a cobalamin, is a form of vitamin B12. Target: Borreria and Spermacoce species. Others Methylcobalamin is a cobalamin, a form of vitamin B12. It differs from cyanocobalamin in that the cyanide is replaced by a methyl group. Methylcobalamin features an octahedral cobalt(III) centre. Methylcobalamin can be obtained as bright… Purity: 98.37% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Phase 4 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg 100 mg, 500 mg
www.MedChemExpress.com 55
Metyrapone MF498 (Su-4885) Cat. No.: HY-B1232 Cat. No.: HY-10794
Bioactivity: Metyrapone is an inhibitor of cytochrome P450-mediated ω/ω-1 Bioactivity: MF498 is a novel and selective E prostanoid receptor 4 (EP4 hydroxylase activity and CYP11B1. Target: CYP11B1 Metyrapone receptor) antagonist, displayed strong binding affinity for is a drug used in the diagnosis of adrenal insufficiency and the EP4 receptor with Ki of 0.7 nM. occasionally in the treatment of Cushing's syndrome (hypercortisolism). Metyrapone blocks cortisol synthesis by… Purity: 99.83% Purity: 98.90% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 10mM x 1mL in DMSO, 500 mg 1 mg, 5 mg, 10 mg
MGAT2-IN-1 MGAT2-IN-2 Cat. No.: HY-101857 Cat. No.: HY-U00430
Bioactivity: MGAT2-IN-1 is an orally active inhibitor of monoacylglycerol Bioactivity: MGAT2-IN-2 is a potent and selective acyl CoA:monoacylglycerol
acyltransferase (MGAT2) with IC50 of 7.8 and 2.4 nM for human acyltransferase 2 ( MGAT2) inhibitor with an IC50 of 3.4 and mouse MGAT2, respectively. nM.
Purity: 98.63% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 25 mg 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Miglitol Mitiglinide Calcium (BAY1099; BAY-m1099) Cat. No.: HY-B0481 (KAD-1229; S21403) Cat. No.: HY-17398
Bioactivity: Miglitol is an oral anti-diabetic drug that acts by inhibiting Bioactivity: Mitiglinide(KAD-1229; S21403) is a drug for the treatment of the ability of the patient to breakdown complex carbohydrates type 2 diabetes; it is a highly selective KATP channel into glucose. Target: Others Miglitol is an oral anti-diabetic antagonist. drug that acts by inhibiting the ability of the patient to breakdown complex carbohydrates into glucose. It is primarily… Purity: 98.0% Purity: 98.88% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in Water, Size: 10mM x 1mL in DMSO, 1 g, 5 g 100 mg, 200 mg, 500 mg
Mitiglinide calcium hydrate Mitoquinone (KAD-1229 calcium hydrate; S-21403 calcium hydrate) Cat. No.: HY-B0682A (MitoQ; MitoQ10) Cat. No.: HY-100116
Bioactivity: Mitiglinide calcium hydrate is a drug for the treatment of Bioactivity: Mitoquinone is a mitochondria-targeted antioxidant designed type 2 diabetes; it is a highly selective KATP channel to accumulate within mitochondria in vivo in order to protect antagonist. against oxidative damage.
Purity: >98% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 50 mg, 100 mg, 500 mg Size: 5 mg, 10 mg, 25 mg
Mitoquinone mesylate (Mitoquinone methanesulfonate; MitoQ10 MK 0893 mesylate; MitoQ mesylate) Cat. No.: HY-100116A Cat. No.: HY-50663
Bioactivity: Mitoquinone mesylate is a TPP-based, mitochondrially Bioactivity: MK 0893 is a potent, selective glucagon receptor antagonist
targeted antioxidant. with IC50 of 6.6 nM, and > 200 fold selectivity against GIPR, PAC1, GLP-1R, VPAC1 and VPAC2.
Purity: 98.0% Purity: 99.22% Clinical Data: Phase 4 Clinical Data: Phase 2 Size: 5 mg, 10 mg, 25 mg, 50 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
56 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
MK-0557 MK-3903 Cat. No.: HY-15411 Cat. No.: HY-107988
Bioactivity: MK-0557 is a highly selective, orally available neuropeptide Bioactivity: MK-3903 is a potent and selective AMP-activated protein Y5 receptor antagonist with a K of 1.6 nM. i kinase ( AMPK) activator with an EC50 of 8 nM.
Purity: 98.28% Purity: 98.10% Clinical Data: Phase 3 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg, 200 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
MK-4074 MK-4256 Cat. No.: HY-107709 Cat. No.: HY-13466
Bioactivity: MK-4074 is a liver-specific inhibitor of acetyl-CoA carboxylase Bioactivity: MK-4256 is a potent and selective SSTR3 antagonist with IC50s ACC1 and ACC2 with IC values of approximately 3 nM. 50 of 0.66 nM and 0.36 nM in human and mouse receptor binding assays, respectively.
Purity: 98.72% Purity: 98.63% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
MK-6913 MK-8245 (Tetrahydrofluoroene 52) Cat. No.: HY-100327 Cat. No.: HY-13070
Bioactivity: Tetrahydrofluoroene 52 is a potent and selective estrogen Bioactivity: MK-8245 is a liver-targeting inhibitor of stearoyl-CoA receptor β agonist. desaturase (SCD) with IC50 of 1 nM for human SCD1 and 3 nM for both rat SCD1 and mouse SCD1, with anti-diabetic and anti-dyslipidemic efficacy.
Purity: >98% Purity: 99.39% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 2 mg, 5 mg, 10 mg, 50 mg, 100 mg
MK-8245 Trifluoroacetate MK196 Cat. No.: HY-13077 (Indacrinone; Indacrynic acid; Indanone) Cat. No.: HY-U00242
Bioactivity: MK-8245 trifluoroacetate is a liver-targeting inhibitor of Bioactivity: MK196 (MK-196) is an investigational diuretic which has stearoyl-CoA desaturase (SCD) with IC50 of 1 nM for human SCD1 pronounced saluretic activity in the rat and dog as well as and 3 nM for both rat SCD1 and mouse SCD1, with anti-diabetic both uricosuric and saluretic activity in the chimpanzee. and anti-dyslipidemic efficacy.
Purity: 98.09% Purity: >98% Clinical Data: Phase 2 Clinical Data: No Development Reported Size: 5 mg, 10 mg, 50 mg, 100 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
MK8722 ML-109 Cat. No.: HY-111363 Cat. No.: HY-114116
Bioactivity: MK8722 is a potent and systemic pan-AMPK activator. Bioactivity: ML-109 is a potent and full thyroid stimulating hormone
receptor (TSHR) agonist, with an EC 50 of 40 nM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size: 5 mg, 10 mg, 25 mg
www.MedChemExpress.com 57
Monacolin J Monocrotaline (Antibiotic MB 530A; Lovastatin diol lactone) Cat. No.: HY-104051 (Crotaline) Cat. No.: HY-N0750
Bioactivity: Monacolin J is an inhibitor of cholesterol biosynthesis, and Bioactivity: Monocrotaline is an pyrrolizidine alkaloid extracted from the inhibits the activity of HMG-CoA reductase. seeds of the Crotalaria spectabilis plant to induce pulmonary hypertension in rodents.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Phase 4 Size: 250 mg, 500 mg Size: 10mM x 1mL in DMSO, 50 mg, 100 mg, 200 mg
Morroniside Motilin, canine Cat. No.: HY-N0532 (Motilin (canine)) Cat. No.: HY-P1541
Bioactivity: Morroniside has neuroprotective effect by inhibiting neuron Bioactivity: Motilin, canine is a 22-amino acid peptide. Motilin is a apoptosis and MMP2/9 expression. potent agonist for gastrointestinal smooth muscle contraction.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 5 mg, 10 mg, 25 mg
MSI-1701 N-Acetyl-D-glucosamine (N-Acetyl-2-amino-2-deoxy-D-glucose; Cat. No.: HY-12219B N-Acetyl-2-amino-2-deoxyglucose) Cat. No.: HY-A0132
Bioactivity: MSI-1701 is an analogue of MSI-1436 which can control weight Bioactivity: N-Acetyl-D-Glucosamine is a monosaccharide derivative of gain and blood glucose level extracted from patent US 7410959 glucose. B1.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 50 mg 1 g
N-Acetyl-L-tyrosine N-Isovaleroylglycine Cat. No.: HY-W012382 Cat. No.: HY-W015464
Bioactivity: N-Acetyl-L-tyrosine originates from tyrosine through an AA Bioactivity: N-Isovaleroylglycine is an acyl glycine and could be used as a acetylase, is associated with aromatic L-amino acid biomarker for the predispositon for weight gain and obesity. decarboxylase deficiency and tyrosinemia I.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 g 100 mg
N-Nornuciferine N-Oleoyl glycine Cat. No.: HY-N2129 Cat. No.: HY-113204
Bioactivity: N-Nornuciferine is an aporphine alkaloid in lotus leaf that Bioactivity: N-Oleoyl glycine is a lipoamino acid, which stimulates
significantly inhibits CYP2D6 with IC50 and Ki of 3.76 and adipogenesis associated with activation of CB1 receptor and 2.34 μM, respectively. Akt signaling pathway in 3T3-L1 adipocyte.
Purity: 99.18% Purity: >98% Clinical Data: No Development Reported Clinical Data: Size: 10mM x 1mL in DMSO, Size: 10 mg 5 mg, 10 mg
58 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Naveglitazar racemate NB-598 Cat. No.: HY-U00036 Cat. No.: HY-16343
Bioactivity: Naveglitazar racemate is the racemate of Naveglitazar. Bioactivity: NB-598 is a potent and competitive inhibitor of squalene Naveglitazar is a nonthiozolidinedione peroxisome epoxidase (SE), and suppresses triglyceride biosynthesis proliferator-activated receptor ( PPAR) α-γ dual, γ-dominant through the farnesol pathway. agonist that has shown glucose-lowering potential in animal models and in the clinic. Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 5 mg, 10 mg, 50 mg
NB-598 hydrochloride NB-598 Maleate Cat. No.: HY-16343A Cat. No.: HY-16343C
Bioactivity: NB-598 hydrochloride is a potent and competitive inhibitor of Bioactivity: NB-598 (Maleate) is a potent and competitive inhibitor of squalene epoxidase (SE), and suppresses triglyceride squalene epoxidase (SE), and suppresses triglyceride biosynthesis through the farnesol pathway. biosynthesis through the farnesol pathway.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg, 50 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
ND-630 Neferine (GS-0976; NDI-010976; firsocostat) Cat. No.: HY-16901 ((-)-Neferine) Cat. No.: HY-N0441
Bioactivity: ND-630 is an acetyl-CoA carboxylase ( ACC) inhibitor; Bioactivity: Neferine is a major bisbenzylisoquinline alkaloid. Neferine strongly inhibits NF-κB activation. inhibits human ACC1 and ACC2 with IC50 values of 2.1 and 6.1 nM, respectively.
Purity: 98.72% Purity: 99.92% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 5 mg, 10 mg, 25 mg, 50 mg
Neostigmine Bromide NGD-4715 (Eustigmin bromide; Neoserine bromide) Cat. No.: HY-B0423 Cat. No.: HY-100318
Bioactivity: Neostigmine Bromide is a cholinesterase inhibitor used in the Bioactivity: NGD-4715 is a selective and orally active treatment of myasthenia gravis. melanin-concentrating hormone receptor 1 (MCHR1) antagonist .
Purity: 98.0% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 100 mg, 500 mg
Niacin Nicodicosapent (Nicotinic acid; Vitamin B3) Cat. No.: HY-B0143 Cat. No.: HY-17640
Bioactivity: Niacin (Vitamin B3) is a water-soluble vitamin and is part of Bioactivity: Nicodicosapent is a fatty acid niacin conjugate that is also the vitamin B group. Target: Others Niacin (also known as an inhibitor of the sterol regulatory element binding protein vitamin B3 and nicotinic acid) is an organic compound with the (SREBP), a key regulator of cholesterol metabolism proteins formula C6H5NO2 and, depending on the definition used, one of such as PCSK9, HMG-CoA reductase, ATP citrate lyase, and the 20 to 80 essential human nutrients. Not enough niacin in… NPC1L1. Purity: 99.0% Purity: 98.19% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 10mM x 1mL in DMSO, 1 g, 5 g 2 mg, 5 mg, 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 59
Niperotidine Nitisinone Cat. No.: HY-15539 (NTBC; Nitisone; SC0735) Cat. No.: HY-B0607
Bioactivity: Niperotidine is a histamine H2-receptor antagonist. Bioactivity: Nitisinone(SC0735) is an inhibitor of the enzyme 4-hydroxyphenylpyruvate dioxygenase.
Purity: >98% Purity: 99.57% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 10 mg, 50 mg
NNC45-0781 NPS-2143 Cat. No.: HY-U00216 (SB 262470A) Cat. No.: HY-10007
Bioactivity: NNC45-0781 is a tissue-selective estrogen partial-agonist. Bioactivity: NPS-2143 is a novel potent and selective antagonist of 2+ Ca receptor with IC50 of 43 nM.
Purity: >98% Purity: 99.42% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
NPS-2143 hydrochloride Nystose Cat. No.: HY-10171 Cat. No.: HY-N1499
Bioactivity: NPS-2143(SB 262470A ) is a selective potent calcium Bioactivity: Nystose is a tetrasaccharide with two fructose molecules ion-sensing receptor antagonist with IC50 of 43 and 41 nM for linked via beta (12) bonds to the fructosyl moiety of cytoplasmic Ca2+ concentrations and parathyroid hormone sucrose. secretion, respectively.
Purity: 99.96% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in Water, 5 mg, 10 mg, 50 mg 10 mg, 50 mg, 100 mg
O-304 Octanedioic acid Cat. No.: HY-112233 Cat. No.: HY-W015300
Bioactivity: O-304 is a small molecule AMPK activator. Bioactivity: Octanedioic acid is found to be associated with carnitine-acylcarnitine translocase deficiency, malonyl-Coa decarboxylase deficiency.
Purity: 98.63% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 1 g
Octanoic acid Odanacatib Cat. No.: HY-41417 (MK-0822) Cat. No.: HY-10042
Bioactivity: Octanoic acid is an oily liquid with a slightly unpleasant Bioactivity: Odanacatib (MK-0822) is a potent and selective inhibitor of
rancid taste and used commercially in the production of esters cathepsin K, with an IC50 of 0.2 nM for human cathepsin K. used in perfumery and also in the manufacture of dyes.
Purity: >98% Purity: 99.80% Clinical Data: No Development Reported Clinical Data: Phase 3 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 g 5 mg, 10 mg, 50 mg, 100 mg
60 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Oleoylethanolamide (N-(2-Hydroxyethyl)oleamide; Omarigliptin N-Oleoyl-2-aminoethanol; N-Oleoylethanolamide; …) Cat. No.: HY-107542 (MK-3102) Cat. No.: HY-15981
Bioactivity: Oleoylethanolamide is a high affinity endogenous PPAR-α Bioactivity: Omarigliptin(MK-3102) is a potent, selective and long-acting agonist, which plays an important role in the treatment of DPP-4 inhibitor with IC50 of 1.6 nM; highly selective over all obesity and arteriosclerosis. proteases tested (IC50 > 67 μM).
Purity: >98% Purity: 99.91% Clinical Data: Clinical Data: Launched Size: 10 mg, 50 mg Size: 10mM x 1mL in DMSO, 2 mg, 5 mg, 10 mg, 50 mg, 100 mg
Omeprazole ORL1 antagonist 1 Cat. No.: HY-B0113 Cat. No.: HY-112263
Bioactivity: Omeprazole(Prilosec) is a proton pump inhibitor used in the Bioactivity: ORL1 antagonist 1 is an opioid receptor-like 1 ( ORL1) treatment of dyspepsia. Target: Proton Pump Omeprazole is a antagonist with an IC50 of 61 nM. proton pump inhibitor used in the treatment of dyspepsia, peptic ulcer disease, gastroesophageal reflux disease, laryngopharyngeal reflux, and Zollinger-Ellison syndrome.… Purity: 97.06% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 100 mg, 500 mg
Orlistat Osajin (Tetrahydrolipstatin; Ro-18-0647) Cat. No.: HY-B0218 (CID 95168; NSC 21565) Cat. No.: HY-N3125
Bioactivity: Orlistat is a lipase inhibitor for obesity management that acts Bioactivity: Osajin is the major bioactive isoflavone present in the fruit by inhibiting the absorption of dietary fats. of Maclura pomifera with antitumor, antioxidant and anti-inflammatory activities.
Purity: 99.75% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg 100 mg, 200 mg, 500 mg
Otenabant Otenabant Hydrochloride (CP-945598) Cat. No.: HY-10871 (CP 945598 Hydrochloride) Cat. No.: HY-10871A
Bioactivity: Otenabant is a potent and selective cannabinoid receptor CB1 Bioactivity: Otenabant Hydrochloride is a potent and selective cannabinoid
antagonist with Ki of 0.7 nM, exhibits 10,000-fold greater receptor CB1 antagonist with Ki of 0.7 nM, exhibits selectivity against human CB2 receptor. 10,000-fold greater selectivity against human CB2 receptor.
Purity: 99.65% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg 5 mg, 10 mg, 50 mg
p-Methylphenyl potassium sulfate P2647 Cat. No.: HY-111431A (BZQ; Benzoquinamide; Benzquinamide; Emete-Con; Emeticon)Cat. No.: HY-U00244
Bioactivity: p-Methylphenyl potassium sulfate is a prototype protein-bound Bioactivity: Benzquinamide is an antiemetic which can bind to the α2A, uremic toxin. α2B, and α2C adrenergic receptors (α2-AR) with K i values of 1,365, 691, and 545 nM, respectively.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 20 mg 50 mg
www.MedChemExpress.com 61
PACAP (1-27), human, ovine, rat Palmitelaidic Acid (PACAP 1-27) Cat. No.: HY-P0176 (9-trans-Hexadecenoic acid; trans-Palmitoleic acid) Cat. No.: HY-N2341
Bioactivity: PACAP (1-27), human, ovine, rat, the N-terminal fragment of Bioactivity: Palmitelaidic acid is the trans isomer of palmitoleic acid.
PACAP-38, is a potent PACAP receptor antagonist with IC50s of Palmitoleic acid is one of the most abundant fatty acids in 3, 2, and 5 nM, respectively, for rat PAC1, rat VPAC1, and serum and tissue. human VPAC2.
Purity: >98% Purity: 98.00% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500u g, 1 mg, 5 mg Size: 10mM x 1mL in Ethanol, 10 mg
Palmitic acid Palmitodiolein (Triglyceride POO; Glycerol dioleate (Hexadecoic acid) Cat. No.: HY-N0830 palmitate; 1,2-Dioleoyl-3-palmitoylglycerol) Cat. No.: HY-112132
Bioactivity: Palmitic acid is a long-chain saturated fatty acid commonly Bioactivity: 1,2-Dioleoyl-3-palmitoyl-rac-glycerol is a triacylglycerol found in both animals and plants. which is present in vegetable oils.
Purity: 98.0% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 g 10 mg, 50 mg
Palosuran Pamidronate Disodium (ACT-058362) Cat. No.: HY-10655 (CGP 23339A) Cat. No.: HY-B0012A
Bioactivity: Palosuran (ACT-058362) is a new potent and specific antagonist Bioactivity: Pamidronate disodium, a bisphosphonate drug, can help to of the human UT receptor with an IC50 of 3.6±0.2 nM. strengthen bones. Target: Others Pamidronate belongs to the family of medications known as bisphosphonates. It is used to treat hypercalcemia (high blood calcium) by people who have cancer. Pamidronate is also used to treat cancer that has… Purity: 99.99% Purity: >98% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 50 mg 5 mg, 10 mg, 50 mg, 100 mg
Pamidronic acid Pancreatic Polypeptide, bovine Cat. No.: HY-B0012 Cat. No.: HY-P1537
Bioactivity: Pamidronic acid is a drug used to treat a broad spectrum of Bioactivity: Pancreatic Polypeptide, bovine, a 36-amino acid, straight bone absorption diseases. chain polypeptide derived primarily from the pancreas, inhibits secretin- and cholecystokinin-stimulated pancreatic secretion; Pancreatic Polypeptide, bovine acts as an agonist of NPY receptor, with high affinity at NPYR4. Purity: 98.0% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 500u g, 1 mg, 5 mg 50 mg
Pancreatic Polypeptide, human Pancreatic Polypeptide, rat (Human pancreatic polypeptide) Cat. No.: HY-P0199 (Rat pancreatic polypeptide) Cat. No.: HY-P1532
Bioactivity: Pancreatic Polypeptide, human is a C-terminally amidated 36 Bioactivity: Pancreatic Polypeptide, rat is an agonist of NPY receptor, amino acid peptide, which acts as a neuropeptide Y ( NPY) with high affinity at NPYR4. Y4/ Y5 receptor agonist.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500u g, 1 mg, 5 mg Size: 500u g, 1 mg, 5 mg
62 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Paquinimod Paricalcitol (ABR 25757) Cat. No.: HY-100442 Cat. No.: HY-50919
Bioactivity: Paquinimod is a S100A9 inhibitor, which prevents S100A9 Bioactivity: Paricalcitol is a vitamin D receptor agonist, used for the binding to TLR-4. prevention and treatment of secondary hyperparathyroidism (excessive secretion of parathyroid hormone) associated with chronic renal failure.
Purity: 98.38% Purity: 99.95% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 5 mg, 10 mg, 50 mg, 100 mg
Paricalcitol-D6 Peliglitazar racemate Cat. No.: HY-76585 (BMS 426707-01 racemate) Cat. No.: HY-101738A
Bioactivity: Paricalcitol-D6 is the deuterated form of Bioactivity: Peliglitazar racemate is the racemate of Peliglitazar. Paricalcitol(Zemplar), which is a drug used for the prevention Peliglitazar is a novel dual α/γ PPAR activator. and treatment of secondary hyperparathyroidism (excessive secretion of parathyroid hormone) associated with chronic renal failure. IC50 value: Target: Vd analog Chemically, it is… Purity: 99.64% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 1 mg, 5 mg, 10 mg
Peptide YY (PYY) (3-36), human Peptide YY (PYY), human (Peptide YY (3-36)) Cat. No.: HY-P1021 Cat. No.: HY-P1514
Bioactivity: Peptide YY (PYY) (3-36), human is a gut hormone peptide that Bioactivity: Peptide YY (PYY) is a gut hormone that regulates appetite and acts as a Y2 receptor agonist to reduce appetite. inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 500u g, 1 mg, 5 mg
PF 03716556 PF-02575799 Cat. No.: HY-13100 Cat. No.: HY-100333
Bioactivity: PF 03716556 is a potent, and selective acid pump (H+,K+ Bioactivity: PF-02575799 is a microsomal triglyceride transfer protein ATPase) antagonist, with pIC50 value of 6.009. IC50 (MTP) inhibitor with an IC50 of 0.77±0.29 nM. value:6.009 (pIC50) Target: H+,K+ ATPase PF-03716556 inhibited the activity of H+, K+-ATPase with pIC50 of 6.026 ± 0.112, 6.038 ± 0.039 and 6.009 ± 0.209 at pH 6.4 for porcine, canine… Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 10 mg, 25 mg, 50 mg, 100 mg
PF-04620110 PF-04971729 Cat. No.: HY-13009 (Ertugliflozin) Cat. No.: HY-15461
Bioactivity: PF-04620110 is an orally active, selective and potent Bioactivity: PF-04971729(Ertugliflozin) is a potent and selective inhibitor diglyceride acyltransferase-1 (DGAT1) inhibitor with IC50 of of the sodium-dependent glucose cotransporter 2(SGLT2). 19 nM.
Purity: 99.37% Purity: 99.80% Clinical Data: Phase 1 Clinical Data: Phase 3 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg
www.MedChemExpress.com 63
PF-04991532 PF-05175157 Cat. No.: HY-100181 Cat. No.: HY-12942
Bioactivity: PF-04991532 is a potent, hepatoselective glucokinase activator Bioactivity: PF-05175157 is broad spectrum acetyl-CoA carboxylase ( ACC)
with EC50s of 80 and 100 nM in human and rat, respectively. inhibitor with IC50s of 27.0, 33.0, 23.5 and 50.4 nM for ACC1 (human), ACC2 (human), ACC1 (rat), ACC2 (rat), respectively.
Purity: >98% Purity: 98.74% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg
PF-06409577 PF-06471553 Cat. No.: HY-103683 Cat. No.: HY-108339
Bioactivity: PF-06409577 is a potent and selective allosteric activator of Bioactivity: PF-06471553 is a potent, selective and orally available
AMPK α1β1γ1 isoform with an EC50 of 7 nM. monoacylglycerol acyltransferase 3 (MGAT3) inhibitor, with an IC50 of 92 nM.
Purity: 98.56% Purity: 98.29% Clinical Data: Phase 1 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
PF-06869206 PF-5190457 Cat. No.: HY-112065 Cat. No.: HY-12584
Bioactivity: PF-06869206 is an orally bioavailable selective inhibitor of Bioactivity: PF-5190457 is a potent and selective ghrelin receptor inverse the sodium-phosphate cotransporter NaPi2a ( SLC34A1) with an agonist with a pKi of 8.36. IC 50 of 380 nM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 5 mg, 10 mg, 25 mg, 50 mg
PF-915275 PF429242 dihydrochloride Cat. No.: HY-18056 Cat. No.: HY-13447A
Bioactivity: PF-915275 is a potent and selective inhibitor of human Bioactivity: PF429242 dihydrochloride is a reversible and competitive S1P 11β-hydroxysteroid dehydrogenase type 1 (11βHSD1) (Ki 1 nM) inhibitor with an IC50 of 175 nM. with good preclinical pharmacokinetic properties.
Purity: 96.31% Purity: 98.76% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Phloretin Phlorizin (NSC 407292; RJC 02792) Cat. No.: HY-N0142 (Floridzin; NSC 2833) Cat. No.: HY-N0143
Bioactivity: Phloretin(NSC 407292; RJC 02792) is a dihydrochalcone, a type Bioactivity: Phlorizin is a non-selective SGLT inhibitor with Kis of 300 of natural phenols. Phloretin inhibits the active transport of and 39 nM for hSGLT1 and hSGLT2, respectively. Phlorizin is glucose into cells by SGLT1 and SGLT2. also a Na+/K+-ATPase inhibitor.
Purity: 99.70% Purity: 95.33% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 250 mg, 500 mg 1 g, 5 g
64 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Pi-Methylimidazoleacetic acid Picoprazole Cat. No.: HY-113274 Cat. No.: HY-15384
Bioactivity: Pi-Methylimidazoleacetic acid is a potential neurotoxin. Bioactivity: Picoprazole is a specific inhibitor of H+/K+-ATPase with
IC50 of 3.1±0.4 μM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 1 mg, 5 mg, 10 mg, 20 mg
Pimelic acid (1,5-Pentanedicarboxylic acid; 1,7-Heptanedioic Pioglitazone acid; Pileric acid) Cat. No.: HY-Y1139 (U 72107) Cat. No.: HY-13956
Bioactivity: Pimelic acid is the organic compound and its derivatives are Bioactivity: Pioglitazone is a potent and selective PPARγ agonist with involved in the biosynthesis of the amino acid called lysine. high affinity binding to the PPARγ ligand-binding domain with
EC50 of 0.93 and 0.99 μM for human and mouse PPARγ, respectively.
Purity: 98.0% Purity: 99.18% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g 10 mg, 50 mg
Pioglitazone hydrochloride Pipecolic acid (U 72107A; AD 4833) Cat. No.: HY-14601 Cat. No.: HY-Y0669
Bioactivity: Pioglitazone hydrochloride is a potent and selective PPARγ Bioactivity: Pipecolic acid is a metabolite of lysine.
agonist with EC50s of 0.93 and 0.99 μM for human and mouse PPARγ, respectively.
Purity: 96.39% Purity: 98.82% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg, 500 mg 5 g
Pirinixil Pirozadil (BR-931) Cat. No.: HY-100334 Cat. No.: HY-100144
Bioactivity: Pirinixil is a hypolipidemic agent of low toxicity. Bioactivity: Pirozadil is a hypolipidemic agent.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 5 mg, 10 mg, 25 mg
Pitavastatin Calcium Poliumoside (Pitavastatin hemicalcium; NK-104) Cat. No.: HY-B0144 Cat. No.: HY-N0033
Bioactivity: Pitavastatin Calcium is a potent hydroxymethylglutaryl-CoA Bioactivity: Poliumoside is a natural compound which exhibit significant (HMG-CoA) reductase inhibitor. Pitavastatin inhibits inhibition of advanced glycation end product formation with IC50 values of 4.6-25.7 μM cholesterol synthesis from acetic acid with an IC50 of 5.8 nM in HepG2 cells.
Purity: 99.94% Purity: 99.86% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 10 mg, 50 mg, 100 mg 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 65
Porphobilinogen Potassium oxonate (Potassium azaorotate; Potassium otastat; Cat. No.: HY-W013495 Potassium oxonate) Cat. No.: HY-17511
Bioactivity: Porphobilinogen could act as a phototoxin, a neurotoxin, and a Bioactivity: Oxonic acid potassium salt is an inhibitor of uricase, oxonic metabotoxin. inhibits the phosphorylation of 5-FU to 5-fluorouridine-5'-monophosphate catalyzed by pyrimidine phosphoribosyl-transferase in a different manner from allopurinol in cell-free extracts and intact cells in vitro.… Purity: >98% Purity: 99.81% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in Water, 5 g
PPAR agonist 1 PPARα-MO-1 Cat. No.: HY-U00340 Cat. No.: HY-U00068
Bioactivity: PPAR agonist 1 is an agonist of PPAR α and PPAR γ, used Bioactivity: PPARα-MO-1 is a potent PPARα modulator extracted from patent for reducing blood glucose, lipid levels, lowering cholesterol WO/2004/110982A1, formula I. and reducing body weight.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
Pparδ agonist Pparδ agonist 1 Cat. No.: HY-112597 Cat. No.: HY-107901
Bioactivity: PPARδ agonist is a PPARδ agonist extracted from patent Bioactivity: Pparδ agonist 1 is a PPAR-δ agonist, with an EC50 of 5.06 US20180071304, compound example 10. nM, used in the research of PPAR-delta related diseases, such as mitochondrial diseases, muscular diseases, vascular diseases, demyelinating diseases and metabolic diseases.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 500 mg, 250 mg Size: 250 mg, 500 mg
Pparδ agonist 2 Pradefovir mesylate Cat. No.: HY-100120 (Remofovir mesylate) Cat. No.: HY-112690A
Bioactivity: Pparδ agonist 2 is a PPARδ agonist extracted from patent WO Bioactivity: Pradefovir mesylate is a good substrate for liver CYP3A4. 2016057656 A1. Pradefovir is converted to 9-(2-phosphonylmethoxyethyl)adenine
(PMEA) in human liver microsomes with a K m of 60 μM.
Purity: >98% Purity: 99.83% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg
Praeruptorin B PRN1008 (Praeruptorin D) Cat. No.: HY-N0082 Cat. No.: HY-112166
Bioactivity: Praeruptorin B is an inhibitor of sterol regulatory Bioactivity: PRN1008 is a reversible covalent inhibitor of Bruton’s
element-binding proteins (SREBPs). Tyrosine Kinase (BTK), with an IC50 of 1.3 nM.
Purity: >98% Purity: 99.49% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
66 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Probenecid Probucol Cat. No.: HY-B0545 Cat. No.: HY-B0388
Bioactivity: Probenecid is a potent and selective agonist of transient Bioactivity: Probucol is an anti-hyperlipidemic drug by lowering the level receptor potential vanilloid 2 ( TRPV2) channels. of cholesterol in the bloodstream by increasing the rate of LDL catabolism.
Purity: 99.91% Purity: 98.0% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g, 5 g 100 mg, 500 mg
Prostaglandin E1 PSN-GK1 (PGE1) Cat. No.: HY-B0131 Cat. No.: HY-U00411
Bioactivity: Prostaglandin E1 (PGE1) is a potent vasodilator and activates Bioactivity: PSN-GK1 is a potent glucokinase activator with an EC50 of the prostaglandin E1 (EP) receptor. 0.13 μM.
Purity: 98.0% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 5 mg, 10 mg, 50 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
PSN632408 PTC124 Cat. No.: HY-16673 (Ataluren) Cat. No.: HY-14832
Bioactivity: PSN632408 is an optimized agonist of GPR119 receptors that Bioactivity: PTC124 (Ataluren) is an orally available CFTR-G542X nonsense shows similar potency to OEA at both recombinant mouse and allele inhibitor. human GPR119 receptors, exhibiting EC50 values of 5.6 and 7.9 uM, respectively.
Purity: 99.13% Purity: 99.88% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg 10 mg, 50 mg, 100 mg, 200 mg
PTP1B-IN-1 PTP1B-IN-2 (PTP1B inhibitor) Cat. No.: HY-10704 Cat. No.: HY-100462
Bioactivity: PTP1B-IN-1 is a potent protein tyrosine phosphatase-1B (PTP1B) Bioactivity: PTP1B-IN-2 is a potent protein tyrosine phosphatase 1B (
inhibitor with IC50 of 1.6 mM; PTP1B) inhibitor with an IC50 of 50 nM. 1,2,5-thiadiazolidin-3-one-1,1-dioxide scaffold for derivatives synthesis.
Purity: 99.58% Purity: 99.63% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
PTP1B-IN-3 Pumosetrag Hydrochloride Cat. No.: HY-15133 (MKC-733; DDP-733) Cat. No.: HY-19650
Bioactivity: PTP1B-IN-3 is a potent and selective PTP1B inhibitor with Bioactivity: Pumosetrag Hydrochloride (MKC-733; DDP-733) is an orally
IC50s of 120 nM (PTP1B) and 120 nM (TCPTP), respectively. available 5-HT3 partial agonist developed for the treatment of irritable bowel syndrome and gastroesophageal reflux disease.
Purity: >98% Purity: 99.27% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
www.MedChemExpress.com 67
PX20606 trans racemate Pyridoxylamine (PX-102 trans racemate) Cat. No.: HY-100443A Cat. No.: HY-B1745
Bioactivity: PX20606 trans racemate is a FXR agonist with EC50s of 32 Bioactivity: Pyridoxylamine is an advanced glycation end production (AGEs) and 34 nM for FXR in FRET and M1H assay, respectively. and lipoxidation end products (ALEs) inhibitor, to protect against diabetes-induced retinal vascular lesions.
Purity: 99.01% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 2 mg
Pyrrole-derivative1 Ranirestat Cat. No.: HY-U00059 (AS-3201) Cat. No.: HY-15314
Bioactivity: Pyrrole-derivative1 is extracted from patent WO/2002/085851A1, Bioactivity: Ranirestat (AS-3201) is an aldose reductase inhibitor being example 2, developed for the treatment of diabetic disease. developed for the treatment of diabetic neuropathy.
Purity: >98% Purity: 99.14% Clinical Data: No Development Reported Clinical Data: Phase 3 Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
Ranitidine hydrochloride Raspberry ketone Cat. No.: HY-B0281A (Frambione; 4-(4-Hydroxyphenyl)-2-butanone) Cat. No.: HY-N1426
Bioactivity: Ranitidine is a histamine H2-receptor antagonist that inhibits Bioactivity: Raspberry ketone is a major aromatic compound of red stomach acid production. raspberry, widely used as a fragrance in cosmetics and as a flavoring agent in foodstuff; also shows PPAR-α agonistic activity.
Purity: 99.48% Purity: 99.91% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg, 500 mg 100 mg
Rbin-1 Rebamipide (Ribozinoindole-1) Cat. No.: HY-100816 (OPC12759; Proamipide) Cat. No.: HY-B0360
Bioactivity: Rbin-1 is a potent, reversible, and specific chemical Bioactivity: Rebamipide is an inducer of endogenous prostaglandin and a inhibitor of eukaryotic ribosome biogenesis. Rbin-1 inhibits oxygen-derived free radical scavenger.
the ATPase with GI50 of 136±7 nM.
Purity: 98.0% Purity: 99.78% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 1 g, 5 g
Repaglinide Retagliptin Phosphate (AG-EE 623ZW) Cat. No.: HY-15209 (SP 2086) Cat. No.: HY-112668
Bioactivity: Repaglinide(AG-EE 623ZW) is a carbamoylmethyl benzoic acid Bioactivity: Retagliptin Phosphate is pharmaceutical composition of DPP-4 (CMBA) derivative, which recently has become available for the inhibitor for treating type-2 diabetes. treatment of type II diabetes.
Purity: 99.92% Purity: 99.69% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
68 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Retinol Retinyl glucoside (Vitamin A1; all-trans-Retinol) Cat. No.: HY-B1342 (Retinyl β-D-glucoside) Cat. No.: HY-A0058
Bioactivity: Retinol, also known as Vitamin A1, has pleiotropic functions Bioactivity: Retinyl-β-D-glucoside is a naturally occurring and including vison, immunity, hematopoiesis, reproduction, cell biologically active metabolites of vitamin A, which are found differentiation/growth, and development. in fish and mammals.
Purity: Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg, 10 mg, 50 mg, 100 mg 100 mg
RG-12525 Riboflavin Tetrabutyrate (NID 525) Cat. No.: HY-101676 Cat. No.: HY-B2239
Bioactivity: RG-12525 is a a specific, competitive and orally effective Bioactivity: Riboflavin tetrabutyrate is a lipophilic flavin derivative antagonist of the peptidoleukotrienes, LTC4, LTD4 and LTE4, with antioxidative and lipid peroxide-removing activity. inhibiting LTC4-, LTD4- and LTE4-inducd guinea pig parenchymal
strips contractions, with IC50s of 2.6 nM, 2.5 nM and 7 nM, respectively; RG-12525 is also a peroxisome… Purity: >98% Purity: 98.56% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 100 mg
Rimacalib Rimeporide (SMP 114) Cat. No.: HY-100779 Cat. No.: HY-19273
Bioactivity: Rimacalib is a Ca 2+/calmodulin-dependent protein kinase II Bioactivity: Rimeporide is a potent and selective inhibitor of the + + (CaMKII) inhibitor, with IC50s of ~1 μM for CaMKIIα to ~30 Na /H exchanger (NHE-1). μM for CaMKIIγ.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size: 1 mg, 5 mg
Rimeporide hydrochloride Rimonabant Cat. No.: HY-19273A (SR141716) Cat. No.: HY-14136
Bioactivity: Rimeporide hydrochloride is a potent and selective inhibitor Bioactivity: Rimonabant(SR141716) is a selective central cannabinoid (CB1) of the Na+/H+ exchanger (NHE-1). receptor inverse agonist with Ki of 1.8 nM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: Phase 4 Size: 1 mg, 5 mg Size: 10 mg, 50 mg, 100 mg
Rimonabant Hydrochloride RISARESTAT (SR 141716A; SR 151716A) Cat. No.: HY-14137 (CT 112) Cat. No.: HY-16433
Bioactivity: Rimonabant hydrochloride is a cannabinoid receptor (CB) Bioactivity: RISARESTAT (CT-112), an aldose reductase inhibitor, is
antagonist which binds selectively to CB1 with a Ki of 2 nM. developed for the treatment of diabetic complications.
Purity: 99.08% Purity: >98% Clinical Data: Phase 4 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 20 mg 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 69
Ro 28-1675 RORγ-IN-1 Cat. No.: HY-10595 Cat. No.: HY-103637
Bioactivity: Ro 28-1675 (Ro 0281675) is a potent allosteric GK activator Bioactivity: RORγ-IN-1 is a RORγ inhibitor extracted from patent US with a SC1.5 value of 0.24± 0.0019 uM. IC50 value: 0.24± 9481674 B1, has a Ki of <100 nM. 0.0019 uM (SC1.5) [1] Target: Glucokinase activator The R stereoisomer Ro 28-1675 activated GK with a SC1.5 of 0.24 uM, while the S isomer did not activated GK up to 10 uM. Oral… Purity: 99.41% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 25 mg 5 mg, 10 mg
Rosiglitazone Rosiglitazone maleate (BRL49653) Cat. No.: HY-17386 (BRL 49653C) Cat. No.: HY-14600
Bioactivity: Rosiglitazone (BRL49653) is a potent thiazolidinedione insulin Bioactivity: Rosiglitazone maleate is a potent and selective activator of
sensitizer. Rosiglitazone is a selective PPARγ agonist with PPARγ, with EC50s of 30 nM, 100 nM and 60 nM for PPARγ1, EC50s of 30 nM, 100 nM and 60 nM for PPARγ1, PPARγ2, and PPARγ2, and PPARγ, respectively, and a Kd of appr 40 nM PPARγ, respectively. for PPARγ; Rosiglitazone maleate is also an modulator of … Purity: 99.21% Purity: 99.25% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 50 mg, 200 mg 100 mg, 500 mg
Rosuvastatin Rosuvastatin Calcium (ZD 4522) Cat. No.: HY-17504A (Rosuvastatin hemicalcium; ZD 4522 Calcium) Cat. No.: HY-17504
Bioactivity: Rosuvastatin is a competitive inhibitor of HMG-CoA reductase Bioactivity: Rosuvastatin Calcium is a competitive inhibitor of HMG-CoA with IC50 of 11 nM. reductase with IC50 of 11 nM. IC50 Value: 11 nM [1] Target: HMG-CoA reductase in vitro: Rosuvastatin is relatively hydrophilic and is highly selective for hepatic cells; its uptake is mediated by the liver-specific organic anion… Purity: >98% Purity: 97.73% Clinical Data: Launched Clinical Data: Launched Size: 10 mg, 50 mg, 100 mg Size: 10mM x 1mL in DMSO, 10 mg, 50 mg, 100 mg, 200 mg
RP 70676 RPR107393 free base Cat. No.: HY-101576 Cat. No.: HY-100299
Bioactivity: RP 70676 is a potent inhibitor of ACAT, with IC50 of 25 and Bioactivity: RPR107393 free base is a selective squalene synthase 44 nM for rat and rabbit ACAT. inhibitor, which inhibits rat liver microsomal squalene synthase with an IC50 of 0.8±0.2 nM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 1 mg, 5 mg, 10 mg
Ruboxistaurin hydrochloride S-8921 (LY 333531 hydrochloride) Cat. No.: HY-10195B Cat. No.: HY-19298
Bioactivity: Ruboxistaurin hydrochloride is a selective and ATP-competitive Bioactivity: S-8921 is an ileal Na +/bile acid cotransporter ( IBAT) PKCβ inhibitor, with IC50s of 4.7 and 5.9 nM for PKCβI and inhibitor.
PKCβII, shows less potent inhibition on PKCη ( IC50, 52 nM),
PKCα ( IC50, 360 nM), PKCγ ( IC50, 300 nM), PKCδ ( IC50, … Purity: 98.54% Purity: >98% Clinical Data: Phase 3 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
70 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
S-Allyl-L-cysteine S-Methyl-L-cysteine Cat. No.: HY-W013573 (L-S-Methylcysteine) Cat. No.: HY-B2188
Bioactivity: S-Allyl-L-cysteine, one of the organosulfur compounds found in Bioactivity: S-Methyl-L-cysteine is a natural product that acts as a AGE, possess various biological effects including neurotrophic substrate in the catalytic antioxidant system mediated by activity, anti-cancer activity, anti-inflammatory activity. methionine sulfoxide reductase A (MSRA), with antioxidative, neuroprotective, and anti-obesity activities.
Purity: 98.64% Purity: 95.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in Water, 10 mg, 25 mg, 50 mg, 100 mg 100 mg
Saikogenin A SAMS Cat. No.: HY-N6584 Cat. No.: HY-P0136
Bioactivity: Saikogenin A, extracted from a Chinese herbal plant called Bioactivity: SAMS peptide is a specific substrate for the AMP-activated Tsai-Fu, is a dipeptidyl peptidase-IV ( DPP-IV) inhibitor. protein kinase ( AMPK). Sequence: His-Met-Arg-Ser-Ala-Met-Ser-Gly-Leu-His-Leu-Val-Lys-Arg-Arg-NH2.
Purity: 98.31% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg Size: 1 mg, 5 mg, 10 mg
SAR407899 SAR407899 hydrochloride Cat. No.: HY-15687A Cat. No.: HY-15687
Bioactivity: SAR407899 is a selective, potent and ATP-competitive ROCK Bioactivity: SAR407899 hydrochloride is a selective, potent and ATP-competitive ROCK inhibitor, with an IC of 135 nM for inhibitor, with an IC50 of 135 nM for ROCK-2, and Kis of 36 50
nM and 41 nM for human and rat ROCK-2, respectively. ROCK-2, and Kis of 36 nM and 41 nM for human and rat ROCK-2, respectively. Purity: 98.43% Purity: 99.81% Clinical Data: Phase 2 Clinical Data: Phase 2 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
Saroglitazar Saroglitazar Magnesium Cat. No.: HY-19937 Cat. No.: HY-19937A
Bioactivity: Saroglitazar is a novel peroxisome proliferator-activated Bioactivity: Saroglitazar magnesium is a novel peroxisome receptor ( PPAR) agonist with predominant PPARα and moderate proliferator-activated receptor ( PPAR) agonist with
PPARγ activity with EC50 values of 0.65 pM and 3 nM in HepG2 predominant PPARα and moderate PPARγ activity with EC50 cells, respectively. values of 0.65 pM and 3 nM in HepG2 cells, respectively.
Purity: 98.03% Purity: 98.85% Clinical Data: Phase 3 Clinical Data: Phase 3 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 1 mg, 5 mg, 10 mg, 25 mg, 50 mg
Sarsasapogenin Saxagliptin (Parigenin; Sarsagenin) Cat. No.: HY-N0073 (BMS-477118) Cat. No.: HY-10285
Bioactivity: Sarsasapogenin is a sapogenin from the Chinese medical herb Bioactivity: Saxagliptin is a selective and reversible DPP4 inhibitor with Anemarrhena asphodeloides Bunge, with antidiabetic, IC50 of 26 nM and Ki of 1.3 nM. anti-oxidative, anticancer and anti-inflamatory activities.
Purity: 99.20% Purity: 98.03% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 25 mg, 50 mg, 100 mg 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 71
Saxagliptin hydrate SB 204990 (BMS-477118 hydrate) Cat. No.: HY-10285A Cat. No.: HY-16450
Bioactivity: Saxagliptin H2O(BMS477118 H2O) is a selective and reversible Bioactivity: SB 204990 is a potent and specific inhibitor of ATP citrate DPP4 inhibitor with IC50 of 26 nM and Ki of 1.3 nM. lyase (ACLY) enzyme.
Purity: >98% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10 mg, 50 mg, 100 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg
SB 415286 SB-568849 Cat. No.: HY-15438 Cat. No.: HY-100308
Bioactivity: SB 415286 is a potent and selective cell permeable inhibitor Bioactivity: SB-568849 is a melanin-concentrating hormone receptor 1 ( of GSK-3α, with an IC of 77.5 nM, and a K of 30.75 nM; SB 50 i MCH R1) antagonist with a pKi of 7.7. 415286 is equally effective at inhibiting human GSK-3α and GSK-3β.
Purity: 99.88% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 10 mg, 50 mg
SB-649868 SB756050 (GSK649868) Cat. No.: HY-10806 Cat. No.: HY-102016
Bioactivity: SB-649868 is a potent and selective orally active orexin ( OX) Bioactivity: SB756050 is a selective TGR5 agonist currently in phase
1 and OX2 receptor antagonist ( pKi =9.4 and 9.5 at the OX 1clinical trials for the treatment of type 2 diabetes.
1 and OX 2 receptor, respectively).
Purity: 99.88% Purity: 99.02% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
SBC-110736 SC26304 Cat. No.: HY-101832 (Dicirenone) Cat. No.: HY-U00200
Bioactivity: SBC-110736 is a proprotein convertase subtilisin kexin type 9 Bioactivity: SC26304 inhibits the effects of Aldosterone on urinary K +:Na ( PCSK9) inhibitor extracted from patent WO2014150395A1, + ratios and the binding of [ 3H]Aldosterone to renal Figure 1. cytoplasmic and nuclear receptors.
Purity: 99.53% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 20 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
SecinH3 Secretin (28-54), human Cat. No.: HY-100559 (Human secretin) Cat. No.: HY-P1465
Bioactivity: SecinH3 is an antagonist of cytohesins with IC50s of 5.4 μM, Bioactivity: Secretin (28-54), human is a 27-amino acid residue 2.4 μM, 5.4 μM, 5.6 μM, 5.6 μM and 65 μM for hCyh1, hCyh2, C-terminally amidated peptide, which acts on secretin mCyh3, hCyh3, drosophila steppke and yGea2-S7, receptors. respectively.
Purity: 99.60% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
72 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Seladelpar Seladelpar sodium salt (MBX-8025) Cat. No.: HY-19522 (MBX-8025 sodium salt; RWJ-800025 sodium salt) Cat. No.: HY-19522A
Bioactivity: Seladelpar is an orally active, potent (50% effect Bioactivity: Seladelpar sodium salt (MBX-8025) is an orally active, potent
concentration EC50 2 nM), and specific PPAR-δ agonist. and specific PPARδ agonist with an EC50 of 2 nM, showing more than 750-fold and 2500-fold selectivity over the PPARα and PPARγ receptors, respectively.
Purity: >98% Purity: 98.52% Clinical Data: No Development Reported Clinical Data: Phase 3 Size: 5 mg, 10 mg, 25 mg, 50 mg, 100 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
Senecionine (Senecionan-11,16-dione, 12-hydroxy-; Aureine; Setmelanotide NSC 89935; Senecionin) Cat. No.: HY-N2560 (RM-493; BIM-22493; IRC-022493) Cat. No.: HY-19870
Bioactivity: Senecionine is a pyrrolizidine alkaloid isolated from Senecio Bioactivity: Setmelanotide (RM-493;BIM-22493;IRC-022493) is a
vulgaris. Senecionine is toxic to animals and humans. melanocortin 4 receptor ( MC4R) agonist with an EC50 of 0.27 nM for human MC4R.
Purity: >98% Purity: 99.35% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg Size: 10mM x 1mL in Water, 1 mg, 5 mg, 10 mg, 50 mg, 100 mg
SHU 9119 Sitagliptin Cat. No.: HY-P0227 (MK0431) Cat. No.: HY-13749
Bioactivity: SHU 9119 is a potent human melanocortin 3 and 4 receptors ( Bioactivity: Sitagliptin is a potent inhibitor of DPP4 with IC50 of 19 nM MC3/4R) antagonist and a partial MC5R agonist; with IC 50 in Caco-2 cell extracts. values of 0.23, 0.06, and 0.09 nM for human MC3R, MC4R and MC5R, respectively. Sequence: Ac-{Nle}-cyclo[Asp-His-D-{Nal}-Arg-Trp-Lys]-NH2. Purity: 98.57% Purity: 99.72% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg Size: 10mM x 1mL in DMSO, 100 mg, 200 mg
Sitagliptin phosphate Sitagliptin phosphate monohydrate (MK0431 phosphate) Cat. No.: HY-13749A (MK-0431 phosphate monohydrate) Cat. No.: HY-13749B
Bioactivity: Sitagliptin phosphate is a potent inhibitor of DPP4 with IC50 Bioactivity: Sitagliptin phosphate monohydrate is a potent inhibitor of DPP4 with IC of 19 nM in Caco-2 cell extracts of 19 nM in Caco-2 cell extracts 50
Purity: >98% Purity: 99.78% Clinical Data: Launched Clinical Data: Launched Size: 100 mg, 200 mg Size: 10mM x 1mL in Water, 100 mg, 200 mg
SMP-028 SNT-207707 Cat. No.: HY-19861 Cat. No.: HY-11029
Bioactivity: SMP-028 is an inhibitor of neutral cholesterol esterase ( Bioactivity: SNT-207707 is a selective, potent and orally active
CEase), with an IC50 of 1.01 μM. melanocortin MC-4 receptor antagonist with an IC50 of 8 nM (binding) and 5 nM (function) on the MC-4 receptor.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 250 mg, 500 mg Size: 250 mg, 500 mg
www.MedChemExpress.com 73
SNT-207858 Sobetirome Cat. No.: HY-11030 (GC-1; QRX-431) Cat. No.: HY-14823
Bioactivity: SNT-207858 is a selective and orally available melanocortin Bioactivity: Sobetirome is a thyroid hormone receptor β ( TRβ)-specific MC-4 receptor antagonist with a 170-fold selectivity vs. agonist, Sobetirome is designed to bind selectively to TRβ-1
MC-3 and a 40-fold selectivity versus MC-5. SNT-207858 has an with EC50 of 0.16 μM. IC50 of 8 nM (binding) and 5 nM (function) on the MC-4 receptor. Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 250 mg, 500 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
Sodium Picosulfate Sograzepide (Sodium Picosulphate) Cat. No.: HY-B0544 (Netazepide; YF 476; YM-220) Cat. No.: HY-14850
Bioactivity: Sodium Picosulfate inhibits absorption of water and Bioactivity: Sograzepide (Netazepide;YF476) is a gastrin/cholecystokinin 2 electrolytes, and increases their secretion. Target: Others receptor (CCK2) antagonist. Sodium Picosulfate displays cytotoxic effects on cultured liver cells. 800 and 1600 mg/mL induces dose-dependently vacuolic and fatty change as well as necrosis combined with a… Purity: 99.0% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 10 mg, 50 mg, 100 mg
Soluble epoxide hydrolase inhibitor Speract Cat. No.: HY-U00453 Cat. No.: HY-P0245
Bioactivity: Soluble epoxide hydrolase inhibitor is an inhibitor of soluble Bioactivity: Speract, a sea urchin egg peptide that regulates sperm epoxide hydrolase, and inhibits human soluble epoxide hydrolase motility, also stimulates sperm mitochondrial metabolism. Sequence: Gly-Phe-Asp-Leu-Asn-Gly-Gly-Gly-Val-Gly. (h-sEH) with pIC50 of 8.4, extracted from patent WO 2010096722 A1, example 57.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg, 25 mg Size: 1 mg, 5 mg, 10 mg
Spermidine Spermine (N-(4-Aminobutyl)-1,3-diaminopropane) Cat. No.: HY-B1776 (NSC 268508; Neuridine) Cat. No.: HY-B1777
Bioactivity: Spermidine, a precursor of spermine, is a polyamine derived Bioactivity: Spermine functions directly as a free radical scabenger to from putrescine and could help stabilize some membranes and protect DNA from free radical attack. nucleic acid structures.
Purity: 97.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 100 mg 100 mg
Spironolactone SQ22536 (SC9420) Cat. No.: HY-B0561 Cat. No.: HY-100396
Bioactivity: Spironolactone is a potent antagonist of the androgen Bioactivity: SQ22536 is an effective adenylate cyclase ( AC) inhibitor. receptor. Target: Androgen Receptor Spironolactone is a potassium sparing diuretic that acts by antagonism of aldosterone in the distal renal tubules. It is used mainly in the treatment of refractory edema in patients with congestive… Purity: 96.17% Purity: 98.43% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g, 5 g 5 mg, 10 mg, 25 mg, 50 mg, 100 mg, 200 mg
74 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
SQ28603 SR 146131 (SQ28,603; Squibb 28603) Cat. No.: HY-U00171 Cat. No.: HY-11077
Bioactivity: SQ28603 is a potent and selective inhibitor of neutral Bioactivity: SR 146131 is a potent, orally available, and selective endopeptidase 3.4.24.11 ( NEP), an enzyme that degrades nonpeptide ( cholecystokinin 1) receptor agonist. atrial natriuretic peptide (ANP).
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 250 mg, 500 mg
SR-18292 SR12813 Cat. No.: HY-101491 (GW 485801) Cat. No.: HY-100793
Bioactivity: SR-18292 is a PPAR gamma coactivator-1α ( PGC-1α) inhibitor, Bioactivity: SR12813 is an inhibitor of which increases PGC-1α acetylation, suppresses gluconeogenic 3-hydroxy-3-methylglutaryl-coenzyme A (HMG-CoA) reductase,
gene expression and reduces glucose production in hepatocytes. with an IC 50 value of 0.85 μM.
Purity: 98.0% Purity: 99.04% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg, 200 mg
SR3335 SR9238 (ML 176) Cat. No.: HY-14413 Cat. No.: HY-101442
Bioactivity: SR3335 is a selective RORα synthetic ligand, directly binds Bioactivity: SR9238 is a synthetic LXR antagonist with IC50s of 214 nM and to RORα ( K 220 nM) but not other RORs, and functions as a i 43 nM for LXRα and LXRβ, respectively. selective partial inverse agonist of RORα in cell-based assays.
Purity: 98.02% Purity: 99.53% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 25 mg, 50 mg
SRT 1720 SRT 1720 Hydrochloride Cat. No.: HY-10532 Cat. No.: HY-15145
Bioactivity: SRT 1720 is a selective activator of human SIRT1 with an Bioactivity: SRT 1720 Hydrochloride is a selective activator of SIRT1 with
EC1.5 of 0.16 μM, and shows less potent activities agaiinst an EC1.5 of 0.16 μM, and shows less potent activities on
SIRT2 and SIRT3 with EC 1.5s of 37 μM and > 300 μM, SIRT2 and SIRT3 with EC 1.5s of 37 μM and 300 μM, respectively. respectively. Purity: >98% Purity: 99.92% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg, 50 mg, 100 mg Size: 5 mg, 10 mg, 50 mg, 100 mg
SSR240612 Stachyose tetrahydrate Cat. No.: HY-15039 Cat. No.: HY-113529
Bioactivity: SSR240612 is a potent, and orally active specific non-peptide Bioactivity: Stachyose is a prebiotic, a non-reducing tetrasaccharide in
bradykinin B1 receptor antagonist, with Kis of 0.48 nM and the rafnose family of oligosaccharides with few side efects. 0.73 nM for B1 kinin receptors of human fibroblast MRC5 and HEK cells expressing human B1 receptors, 481 nM and 358 nM for B2 receptors of guinea pig ileum membranes and CHO cells… Purity: 99.19% Purity: 98.10% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 5 mg
www.MedChemExpress.com 75
Stearic acid STO-609 Cat. No.: HY-B2219 Cat. No.: HY-19805
Bioactivity: Stearic acid is a long chain dietary saturated fatty acid Bioactivity: STO-609 is a selective and cell-permeable inhibitor of the Ca which exists in many animal and vegetable fats and oils. 2+/calmodulin-dependent protein kinase kinase ( CaM-KK),
with Ki values of 80 and 15 ng/mL for recombinant CaM-KKα and CaM-KKβ, respectively. Purity: 98.0% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Strontium Ranelate Suberylglycine (Distrontium renelate; S12911) Cat. No.: HY-17397 Cat. No.: HY-113367
Bioactivity: Strontium ranelate(S12911) stimulates the calcium sensing Bioactivity: Suberylglycine is an acyl glycine, which is a normally minor receptors (CaSR) and leads to the differentiation of metabolite of fatty acid. pre-osteoblast to osteoblast which increases the bone formation.
Purity: 99.16% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 100 mg, 500 mg Size:
Succinic acid Sucrose (Wormwood acid) Cat. No.: HY-N0420 (D-(+)-Saccharose) Cat. No.: HY-B1779
Bioactivity: Succinic acid is an intermediate product of the tricarboxylic Bioactivity: Sucrose is a disaccharide which is composed of two acid cycle, as well as one of fermentation products of monosaccharides, glucose and fructose. anaerobic metabolism.
Purity: 98.0% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in Water, 100 mg 100 mg
Syringic acid T863 Cat. No.: HY-N0339 (DGAT-1 inhibitor) Cat. No.: HY-32219
Bioactivity: Syringic acid is correlated with high antioxidant activity and Bioactivity: T-863(DGAT-1 inhibitor) is an orally active, selective and inhibition of LDL oxidation. potent DGAT1 (Acyl-CoA:diacylglycerol acyltransferase 1) inhibitor that interacts with the acyl-CoA binding site of DGAT1, and inhibits triacylglycerol synthesis in cells.
Purity: >98% Purity: 99.08% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 100 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
TA-1801 Tacalcitol (1,24(R)-Dihydroxyvitamin D3; Cat. No.: HY-19030 1.alpha.,24R-Dihydroxyvitamin D3) Cat. No.: HY-32337
Bioactivity: TA-1801 is a hypolipidemic agent. Bioactivity: Tacalcitol (1,24(R)-Dihydroxyvitamin D3; 1.alpha.,24R-Dihydroxyvitamin D3) promotes normal bone development by regulating calcium.
Purity: >98% Purity: 98.88% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 1 mg, 5 mg, 10 mg, 25 mg
76 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Taranabant Tarazepide (MK-0364) Cat. No.: HY-10013 Cat. No.: HY-U00062
Bioactivity: Taranabant is a highly potent and selective cannabinoid 1 ( Bioactivity: Tarazepide is a potent and specific CCK-A receptor CB1) receptor inverse agonist that inhibits the binding and antagonist.
functional activity of various agonists, with a binding Ki of 0.13 nM for the human CB1R in vitro.
Purity: 99.46% Purity: >98% Clinical Data: Phase 3 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 20 mg 2 mg, 5 mg, 10 mg, 25 mg
Taspoglutide Taurine (ITM077; R1583; BIM51077) Cat. No.: HY-P0165 (2-Aminoethanesulfonic acid) Cat. No.: HY-B0351
Bioactivity: Taspoglutide is a long-acting glucagon-like peptide 1 ( Bioactivity: Taurine is an organic acid widely distributed in animal GLP-1) receptor agonist developed for treatment of type 2 tissues. Target: Others Taurine is a major constituent of bile
diabetes, with an EC50 value of 0.06 nM. Sequence: His-{Aib} and can be found in the large intestine and accounts for -Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-A approximately 0.1% of total human body weight [1]. Taurine is la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-{Aib}-Arg-NH2. present in high concentration in algae and in the animals… Purity: 97.17% Purity: 98.0% Clinical Data: Phase 3 Clinical Data: Phase 4 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in Water, 1 mg, 5 mg, 10 mg, 25 mg 1 g, 5 g
TB500 TC-G-1008 Cat. No.: HY-P0170 (GPR39-C3) Cat. No.: HY-103007
Bioactivity: TB500 is a synthetic version of an active region of thymosin β Bioactivity: TC-G-1008 (GPR39-C3) is a potent and orally available GPR39 . TB500 is claimed to promote endothelial cell 4 agonist with EC50 values of 0.4 and 0.8 nM for rat and human differentiation, angiogenesis in dermal tissues, keratinocyte receptors respectively. migration, collagen deposition and decrease inflammation. Sequence: N-Acetyl-Leu-Lys-Lys-Thr-Glu-Thr-Gln. Purity: 98.36% Purity: 99.71% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 2 mg, 5 mg, 10 mg, 25 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
TCS 401 TD-5471 hydrochloride Cat. No.: HY-12312 Cat. No.: HY-19942A
Bioactivity: TCS 401 is a selective inhibitor of protein tyrosine Bioactivity: TD-5471 hydrochloride is a potent and selective full agonist
phosphatase 1B (PTP1B). of the human β2-adrenoceptor.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg 5 mg, 10 mg, 50 mg, 100 mg
Teneligliptin Teneligliptin hydrobromide Cat. No.: HY-14806 (Teneligliptin) Cat. No.: HY-14806A
Bioactivity: Teneligliptin is a potent chemotype prolylthiazolidine-based Bioactivity: Teneligliptin hydrobromide is a potent chemotype DPP-4 inhibitor, which competitively inhibits human plasma, prolylthiazolidine-based DPP-4 inhibitor, which competitively
rat plasma, and human recombinant DPP-4 in vitro, with IC50s inhibits human plasma, rat plasma, and human recombinant DPP-4 in vitro, with IC s of approximately 1 nM. of approximately 1 nM. 50
Purity: 99.82% Purity: 99.99% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in Water, 10 mg, 50 mg, 100 mg, 250 mg 10 mg, 50 mg, 100 mg, 250 mg
www.MedChemExpress.com 77
Terazosin Terbufibrol Cat. No.: HY-B0371 Cat. No.: HY-101812
Bioactivity: Terazosin is a selective alpha1-antagonist used for treatment Bioactivity: Terbufibrol has been shown highly active in reducing serum of symptoms of benign prostatic hyperplasia (BPH). total cholesterol (TC) levels in the normal and hypercholesterolemic male rat.
Purity: >98% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 100 mg, 500 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
TES-1025 TES-991 Cat. No.: HY-111365 Cat. No.: HY-112619
Bioactivity: TES-1025 is a potent and selective human Bioactivity: TES-991 is a potent and selective human α-amino-β-carboxymuconate-ε-semialdehyde decarboxylase ( αAmino-β-carboxymuconate-ε-semialdehyde Decarboxylase
ACMSD) inhibitor with an IC50 of 13±3 nM. (ACMSD) inhibitor, with an IC50 of 3 nM.
Purity: 98.12% Purity: 99.65% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
TFAP TGR5 Receptor Agonist (N-(5-Aminopyridin-2-yl)-4-(trifluoromethyl)benzamide) Cat. No.: HY-112731 Cat. No.: HY-14229
Bioactivity: TFAP is a selective cyclooxygenase-1 (COX-1) inhibitor, with Bioactivity: TGR5 Receptor Agonist, a potent TGR5(GPCR19) agonist, showed improved potency in the U2-OS cell assay (pEC50 = 6.8) and in an IC50 of 0.8 μM. melanophore cells (pEC50 = 7.5).
Purity: 99.97% Purity: 99.86% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
Thiamine monochloride Thiamine nitrate (Vitamin B1) Cat. No.: HY-A0100 (Vitamin B1 nitrate) Cat. No.: HY-B2223
Bioactivity: Thiamine monochloride (Vitamin B1) is an essential vitamin Bioactivity: Thiamine nitrate is an essential vitamin which can enhance that plays an important role in cellular production of energy normal neuronal actives. from ingested food and enhances normal neuronal actives.
Purity: 98.16% Purity: 98.0% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g 100 mg, 1 g
Thiamine pyrophosphate Thymine Cat. No.: HY-113076 Cat. No.: HY-W010450
Bioactivity: Thiamine pyrophosphate is the coenzyme form of Vitamin B1 and Bioactivity: Thymine is one of the four nucleobases in the nucleic acid of is a required intermediate in the pyruvate dehydrogenase DNA and can be a target for actions of 5-fluorouracil (5-FU)
complex and the ketoglutarate dehydrogenase complex. in cancer treatment, with a K m of 2.3 μM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 1 g
78 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Thyrotropin-Releasing Hormone (TRH), Free Acid Thyroxine sulfate (TRH-OH) Cat. No.: HY-P1529 (T4 Sulfate) Cat. No.: HY-101406
Bioactivity: Thyrotropin-Releasing Hormone (TRH), Free Acid (TRH-OH) is a Bioactivity: Thyroxine sulfate is a thyroid hormone metabolite. physiological metabolite of Thyrotropin-Releasing Hormone.
Purity: >98% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10 mg, 25 mg, 50 mg, 100 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg
Tiaprost Tiglyl carnitine (Iliren) Cat. No.: HY-111478 Cat. No.: HY-113408
Bioactivity: Tiaprost is a prostaglandin F 2α ( PGF2α) analogue. Bioactivity: Tiglyl carnitine is found to be associated with celiac disease and mitochondrial acetoacetyl-CoA thiolase (T2) deficiency.
Purity: 98.0% Purity: >98% Clinical Data: No Development Reported Clinical Data: Size: 1 mg Size:
Tiopronin Tioxolone Cat. No.: HY-B0373 Cat. No.: HY-B0483
Bioactivity: Tiopronin is a prescription thiol drug used to control the Bioactivity: Tioxolone, a metalloenzyme carbonic anhydrase I inhibitor, is rate of cystine precipitation and excretion in the disease an anti-acne preparation. cystinuria.
Purity: 98.0% Purity: 98.0% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg 1 g
Tiplaxtinin Tocofersolan (D-α-Tocopherol polyethylene glycol 1000 (PAI-039; Tiplasinin) Cat. No.: HY-15253 succinate; TPGS; Vitamin E-TPGS) Cat. No.: HY-B0717
Bioactivity: Tiplaxtinin is a selective and orally efficacious inhibitor of Bioactivity: Tocofersolan is a synthetic water-soluble version of vitamin
plasminogen activator inhibitor-1 ( PAI-1) with IC50 of 2.7 μM. E.
Purity: 97.60% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 5 g, 10 g, 25 g
Tofogliflozin Tofogliflozin hydrate (CSG452) Cat. No.: HY-14902 (CSG-452 hydrate) Cat. No.: HY-13413
Bioactivity: Tofogliflozin(CSG-452) is a potent and highly specific Bioactivity: Tofogliflozin(CSG-452) hydrate is a potent and highly specific sodium/glucose cotransporter 2(SGLT2) inhibitor with Ki values sodium/glucose cotransporter 2(SGLT2) inhibitor with Ki values of 2.9, 14.9, and 6.4 nM for human, rat, and mouse SGLT2. of 2.9, 14.9, and 6.4 nM for human, rat, and mouse SGLT2.
Purity: >98% Purity: 99.41% Clinical Data: Launched Clinical Data: Launched Size: 5 mg, 10 mg, 50 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
www.MedChemExpress.com 79
Tolbutamide Tolimidone Cat. No.: HY-B0401 (MLR-1023) Cat. No.: HY-59047
Bioactivity: Tolbutamide is a first generation potassium channel blocker, Bioactivity: Tolimidone is a potent and selective allosteric activator of
sulfonylurea oral hypoglycemic drug. Target: Potassium Channel Lyn kinase with an EC50 of 63 nM. Tolbutamide is an oral antihyperglycemic agent used for the treatment of non-insulin-dependent diabetes mellitus (NIDDM). Tolbutamide act by stimulating β cells of the pancreas to… Purity: 98.0% Purity: 99.87% Clinical Data: Launched Clinical Data: Phase 2 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 1 g, 5 g 5 mg
Topiroxostat Torsemide (FYX-051) Cat. No.: HY-14874 (Torasemide) Cat. No.: HY-B0247
Bioactivity: Topiroxostat(FYX-051) is a novel and potent xanthine Bioactivity: Torsemide is a pyridine-sulfonyl urea type loop diuretic. oxidoreductase (XOR) inhibitor with IC50 value of 5.3 nM.
Purity: 98.54% Purity: 99.74% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg, 200 mg 10 mg, 100 mg
TR antagonist 1 trans-ACPD Cat. No.: HY-111443 (Trans-(±)-ACP) Cat. No.: HY-19434
Bioactivity: TR antagonist 1 is a high-affinity thyroid hormone receptor Bioactivity: trans-ACPD, a metabotropic receptor agonist, produces calcium mobilization and an inward current in cultured (TR) antagonist with IC50s of 36 and 22 nM for TRα and TRβ, respectively. cerebellar Purkinje neurons.
Purity: 99.64% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in Water, 5 mg, 10 mg, 50 mg, 100 mg 2 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
trans-trans-Muconic acid Trelagliptin Cat. No.: HY-113247 (SYR-472) Cat. No.: HY-15408
Bioactivity: trans-trans-Muconic acid is a urinary metabolite of benzene Bioactivity: Trelagliptin(SYR-472) is a long acting dipeptidyl peptidase-4 and has been used as a biomarker of exposure to benzene in (DPP-4) inhibitor that is being developed for the treatment of humans type 2 diabetes (T2D).
Purity: >98% Purity: 99.89% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg 5 mg, 10 mg, 50 mg, 100 mg
Trelagliptin succinate Triamterene (SYR-472 succinate) Cat. No.: HY-15408A Cat. No.: HY-B0575
Bioactivity: Trelagliptin(SYR-472) is a long acting dipeptidyl peptidase-4 Bioactivity: Triamterene blocks epithelial Na+ channel (ENaC) in a (DPP-4) inhibitor that is being developed for the treatment of voltage-dependent manner, which used as a mild diuretic. type 2 diabetes (T2D).
Purity: 99.89% Purity: 99.17% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg 100 mg, 500 mg
80 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Trichlormethiazide Tricosanoic acid Cat. No.: HY-B0235 Cat. No.: HY-W009081
Bioactivity: Trichlormethiazide is a thiazide diuretic with properties Bioactivity: Tricosanoic acid is a long-chain fatty acid and shown to be a similar to those of hydrochlorothiazide. hair growth stimulant.
Purity: 98.67% Purity: >98% Clinical Data: Launched Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 g, 5 g
Trigonelline Trigonelline chloride (Trigenolline) Cat. No.: HY-N0414 (Trigonelline hydrochloride) Cat. No.: HY-N0415
Bioactivity: Trigonelline, an alkaloid with potential antidiabetic Bioactivity: Trigonelline chloride, an alkaloid with potential antidiabetic activity, is present in considerable amounts in coffee. activity, is present in considerable amounts in coffee.
Purity: >98% Purity: 99.96% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 10mM x 1mL in DMSO, 100 mg, 500 mg
Trimebutine Trimebutine maleate Cat. No.: HY-B0380 Cat. No.: HY-B0380A
Bioactivity: Trimebutine is a drug with antimuscarinic and weak mu opioid Bioactivity: Trimebutine maleate is a drug with antimuscarinic and weak mu agonist effects. opioid agonist effects.
Purity: >98% Purity: 99.95% Clinical Data: Launched Clinical Data: Launched Size: 5 g Size: 10mM x 1mL in DMSO, 5 g
Troxerutin TUG-770 (Trihydroxyethylrutin) Cat. No.: HY-N0139 Cat. No.: HY-15697
Bioactivity: Troxerutin, also known as vitamin P4, is a Bioactivity: TUG-770 is a highly potent free fatty acid receptor 1 tri-hydroxyethylated derivative of natural bioflavonoid rutins (FFA1/GPR40) agonist with EC50 of 6 nM for hFFA1. IC50 Value: which can inhibit the production of reactive oxygen species ( 6 nM (hFFA1, EC50) [1] Target: GPR40 in vitro: TUG-770 ROS) and depress ER stress-mediated NOD activation. (Compound 22) displayed excellent physicochemical and in vitro ADME properties, with good aqueous solubility, good chemical… Purity: 98.05% Purity: 98.52% Clinical Data: Phase 4 Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 100 mg, 5 g 5 mg, 10 mg, 50 mg, 100 mg
TUG-891 UDP-GlcNAc Disodium Salt Cat. No.: HY-100881 (UDP-α-D-N-Acetylglucosamine Disodium Salt) Cat. No.: HY-112174
Bioactivity: TUG-891 is a potent and selective agonist of the long chain Bioactivity: UDP-α-D-N-Acetylglucosamine Disodium Salt is a donor substrate free fatty acid (LCFA) receptor 4. of O-GlcNAc transferase (OGT).
Purity: 99.27% Purity: 99.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 5 mg 5 mg, 10 mg, 25 mg, 50 mg
www.MedChemExpress.com 81
UK-157147 Undecanedioic acid Cat. No.: HY-100319 Cat. No.: HY-W014125
Bioactivity: UK-157147 is a substrate for UDP-glucuronosyltransferases ( Bioactivity: Undecanedioic acid is associated with intercellular matrix
UGT1A1) with a Km value of 105 μM. macromolecules and specifically with elastin.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 1 g
Ursocholic acid Ursodiol Cat. No.: HY-113212 (Ursodeoxycholic acid; UDCS) Cat. No.: HY-13771
Bioactivity: Ursocholic acid, a bile acid found predominantly in bile of Bioactivity: Ursodiol reduces cholesterol absorption and is used to mammals, is an inhibitor of 7α-hydroxysteroid dehydrogenase dissolve gallstones. Target: Others Ursodiol, also known as and hepatocyte nuclear factor 1α. ursodeoxycholic acid and the abbreviation UDCA, is one of the secondary bile acids, which are metabolic byproducts of intestinal bacteria. The drug reduces cholesterol absorption… Purity: >98% Purity: 98.0% Clinical Data: Clinical Data: Launched Size: 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 1 g, 5 g
VD2-D3 VD3-D6 Cat. No.: HY-15330 (Vitamin D3-26,26,26,27,27,27-d6) Cat. No.: HY-15331
Bioactivity: VD2-D3 is a deuterated form of vitamin D. Bioactivity: VD3-D6(Vitamin D3-26,26,26,27,27,27-d6) is the deuterated form of Vitamin D3; tools for determination of Vitamin D3 metabolites in human serum.
Purity: 95.75% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg Size: 1 mg, 5 mg
Velagliflozin Velneperit Cat. No.: HY-109018 (S2367) Cat. No.: HY-14423
Bioactivity: Velagliflozin is an orally available sodium-glucose Bioactivity: Velneperit (S-2367) is a novel neuropeptide Y (NPY) Y5 cotransporter 2 ( SGLT2) inhibitor, with anti-diabetic receptor antagonist. activity.
Purity: >98% Purity: 99.65% Clinical Data: No Development Reported Clinical Data: Phase 2 Size: 250 mg, 500 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
Verinurad Vildagliptin Cat. No.: HY-16733 (LAF237; NVP-LAF 237) Cat. No.: HY-14291
Bioactivity: Verinurad is an urate transporter inhibitor with EC50 value of Bioactivity: Vildagliptin (LAF-237; NVP-LAF 237) inhibits DPP-4 with IC50 0.05 μM. of 2.3 nM. IC50 Value: 2.3 nM[1] Target: DPP-4 in vitro: Vildagliptin is an N-substituted glycyl-2-cyanopyrrolidine (figure 2). It is a potent competitive and reversible inhibitor of human and rodent DPP-4 in vitro, with a median… Purity: 98.0% Purity: 98.03% Clinical Data: No Development Reported Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg 10 mg, 50 mg, 100 mg, 500 mg
82 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
Vildagliptin dihydrate VIP(6-28)(human, rat, porcine, bovine) (LAF237 dihydrate; NVP-LAF 237 dihydrate) Cat. No.: HY-14291A Cat. No.: HY-P1023
Bioactivity: Vildagliptin (LAF237 dihydrate;NVP-LAF 237 dihydrate) is a Bioactivity: VIP(6-28)(human, rat, porcine, bovine) is an effective dipeptidyl peptidase 4 (DPP4) inhibitor that delays the antagonist of the actions of exogenous vasoactive intestinal degradation of glucagon-like peptide-1 (GLP-1). peptide ( VIP) on cAMP. Sequence: Phe-Thr-Asp-Asn-Tyr-Thr-Arg-L eu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn . Purity: >98% Purity: 98.43% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10 mg, 50 mg, 100 mg Size: 500u g, 1 mg, 5 mg
Vitamin B12 Vitamin D2 (Cyanocobalamin) Cat. No.: HY-B0315 (Ergocalciferol; Calciferol; Ercalciol) Cat. No.: HY-76542
Bioactivity: Vitamin B12 is a water soluble vitamin with a key role in the Bioactivity: Vitamin D2 (Ergocalciferol) is a form of vitamin D, used as a normal functioning of the brain and nervous system, and for vitamin D supplement. Target: Ergocalciferol is a secosteroid the formation of blood. formed by a photochemical bond breaking of a steroid, specifically, by the action of ultraviolet light on ergosterol. Purity: 99.22% Purity: 98.0% Clinical Data: Launched Clinical Data: Launched Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 500 mg 5 g, 10 g
Vitamin D4 Voglibose Cat. No.: HY-75958 Cat. No.: HY-B0025
Bioactivity: Vitamin D4 is the active analogue of Vitamin D. Bioactivity: Voglibose is an N-substituted derivative of valiolamine, excellent inhibitory activity against α-glucosidases and its action against hyperglycemia and various disorders caused by hyperglycemia. Target: α-glucosidases glibose can inhibit the intestinal α-glucosidases, which are responsible for the… Purity: 99.62% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Launched Size: 1 mg, 5 mg, 10 mg, 50 mg Size: 10mM x 1mL in Water, 50 mg, 100 mg
VR23 W146 Cat. No.: HY-18741 (W-146; W 146) Cat. No.: HY-101395
Bioactivity: VR23 is a small molecule that potently inhibited the Bioactivity: W146 is a selective antagonist of sphingosine-1-phosphate
activities of trypsin-like proteasomes (IC50 = 1 nM), receptor 1 ( S1PR1) with an EC 50 value of 398 nM. chymotrypsin-like proteasomes (IC50 = 50-100 nM), and caspase-like proteasomes (IC50 = 3 μM).
Purity: 95.51% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 250 mg, 500 mg 5 mg, 10 mg, 50 mg, 100 mg
WAY-151932 WAY-362450 (VNA-932; WAY-VNA 932) Cat. No.: HY-19381 (XL335; Turofexorate isopropyl) Cat. No.: HY-50911
Bioactivity: WAY-151932 is a vasopressin V2-receptor agonist with IC50 of Bioactivity: WAY-362450 is a potent, selective, and orally bioavailable FXR agonist with EC of 4 nM. 80.3 nM and 778 nM in human-V 2 binding and V 1a binding 50 assay.
Purity: >98% Purity: 99.41% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg, 20 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg, 100 mg
www.MedChemExpress.com 83
WS-12 WS-3 Cat. No.: HY-108449 Cat. No.: HY-W014325
Bioactivity: WS-12 is an agonist of TRPM8 with an EC50 of 39 nM. Bioactivity: WS-3 is an agonist of TRPM8 with an EC50 of 3.7 μM.
Purity: 99.03% Purity: 99.21% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 mg, 10 mg 5 g
Wy-14643 Xanthine oxidase-IN-1 (Pirinixic acid) Cat. No.: HY-16995 (4-(3-Cyano-5,6-difluoroindol-1-yl)-2-hydroxybenzoic acid) Cat. No.: HY-U00288
Bioactivity: Wy-14643 is a potent agonist of PPARα, with EC50s of 0.63 Bioactivity: Xanthine oxidase-IN-1 is a xanthine oxidase inhibitor extracted μM, 32 μM for murine PPARα and PPARγ, and 5.0 μM, 60 μM, 35 from patent WO2008126898A1, page 68, compound example 3, with an IC of 6.5 nM. μM for human PPARα, PPARγ and PPARδ, respectively. 50
Purity: 99.69% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in DMSO, Size: 1 mg, 5 mg, 10 mg, 20 mg 10 mg, 50 mg, 100 mg, 250 mg
Xanthurenic acid XEN723 Cat. No.: HY-W014666 Cat. No.: HY-100249
Bioactivity: Xanthurenic acid is a putative endogenous Group II Bioactivity: XEN723 is a novel and potent thiazolylimidazolidinone
metabotropic glutamate receptor agonist, on sensory inhibitor of Stearoyl-CoA Desaturase ( SCD1) with IC50s of 45 transmission in the thalamus. and 524 nM in mouse and HepG2 cell, respectively.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: Size: 1 mg, 5 mg, 10 mg
Xenin YK11 Cat. No.: HY-P0259 Cat. No.: HY-107480
Bioactivity: Xenin is a 25-amino acid peptide initially isolated from human Bioactivity: YK11 is a partial agonist of androgen receptor, with gastric mucosa. Xenin is a gut hormone that can reduce food osteogenic activity. intake. Sequence: Met-Leu-Thr-Lys-Phe-Glu-Thr-Lys-Ser-Ala-Arg- Val-Lys-Gly-Leu-Ser-Phe-His-Pro-Lys-Arg-Pro-Trp-Ile-Leu.
Purity: >98% Purity: 98.07% Clinical Data: Phase 1 Clinical Data: No Development Reported Size: 500u g, 1 mg, 5 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
YM-53601 free base YM17E Cat. No.: HY-100313 Cat. No.: HY-101627
Bioactivity: YM-53601 free base is a squalene synthetase inhibitor which Bioactivity: YM17E is an inhibitor of acyl CoA:cholesterol acyltransferase
suppresses lipogenic biosynthesis and lipid secretion in ( ACAT), with IC50 of 44 nM in rabbit liver microsomes in rodents. vitro.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 1 mg, 5 mg, 10 mg, 20 mg
84 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]
YM348 ZLN005 Cat. No.: HY-100330 Cat. No.: HY-17538
Bioactivity: YM348 is a potent and orally active 5-HT2C receptor Bioactivity: ZLN005 is a novel transcriptional regulator of peroxisome proliferator-activated receptor-γ coactivator-1α (PGC-1α). agonist, which shows a high affinity for cloned human 5-HT2C
receptor ( Ki: 0.89 nM).
Purity: >98% Purity: 98.11% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 10 mg, 50 mg
ZLN024 ZLN024 hydrochloride Cat. No.: HY-16708 Cat. No.: HY-16708A
Bioactivity: ZLN024 is an AMPK allosteric activator. ZLN024 directly Bioactivity: ZLN024 hydrochloride is an AMPK allosteric activator. activates recombinant AMPK α1β1γ1, AMPK α2β1γ1, AMPK α1β2γ1 ZLN024 directly activates recombinant AMPK α1β1γ1, AMPK
and AMPK α2β2γ1 heterotrimer with EC50s of 0.42 µM, 0.95 µM, α2β1γ1, AMPK α1β2γ1 and AMPK α2β2γ1 heterotrimer with EC50s 1.1 µM and 0.13 µM, respectively. of 0.42 µM, 0.95 µM, 1.1 µM and 0.13 µM, respectively.
Purity: >98% Purity: 98.55% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg, 50 mg Size: 10mM x 1mL in DMSO, 5 mg, 10 mg, 50 mg
α-L-Rhamnose monohydrate α-Melanocyte-Stimulating Hormone (MSH), amide Cat. No.: HY-N0642 Cat. No.: HY-P0252
Bioactivity: α-L-Rhamnose monohydrate is a component of the plant cell wall Bioactivity: α-Melanocyte-Stimulating Hormone (MSH), amide stimulates pectic polysaccharides rhamnogalacturonan I and melanocortin 1 receptor that results in the activation of rhamnogalacturonan II. α-L-Rhamnose monohydrate is also a adenylyl cyclase. Sequence: component of bacterial polysaccharides where it plays an Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2. important role in pathogenicity. Purity: 98.0% Purity: 98.55% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 10mM x 1mL in Water, Size: 1 mg, 5 mg, 10 mg, 25 mg 100 mg, 500 mg
β-Alanine β-Carotene (2-Carboxyethylamine; 3-Aminopropanoic acid) Cat. No.: HY-N0230 (Provitamin A; Carotaben; beta-Carotene; Lucarotin) Cat. No.: HY-N0411
Bioactivity: β-Alanine is a non-essential amino acid that is shown to be Bioactivity: Beta Carotene is an organic compound and classified as a metabolized into carnosine, which functions as an terpenoid. It is a precursor (inactive form) of vitamin A. intracellular buffer. Target: Others Beta Carotene is a strongly colored red-orange pigment abundant in plants and fruits.β-Carotene is biosynthesized from geranylgeranyl pyrophosphate. It is a… Purity: 98.0% Purity: 98.0% Clinical Data: No Development Reported Clinical Data: Phase 3 Size: 10mM x 1mL in DMSO, Size: 10mM x 1mL in DMSO, 5 g 50 mg, 100 mg
β-Casomorphin, bovine β-Casomorphin, human (β-Casomorphin-7 (bovine); Bovine β-casomorphin-7) Cat. No.: HY-P0179 (Human β-casomorphin 7) Cat. No.: HY-P1481
Bioactivity: β-casomorphin, bovine (β-casomorphin-7) is a opioid peptide Bioactivity: β-Casomorphin, human is an opioid peptide, acts as an agonist
with an IC50 of 14 μM in an Opioid receptors binding assay. of opioid receptor.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 5 mg, 10 mg, 25 mg Size: 5 mg, 10 mg, 25 mg
www.MedChemExpress.com 85
β-Melanocyte Stimulating Hormone (MSH), human β3-AR agonist 2 (Beta-MSH (1-22) (human)) Cat. No.: HY-P1504 Cat. No.: HY-U00391
Bioactivity: β-Melanocyte Stimulating Hormone (MSH), human is a Bioactivity: β 3-AR agonist 2 is a potent and selective β3-adrenergic melanocortin (MC) receptor agonist. receptor ( β3-AR) agonist with an EC50 of 8 nM.
Purity: >98% Purity: >98% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 1 mg, 5 mg, 10 mg
γ-1-Melanocyte Stimulating Hormone (MSH), amide γ-Oryzanol Cat. No.: HY-P1531 Cat. No.: HY-B2194
Bioactivity: γ-1-Melanocyte Stimulating Hormone (MSH), amide is a 11-amino Bioactivity: γ-Oryzanol is a potent DNA methyltransferases ( DNMTs) acid peptide. γ-1-Melanocyte Stimulating Hormone (MSH) inhibitor in the striatum of mice. γ-Oryzanol significantly + regulates sodium (Na ) balance and blood pressure through inhibits the activities of DNMT1 ( IC50=3.2 μM), DNMT3a activation of the melanocortin receptor 3 ( MC3-R). ( IC50=22.3 μM). Purity: >98% Purity: 95.0% Clinical Data: No Development Reported Clinical Data: No Development Reported Size: 1 mg, 5 mg, 10 mg Size: 10mM x 1mL in DMSO, 1 g
86 Tel: 609-228-6898 Fax: 609-228-5909 Email: [email protected]