TMS Track List
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Few Translation of Works of Tamil Sidhas, Saints and Poets Contents
Few translation of works of Tamil Sidhas, Saints and Poets I belong to Kerala but I did study Tamil Language with great interest.Here is translation of random religious works That I have done Contents Few translation of works of Tamil Sidhas, Saints and Poets ................. 1 1.Thiruvalluvar’s Thirukkual ...................................................................... 7 2.Vaan chirappu .................................................................................... 9 3.Neethar Perumai .............................................................................. 11 4.Aran Valiyuruthal ............................................................................. 13 5.Yil Vazhkai ........................................................................................ 15 6. Vaazhkkai thunai nalam .................................................................. 18 7.Makkat peru ..................................................................................... 20 8.Anbudamai ....................................................................................... 21 9.Virunthombal ................................................................................... 23 10.Iniyavai kooral ............................................................................... 25 11.Chei nandri arithal ......................................................................... 28 12.Naduvu nilamai- ............................................................................. 29 13.Adakkamudamai ........................................................................... -
Spectacle Spaces: Production of Caste in Recent Tamil Films
South Asian Popular Culture ISSN: 1474-6689 (Print) 1474-6697 (Online) Journal homepage: http://www.tandfonline.com/loi/rsap20 Spectacle spaces: Production of caste in recent Tamil films Dickens Leonard To cite this article: Dickens Leonard (2015) Spectacle spaces: Production of caste in recent Tamil films, South Asian Popular Culture, 13:2, 155-173, DOI: 10.1080/14746689.2015.1088499 To link to this article: http://dx.doi.org/10.1080/14746689.2015.1088499 Published online: 23 Oct 2015. Submit your article to this journal View related articles View Crossmark data Full Terms & Conditions of access and use can be found at http://www.tandfonline.com/action/journalInformation?journalCode=rsap20 Download by: [University of Hyderabad] Date: 25 October 2015, At: 01:16 South Asian Popular Culture, 2015 Vol. 13, No. 2, 155–173, http://dx.doi.org/10.1080/14746689.2015.1088499 Spectacle spaces: Production of caste in recent Tamil films Dickens Leonard* Centre for Comparative Literature, University of Hyderabad, Hyderabad, India This paper analyses contemporary, popular Tamil films set in Madurai with respect to space and caste. These films actualize region as a cinematic imaginary through its authenticity markers – caste/ist practices explicitly, which earlier films constructed as a ‘trope’. The paper uses the concept of Heterotopias to analyse the recurrence of spectacle spaces in the construction of Madurai, and the production of caste in contemporary films. In this pursuit, it interrogates the implications of such spatial discourses. Spectacle spaces: Production of caste in recent Tamil films To foreground the study of caste in Tamil films and to link it with the rise of ‘caste- gestapo’ networks that execute honour killings and murders as a reaction to ‘inter-caste love dramas’ in Tamil Nadu,1 let me narrate a political incident that occurred in Tamil Nadu – that of the formation of a socio-political movement against Dalit assertion in December 2012. -
Global Journal of Human Social Science
Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS EffectonImprovingtheEconomy EffectivenessofGovernmentPolicies FeasibilityoftheProposedMonetary RetrospectiveReflectionontheHistory VOLUME18ISSUE5VERSION1.0 Global Journal of Human-Social Science: E Economics Global Journal of Human-Social Science: E Economics Volume 18 Issue 5 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2018. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ G lobal Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU -
List of Nominated IIC Members for the Innovation Ambassador Training Program 2021 Advanced Level
List of Nominated IIC Members for the Innovation Ambassador Training Program 2021 Advanced Level S.No IIC ID Institute State Institute Name Nominated IIC Member 1 IC201811727 Maharashtra Bharati Vidyapeeth Deemed to be University College of Engineering Chinke Sandeep Laxman 2 IC201811727 Maharashtra Bharati Vidyapeeth Deemed to be University College of Engineering Dr. Sunita Dhotre 3 IC201811727 Maharashtra Bharati Vidyapeeth Deemed to be University College of Engineering Dr. Bindu Garg 4 IC201811727 Maharashtra Bharati Vidyapeeth Deemed to be University College of Engineering Sonali D Mali 5 IC201810052 Uttar Pradesh IILM Academy of Higher Learning College of Engineering & Manjula Shanbhog Technology 6 IC202014070 Maharashtra A P SHAH INSTITUTE OF TECHNOLOGY Dr Sameer Nanivadekar 7 IC202014070 Maharashtra A P SHAH INSTITUTE OF TECHNOLOGY Bhushan Chavan 8 IC202014070 Maharashtra A P SHAH INSTITUTE OF TECHNOLOGY Manishkumar Gadle 9 IC202014070 Maharashtra A P SHAH INSTITUTE OF TECHNOLOGY Dipali P. Rajguru 10 IC202014070 Maharashtra A P SHAH INSTITUTE OF TECHNOLOGY Amol Shinde 11 IC202014070 Maharashtra A P SHAH INSTITUTE OF TECHNOLOGY Aakash M. Vichare 12 IC202014070 Maharashtra A P SHAH INSTITUTE OF TECHNOLOGY Dr. Mugdha Agarwadkar 13 IC201811289 Tamil Nadu A.P.C. Mahalaxmi College for Women Dr. V. Maheswari 14 IC201811289 Tamil Nadu A.P.C. Mahalaxmi College for Women Dr. R. Rajeswari 15 IC201811289 Tamil Nadu A.P.C. Mahalaxmi College for Women Dr.S.Sankaravadivu 16 IC201811289 Tamil Nadu A.P.C. Mahalaxmi College for Women Dr.K.Chitra -
Chevalior Sivaji Ganesan‟S Tamil Film Songs Not Only Emulated the Quality of the Movie but Also Contains Ethical Imports That
Global Journal of HUMAN-SOCIAL SCIENCE: A Arts & Humanities - Psychology Volume 20 Issue 10 Version 1.0 Year 2020 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X Chevalior Sivaji Ganesan‟S Tamil Film Songs Not Only Emulated the Quality of the Movie but also Contains Ethical Imports that can be Compared with the Ethical Theories – A Retrospective Reflection By P.Sarvaharana, Dr. S.Manikandan & Dr. P.Thiyagarajan Tamil Nadu Open University Abstract- This is a research work that discusses the great contributions made by Chevalior Shivaji Ganesan to the Tamil Cinema. It was observed that Chevalior Sivaji film songs reflect the theoretical domain such as (i) equity and social justice and (ii) the practice of virtue in the society. In this research work attention has been made to conceptualize the ethical ideas and compare it with the ethical theories using a novel methodology wherein the ideas contained in the film song are compared with the ethical theory. Few songs with the uncompromising premise of patni (chastity of women) with the four important charateristics of women of Tamil culture i.e. acham, madam, nanam and payirpu that leads to the great concept of chastity practiced by exalting woman like Kannagi has also been dealt with. The ethical ideas that contain in the selection of songs were made out from the selected movies acted by Chevalier Shivaji giving preference to the songs that contain the above unique concept of ethics. GJHSS-A Classification: FOR Code: 190399 ChevaliorSivajiGanesanSTamilFilmSongsNotOnlyEmulatedtheQualityoftheMoviebutalsoContainsEthicalImportsthatcanbeComparedwiththeEthicalTheo riesARetrospectiveReflection Strictly as per the compliance and regulations of: © 2020. -
Songs Download Tamil Old
Songs download tamil old A. A n · B. Best of Old Collections. C. man · Chandra Babu. D. li Govindarajan. G. Gandasala. J. Jeyachanthiran. K. provides latest tamil mp3 songs free download, old tamil mp3 songs free You are here: Home:: Old Collections. Old Collections.Sad Songs (Old) 2 · Sad Songs (Old) 1 · Old Collections 1 · Old Collections 2. We have categorized by tamil classical songs collection, Kannadasan Hits, Siviji ganesan and MGR movies, Gemini Ganesan Hits.Kannadasan Hits · JP Chandrababu Tamil Old · Tamil to 's Old Sad. Kannadasan was a Tamil poet and most important writers in the Tamil language. we have categorized by Kannadasan Hits Old Songs Free Download. Tamil Old Collections Mp3 Songs Download, Tamil Old Collections High Quality Mp3 Songs Free Download.Sivaji Ganesan - Golden Hits · Sad Songs (Old) · Old Collections 2. Ilayaraja Tamil Hits, Lahari Music presents to you Ilayaraja Old Tamil Hit Songs, Ilayaraja Tamil Songs. Saregama Tamil , views · MGR & Jayalalitha Romantic Songs Jukebox - Old Classic. Hi here you will get all Tamil old hit songs from Tamil movies. This Tamil Old Evergreen Hit Songs App is dedicated to Tamil Fans. In this app. Hi here you will get all Tamil old hit songs from Tamil movies. In this app you will get Tamil old can listen and watch your favourite old Tamil songs. old tamil songs download tamil old songs download old tamil songs free download. ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; Music Sivaji Ganesan Tamil Mp3 Songs Free Download Mp3 Music New Hits High quality Songs Best Tamil Mp3 Songs downloads. MG Ramachandran Hits, MGR Hits Mp3 Songs Download, MG Ramachandran Old Movie Songs Collection, MG Ramachandran Songs. -
“List of Companies/Llps Registered During the Year 1982”
“List of Companies/LLPs registered during the year 1982” Note: The list include all companies/LLPs registered during this period irrespective of the current status of the company. In case you wish to know the current status of any company please access the master detail of the company at the MCA site http://mca.gov.in Sr. No. CIN/FCRN/LLPIN/FLLPIN Name of the entity Date of Incorporation 1 U45200MH1982PLC025999 ASIATIC PROPERTIES LTD 1/1/1982 2 U33110MH1982PTC026004 CROWN WATCHES PVT LTD 1/1/1982 3 U74899DL1982PTC012932 ANURUP EXPORTS PRIVATE LIMITED 1/1/1982 4 U15127TN1982PTC009153 AGRO PRODUCE BROKERS PRIVATE LIMITED 1/1/1982 5 U18209TN1982PTC009154 AMBUR LEATHERS PVT LTD 1/1/1982 6 U33111TN1982PTC009156 DVM REFRIGERATION & AIR CONDITIONING PVT LTD 1/1/1982 7 U63090GJ1982PTC004944 ARIHANT TRAVELS PVT LTD 1/1/1982 8 U92112OR1982PTC001025 DYNAMIC STUDIOS PVT LTD 1/1/1982 9 U55101KA1982PTC004571 KOMARALA HOTELSANDRESORTS PRIVATE LIMITED 1/1/1982 10 U85110KA1982PTC004577 KOR INVESTMENTS PRIVATE LIMITED 1/1/1982 11 U18101KA1982PTC004579 HARWOOD GARMENTS PRIVATE LIMITED 1/1/1982 12 U65993KA1982PTC004576 KUSHAL INVESTMENTS PRIVATE LIMITED 1/1/1982 13 U24299PB1982PTC004789 KISHORE CHEMICALS PVT LTD 1/1/1982 14 U24231GJ1982PTC004946 KISAN BROTHERS PVT LTD 1/1/1982 15 U52324MH1982PTC026001 G GANGADAS SHSH AND SONS PVT LTD 1/1/1982 16 U01220MH1982PTC025998 THE EQUUS STUD PVT LTD 1/1/1982 17 U26941GJ1982PTC004943 VEKMONS PRIVATE LIMITED 1/1/1982 18 U00313KA1982PTC004573 MAPLE PLAST PRIVATE LIMITED 1/1/1982 19 U01135GJ1982PTC004942 MAHENDRA AND MAHENDRA SEEDS PVT LTD 1/1/1982 20 U24231GJ1982PTC004945 OPAL PROCESS SUPPLIER PRIVATE LIMITED 1/1/1982 21 U26999UP1982PLC005517 PREMIER VINYL FLOORING LIMITED. -
Vkocl" the Politics and Anti-Politics of Shelter Policy in Chennai, India
The Politics and Anti-Politics of Shelter Policy in Chennai, India By MASSACHUS-TS INSi E OF TECHNOLOGY Nithya V. Raman SEP 059 2008 A.B. Social Studies Harvard University, 2002 LIBRARIES SUBMITTED TO THE DEPARTMENT OF URBAN STUDIES AND PLANNING IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF MASTER IN CITY PLANNING AT THE MASSACHUSETTS INSTITUTE OF TECHNOLOGY SEPTEMBER 2008 C 2008 Nithya V. Raman. All Rights Reserved. The author hereby grants to MIT the permission to reproduce and to distribute publicly paper and electronic copies of the thesis document in whole or in part in any medium now known or hereafter created. Author Department of trban Studies and Planning - cAugust 12, 2008) Certified by Prof4 ssor Balakrishnan Rajagopal Department of Urban Studies and Planning Thesis Supervisor Accepted by Professor Souza Briggs C [ir, MCP Committee Department of Urbanr tudies and Planning vkocl" The Politics and Anti-Politics of Shelter Policy in Chennai, India By Nithya V. Raman Submitted to the Department of Urban Studies and Planning on August 18, 2008 In Partial Fulfillment of the Requirements for the Degree of Master in City Planning ABSTRACT Many scholars argue that global forces, such as increased economic integration into the global economy or interventions from international aid agencies, are directly affecting the governance of municipalities. This paper explores the process by which international influences affect local governance by using the history of a single institution, the Tamil Nadu Slum Clearance Board in Chennai, India, and examining the evolution of the Board's policies towards slums and slum clearance from 1970 to the present. -
1) Mana Desam ( Category/Genre = Social ) (Date: 24.11.1949 )
1) Mana Desam ( Category/Genre = Social ) (Date: 24.11.1949 ) 2) Shavukaru ( Category/Genre = Social ) (Date: 07.04.1950 ) 3) Palleturi Pilla ( Category/Genre = Social ) (Date: 27.04.1950 ) 4) Maya Rambha ( Category/Genre = Mythological ) (Date: 15.09.1950 ) 5) Samsaram ( Category/Genre = Social ) (Date: 29.12.1950 ) 6) Pathala Bhairavi ( Category/Genre = Classical ) (Date: 15.03.1951 ) 7) Mallishwari ( Category/Genre = Historical ) (Date: 20.12.1951 ) 8) Pelli Chesi Choodu ( Category/Genre = Social ) (Date: 29.02.1952 ) 9) Daasi ( Category/Genre = Social ) (Date: 1952 ) 10) Palleturu ( Category/Genre = Social ) (Date: 1952 ) 11) Ammalakkalu ( Category/Genre = Social ) (Date: 12.03.1953 ) 12) Pitchi Pulliah ( Category/Genre = Social ) (Date: 17.07.1953 ) 13) Chandi Rani ( Category/Genre = Classical ) (Date: 28.08.1953 ) 14) Chandraharam ( Category/Genre = Classical ) (Date: 06.01.1954 ) 15) Vaddante Dabbu ( Category/Genre = Social ) (Date: 19.02.1954 ) 16) Thodu Dongalu ( Category/Genre = Social ) (Date: 15.04.1954 ) 17) Rechukka ( Category/Genre = Classical ) (Date: 23.05.1954 ) 18) Raju Peda ( Category/Genre = Classical ) (Date: 25.06.1954 ) 19) Sangam ( Category/Genre = Social ) (Date: 10.07.1954 ) 20) Aggiramudu ( Category/Genre = Social ) (Date: 05.08.1954 ) 21) Parivarthana ( Category/Genre = Social ) (Date: 01.09.1954 ) 22) Iddaru Pellalu ( Category/Genre = Social ) (Date: 06.10.1954 ) 23) Missamma ( Category/Genre = Social ) (Date: 12.01.1955 ) 24) Vijaya Gowri ( Category/Genre = Classical ) (Date: 30.06.1955 ) 25) Cherapakura -
ANNEXURE 5.8 (CHAPTER V , PARA 25) FORM 9 List of Applications For
ANNEXURE 5.8 (CHAPTER V , PARA 25) FORM 9 List of Applications for inclusion received in Form 6 Designated location identity (where Constituency (Assembly/£Parliamentary): Karur Revision identity applications have been received) 1. List number@ 2. Period of applications (covered in this list) From date To date 16/11/2020 16/11/2020 3. Place of hearing * Serial number$ Date of receipt Name of claimant Name of Place of residence Date of Time of of application Father/Mother/ hearing* hearing* Husband and (Relationship)# 1 16/11/2020 GOBINATHAN Samidurai R (F) 117, kamachiyamman kovil street, vangal., kuppichipalayam, , 2 16/11/2020 Ramya Periyasamy (H) 6/90, Magalir Nagar, Manmangalam, , 3 16/11/2020 MALAR RAJIV GANDHI (H) 573, SIVASAKTHI NAGAR IIND CROSS, ATHUR, , 4 16/11/2020 SHERLIN rajasingh charles (F) 108, sivalingasassariyar, CHRISTOBEL vengamedu, , 5 16/11/2020 Kavitha Kathiravan (H) 6, LGB Kandasamy store, Chinna kulathupalayam, , 6 16/11/2020 GANESH JAYADEVAN (F) NO 84, K V B NAGAR MAIN ROAD , VAIYAPURI NAGAR, , 7 16/11/2020 SUGANTHI GANESH (H) NO 84, K V B NAGAR MAIN ROAD , VAIYAPURI NAGAR, , 8 16/11/2020 Srimathi Sridhar Aparajith (H) 3/2, Hanumanthrayan Kovil Street, Karur, , 9 16/11/2020 saran saran rathinam rathinam (F) 40 anna nagar, gandhigramam, thanthoni, , 10 16/11/2020 KARTHIKEYAN VELAMMAL 35 B , J J NAGAR, ASHOK THIYAGARAJAN THIYAGARAJAN (M) NAGAR EAST, THANTHONDRIMALAI, , 11 16/11/2020 VELAMMAL KARTHIKA 35 B, J J NAGAR, WARD 47 THIYAGARAJAN KARTHIKEYAN (O) ASHOK NAGAR EAST, THANTHONDRIMALAI, , 12 16/11/2020 KARTHIKA -
MGR Smallest PDF Copy
MAKKAL THILAGAM 18. Ondre Kulamendru M.G.RAMACHANDRAN Artistes: K.J. Yesudas & Chorus Film: Pallaandu Vaazhga 01. Moondrezhuthil En 19. Naalai Ulagai Artiste: T.M. Soundararajan Artistes: M.S. Viswanathan & Film: Deivathaai K.J. Yesudas 02. Odi Odi Uzhaikkanum Film: Uzhaikkum Karangal Artiste: T.M. Soundararajan 20. Maaradhaiya Maaradhu Film: Nalla Neram Artiste: T.M. Soundararajan 03. Achcham Enbathu Film: Kudumba Thalaivan Artiste: T.M. Soundararajan 21. Vellipanatthukkum Film: Mannadhi Mannan Artiste: P.B. Sreenivas 04. Atho Andha Paravai Film: Sabaash Mapillai Artistes: T.M. Soundararajan & Chorus 22. Nenjam Undu Film: Aayirathil Oruvan Artiste: T.M. Soundararajan 05. Chinnappayalae Film: En Annan Artiste: T.M. Soundararajan 23. Ondru Engal Jaadhiyae Film: Arasilangkumari Artistes: T.M. Soundararajan & 06. Puthiya Vaanam L.R. Eswari Artiste: T.M. Soundararajan Film: Panakkara Kudumbam Film: Anbe Vaa 24. Naadu Athai Naadu 07. Oru Thaai Makkal Artistes: T.M. Soundararajan & Artistes: T.M. Soundararajan & Chorus P. Susheela Film: Ananda jyothi Film: Nadodi 08. Ulagam Engum 25. Pudhiyadhor Ulagam Seivom Artistes: T.M. Soundararajan & Artistes: Dr. Seerkazhi P. Susheela S. Govindarajan & Chorus Film: Nadodi Film: Chandrodhayam 09. Naalai Namathe 26. Uzhaikkum Kaigale Artistes: T.M. Soundararajan & Artiste: T.M. Soundararajan S.P. Balasubrahmanyam Film: Thanippiravi Film: Naalai Namathe 27. Naan Anaiyittaal 10. Naan Yaen Piranthen Artiste: T.M. Soundararajan Artiste: T.M. Soundararajan Film: Enga Veettu Pillai Film: Naan Yaen Piranthen 28. Velga Naadu 11. Vetri Meethu Vetri Vandhu Artistes: C.S. Jayaraman & Chorus Artiste: S.P. Balasubrahmanyam Film: Kanchi Thalaivan Film: Thedi Vandha Maappillai 29. Thambikku Oru Pattu 12. Namadhu Vetriyai Naalai Artiste: T.M. Soundararajan Artistes: Dr. -
Sivaji Ganesan List of Movies
1 / 4 Sivaji Ganesan List Of Movies Here you will find the full list of movies on which Sivaji Ganesan has worked, in reverse chronological order. You can also view the filmography by the role played .... Kollywood movie actor Sivaji Ganesan Facts, born date, details on Movies, Awards and ... Other names of Sivaji Ganesan: Vettaithidal Chinnaiahpillai Ganesan, Nadigar Thilagam ... Vasantha Maligai Rerelease Theaters List In Chennai!. Sivaji Ganesan latest super hit movies list, blockbuster movies, average movies, ... Padayappa; Rajinikanth, Sivaji Ganesan, Soundarya (Actress); Tamil; 10 Apr, 1999 ... Vasantha Maligai; Sivaji Ganesan, Vanisri, K. Balaji; Tamil; 16 Mar, 1973 ... Karnan; Sivaji Ganesan, N. T. Rama Rao, S. A. Asokan; Tamil; 14 Jan, 1964.. The list of film stars who had to bite the dust in politics is so long - Vennira adai Nirmala, Karthik Muthuraman, S V Sekar, Sivaji Ganesan, Sarath Kumar, .... After a brief respiratory problems, Sivaji Ganesan, breathed his last on Juy 21, 2001 ... /tamil/movie- reviews/vasantha-maligai/movie-review/18870236.cms, ... Sivaji Ganesan Filmography with photographs Sivaji's filmography with ... Mozhi in Tamil", "Movie Milestone: 20 years of Rajinikanth's Padayappa", .... Shivaji Ganesan movies list. ... Muthal Mariyathai (1985)Shivaji Ganesan, Radha, Satyaraj. Nermai (1985)Shivaji Ganesan, ... Vasantha Maligai (1972)Shivaji Ganesan, Nagesh ... Karnan (1963)Nandamuri Taraka Rama Rao, Shivaji Ganesan.. Filmography — Filmography[edit] · Parasakthi (1952) Ganesan's first film · Thirumbi Paar (1953) · Manohara (1954) · Kalvanin Kadhali (1955) · Naan .... The father-in-law of Malayalam superstar, Mohanlal, Balaji has the distinction of producing the maximum number of Sivaji films and acting as Sivaji's brother in ... 2 comments: · 1.