DOCSLIB.ORG

Supplementary Table 1

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text

Load more

Supplementary Table 1. List of genes that encode proteins contianing cell surface epitopes and are represented on Agilent human 1A V2 microarray chip (2,177 genes) Agilent Probe ID Gene Symbol GenBank ID UniGene ID A_23_P103803 FCRH3 AF459027 Hs.292449 A_23_P104811 TREH AB000824 Hs.129712 A_23_P105100 IFITM2 X57351 Hs.174195 A_23_P107036 C17orf35 X51804 Hs.514009 A_23_P110736 C9 BC020721 Hs.1290 A_23_P111826 SPAM1 NM_003117 Hs.121494 A_23_P119533 EFNA2 AJ007292 No-Data A_23_P120105 KCNS3 BC004987 Hs.414489 A_23_P128195 HEM1 NM_005337 Hs.182014 A_23_P129332 PKD1L2 BC014157 Hs.413525 A_23_P130203 SYNGR2 AJ002308 Hs.464210 A_23_P132700 TDGF1 X14253 Hs.385870 A_23_P1331 COL13A1 NM_005203 Hs.211933 A_23_P138125 TOSO BC006401 Hs.58831 A_23_P142830 PLA2R1 U17033 Hs.410477 A_23_P146506 GOLPH2 AF236056 Hs.494337 A_23_P149569 MG29 No-Data No-Data A_23_P150590 SLC22A9 NM_080866 Hs.502772 A_23_P151166 MGC15619 BC009731 Hs.334637 A_23_P152620 TNFSF13 NM_172089 Hs.54673 A_23_P153986 KCNJ3 U39196 No-Data A_23_P154855 KCNE1 NM_000219 Hs.121495 A_23_P157380 KCTD7 AK056631 Hs.520914 A_23_P157428 SLC10A5 AK095808 Hs.531449 A_23_P160159 SLC2A5 BC001820 Hs.530003 A_23_P162162 KCTD14 NM_023930 Hs.17296 A_23_P162668 CPM BC022276 Hs.334873 A_23_P164341 VAMP2 AL050223 Hs.25348 A_23_P165394 SLC30A6 NM_017964 Hs.552598 A_23_P167276 PAQR3 AK055774 Hs.368305 A_23_P170636 KCNH8 AY053503 Hs.475656 A_23_P170736 MMP17 NM_016155 Hs.159581 A_23_P170959 LMLN NM_033029 Hs.518540 A_23_P19042 GABRB2 NM_021911 Hs.87083 A_23_P200361 CLCN6 X83378 Hs.193043 A_23_P200710 PIK3C2B Y11312 Hs.497487 A_23_P201544 NTNG1 NM_014917 Hs.211236 A_23_P202138 SFXN3 NM_030971 Hs.283844 A_23_P203713 NEU3 Y18563 Hs.191074 A_23_P203807 SLC26A10 AL050358 No-Data A_23_P203870 RDH5 NM_002905 Hs.172914 A_23_P206336 KCNG4 AF348984 Hs.335877 A_23_P206396 CKLF AF135380 Hs.15159 A_23_P207639 ATP2A3 NM_174953 Hs.513870 A_23_P208416 SLC35E1 AK027699 Hs.134074 A_23_P208517 LENG4 NM_024298 Hs.467279 A_23_P211680 MLC1 D25217 Hs.517729 A_23_P212568 TCRIM BC025713 Hs.138701 A_23_P215245 ACHE M55040 Hs.154495 A_23_P22625 SLC9A6 AF030409 Hs.62185 A_23_P252825 SCAP D83782 Hs.531789 A_23_P254801 PLCG1 NM_002660 Hs.268177 A_23_P256642 KCNE1L AJ012743 Hs.522753 A_23_P259071 AREG M30704 Hs.270833 A_23_P259251 KCND2 NM_012281 Hs.21703 A_23_P259442 CPE X51405 Hs.75360 A_23_P313380 UGCG NM_003358 Hs.304249 A_23_P319083 SLC30A2 NM_032513 Hs.143545 A_23_P32847 GRID2 AF009014 Hs.480281 A_23_P340088 PRSS8 NM_002773 Hs.75799 A_23_P342688 KIAA1984 NM_032874 Hs.370555 A_23_P34307 PIGK AF022913 Hs.293653 A_23_P34460 SLC35A3 AB021981 Hs.448979 A_23_P345746 TPTE NM_013315 Hs.122986 A_23_P35055 NPHS2 AJ279254 Hs.412710 A_23_P367628 KIAA0528 NM_014802 Hs.271014 A_23_P397334 PAQR4 NM_152341 Hs.351474 A_23_P39885 DPP4 X60708 Hs.368912 A_23_P407662 KLRA1 NM_006611 Hs.159297 A_23_P42407 HLA-DRB4 NM_021983 Hs.520049 A_23_P46412 SCNN1D AK093239 Hs.512681 A_23_P47282 ST14 BC030532 Hs.504315 A_23_P49546 GRIN2C NM_000835 Hs.436980 A_23_P51217 CLCA1 AF039400 Hs.194659 A_23_P56604 IL1RL2 NM_003854 Hs.469520 A_23_P72737 IFITM1 J04164 Hs.458414 A_23_P74809 MCLC AB052915 Hs.552587 A_23_P75369 TCIRG1 BC032465 Hs.495985 A_23_P77918 HS3ST3B1 NM_006041 Hs.48384 A_23_P78595 R29124_1 NM_033543 Hs.549225 A_23_P82669 GBAS BC030821 Hs.437367 A_23_P83293 CEECAM1 NM_016174 Hs.495230 A_23_P85503 PGLYRP4 NM_020393 Hs.58356 A_23_P86242 SLC30A10 AL359609 Hs.519812 A_23_P86561 DRD1IP AF225903 Hs.148680 A_23_P92042 ITPR1 D26070 Hs.374613 A_23_P93217 SLC22A7 NM_006672 Hs.485438 A_23_P96099 BAIAP1 AB010894 Hs.169441 A_23_P96899 PGLYRP3 AY035376 Hs.348266 A_23_P97242 VMD2L2 AF440757 Hs.302513 A_23_P97283 PAQR6 NM_024897 Hs.235873 A_23_P98369 GRIA4 U16129 Hs.503743 A_23_P99251 LIN7A AF087693 Hs.144333 A_23_P140152 FAM14A AF208232 Hs.94695 A_23_P145715 AOAH BC025698 Hs.488007 A_23_P102551 BENE BC003179 Hs.185055 A_23_P105545 VAMP1 NM_014231 Hs.20021 A_23_P105908 ATP11A BC024154 Hs.508757 A_23_P106042 CKLFSF5 AF479262 Hs.99272 A_23_P112982 DKFZp761H039 BC033587 Hs.4221 A_23_P114275 PGRMC1 Y12711 Hs.90061 A_23_P116890 PRB3 NM_006249 Hs.73031 A_23_P118615 ABCA8 AB020629 Hs.58351 A_23_P12072 KCNC4 NM_004978 Hs.153521 A_23_P120899 CSF2RB M59941 Hs.285401 A_23_P122152 PKD2L2 AF118125 Hs.310431 A_23_P123071 CAV2 NM_001233 Hs.212332 A_23_P123376 LYNX1 AF321824 Hs.158665 A_23_P12423 ATP13A2 NM_022089 Hs.128866 A_23_P124402 HTR3C NM_130770 Hs.352185 A_23_P127760 MS4A12 BC029793 Hs.272789 A_23_P129225 TRPM1 AF071787 Hs.155942 A_23_P13065 ZDHHC13 AK001714 Hs.188569 A_23_P137797 RYR2 X98330 Hs.109514 A_23_P138011 ATP8B2 AB032963 Hs.435700 A_23_P14174 TNFSF13B NM_006573 Hs.525157 A_23_P146908 STX8 AF062077 Hs.431109 A_23_P1473 PRF1 BC047695 Hs.2200 A_23_P151394 TM9SF2 U81006 Hs.130413 A_23_P152047 SCAMP5 BC024700 Hs.374180 A_23_P154379 NAT8 BC012626 Hs.14637 A_23_P155733 KCNIP4 NM_025221 Hs.546445 A_23_P155868 PGRMC2 BC016692 Hs.507910 A_23_P157245 MGC9712 BC026694 Hs.549276 A_23_P160359 EPB41 J03796 Hs.175437 A_23_P162087 C11orf15 AK074677 Hs.501853 A_23_P163216 ATP8B4 NM_024837 Hs.511311 A_23_P163390 CHRNA7 X70297 Hs.511772 A_23_P163759 KCTD5 AK000047 Hs.61960 A_23_P165450 APG9L1 NM_024085 Hs.323363 A_23_P167556 FLJ31951 NM_144726 Hs.349306 A_23_P169077 LY6E U42376 Hs.521903 A_23_P169446 PTGES NM_004878 Hs.146688 A_23_P170280 ATP10D NM_020453 Hs.437241 A_23_P170679 COL4A3 X80031 Hs.471525 A_23_P17083 SLC4A10 AB040457 No-Data A_23_P171132 EDA2R BC034919 Hs.302017 A_23_P19944 CLDN4 BC000671 Hs.520942 A_23_P200653 FLJ23091 NM_024911 Hs.479491 A_23_P202773 KCNK4 AF247042 Hs.97174 A_23_P202939 APLP2 S60099 Hs.370247 A_23_P204702 TEGT BC000916 Hs.35052 A_23_P205188 C13orf11 NM_017905 Hs.317593 A_23_P208957 SCAMP4 NM_079834 Hs.144980 A_23_P210365 C20orf59 NM_022082 Hs.512686 A_23_P210872 TM9SF4 NM_014742 Hs.529360 A_23_P212522 ATP11B AB023173 Hs.478429 A_23_P213825 ATP10B NM_025153 No-Data A_23_P213857 C7 J03507 Hs.78065 A_23_P214402 UNC93A NM_018974 Hs.267749 A_23_P216520 C9orf127 AF149297 No-Data A_23_P218086 TPCN1 NM_017901 Hs.524763 A_23_P218128 IGHM No-Data No-Data A_23_P24444 DHCR7 AF034544 Hs.503134 A_23_P251089 PLP2 L09604 Hs.77422 A_23_P253409 SLC31A1 U83460 Hs.532315 A_23_P253597 LRRC3 AY061857 Hs.326579 A_23_P254363 PRRG1 AF009242 Hs.190341 A_23_P256405 ATP13A4 AK096510 Hs.450092 A_23_P258433 ACCN5 AJ252011 Hs.381349 A_23_P26201 HCN4 AJ132429 Hs.225671 A_23_P26294 TPSG1 AF175522 Hs.530861 A_23_P2793 ALOX5AP BC018538 Hs.507658 A_23_P30554 KCNIP1 BC035032 Hs.484111 A_23_P31218 C7orf13 AF439977 Hs.124854 A_23_P31460 STEAP BC011802 Hs.61635 A_23_P316960 GRINA No-Data No-Data A_23_P3171 KCNK13 BC012779 Hs.510191 A_23_P319423 KCNK5 NM_003740 Hs.444448 A_23_P324340 DISP2 NM_033510 Hs.355645 A_23_P324554 TMEM16D NM_178826 Hs.58785 A_23_P326204 MGC26963 NM_152621 Hs.48343 A_23_P334192 FLJ90709 NM_173514 Hs.128696 A_23_P334727 NRG4 NM_138573 Hs.238914 A_23_P334758 STRC NM_153700 Hs.550553 A_23_P33759 DHRS3 BC002730 Hs.289347 A_23_P337726 ATP13A5 NM_173703 No-Data A_23_P34827 HCN3 AB040968 Hs.284171 A_23_P34859 LOC284723 AL832282 Hs.116113 A_23_P351667 ADAM23 NM_003812 Hs.370287 A_23_P357724 KCNK3 NM_002246 Hs.24040 A_23_P368624 CHRNB2 NM_000748 Hs.2306 A_23_P391980 CKLFSF4 NM_178818 Hs.325825 A_23_P39481 ABCA7 AF328787 Hs.134514 A_23_P396800 NEGR1 NM_173808 Hs.146542 A_23_P403542 PITPNM2 NM_020845 Hs.272759 A_23_P403991 TRPM8 NM_024080 Hs.366053 A_23_P40880 CKLFSF8 AF474370 Hs.154986 A_23_P416666 CX62 NM_032602 Hs.334499 A_23_P417974 AQP11 NM_173039 Hs.503345 A_23_P432056 RTN4RL1 NM_178568 Hs.22917 A_23_P45099 HLA-DRB5 BC009234 Hs.534322 A_23_P46690 LOC388730 No-Data No-Data A_23_P50591 KCNK6 AF117708 Hs.240395 A_23_P5165 ATP13A1 AK056420 Hs.501794 A_23_P56369 ABCA12 NM_173076 Hs.134585 A_23_P56488 FLJ39822 NM_173512 Hs.293185 A_23_P56820 FLJ39502 No-Data No-Data A_23_P57736 CKLFSF6 AF479261 No-Data A_23_P59870 GJE1 AF503615 Hs.367980 A_23_P6066 CPXM AK027661 Hs.532685 A_23_P61956 C7orf32 AK094602 Hs.351612 A_23_P63083 ASH1L NM_018489 Hs.491060 A_23_P64419 LOC387601 AK091990 Hs.332119 A_23_P64560 FRAG1 NM_014489 Hs.133968 A_23_P65659 ATP10A AB051358 Hs.128041 A_23_P65963 BFAR BC003054 Hs.435556 A_23_P65967 FLJ10815 AK001677 Hs.10499 A_23_P66177 CACNG3 AK095553 Hs.7235 A_23_P66306 ALG1 BC031095 Hs.406461 A_23_P66497 CACNG5 AF361351 Hs.278907 A_23_P67555 APBA3 AB021638 Hs.465607 A_23_P68662 ADRM1 BC017245 Hs.90107 A_23_P69844 SLC35A4 BC009906 Hs.406840 A_23_P72157 FLJ22269 NM_032219 Hs.334789 A_23_P75033 C10orf74 AK056193 Hs.416090 A_23_P77899 CACNG4 BC034532 Hs.514423 A_23_P7791 OGFRL1 NM_024576 Hs.549195 A_23_P77913 FLJ31196 BC035288 Hs.126830 A_23_P78867 RYR1 NM_000540 Hs.466664 A_23_P78873 KCTD15 NM_024076 Hs.221873 A_23_P79108 ATP8B3 BC035162 Hs.306212 A_23_P7932 TREML2 NM_024807 Hs.164797 A_23_P84000 CACNG2 NM_006078 Hs.197693 A_23_P85765 CACNA1S NM_000069 Hs.1294 A_23_P85800 CD52 BC000644 Hs.276770 A_23_P86682 FER1L3 NM_133337 Hs.500572 A_23_P86874 KCNK7 NM_033347 Hs.175218 A_23_P86931 SLC37A2 AK074207 Hs.352661 A_23_P87279 TRPM5 NM_014555 Hs.272287 A_23_P87982 ATP12A NM_001676 Hs.147111 A_23_P88411 SEL1L AF052059 Hs.181300 A_23_P88489 CATSPER2 NM_172095 Hs.389181 A_23_P88865 CKLFSF3 AK056324 Hs.298198 A_23_P89302 CACNG1 L07738 Hs.147989 A_23_P90510 C19orf32 BC008201 Hs.76277 A_23_P91293 VAPB AF086628 Hs.182625 A_23_P94838 RYR3 NM_001036 Hs.549061 A_23_P96209 C8orf20 BC013048 Hs.289063 A_23_P96383 SRPX NM_006307 Hs.15154 A_23_P98037 SMBP NM_020123 Hs.500674 A_23_P145664 EPO X02157 Hs.2303 A_23_P150684 OR51F1 AF546569 No-Data A_23_P150960 MGC13168 NM_032735 Hs.412421 A_23_P162083 OR4C46 AB065546 No-Data A_23_P163173 LTB4R2 AB008193 No-Data A_23_P251906 LOC143458
Recommended publications
  • OR12D2 (Y-13): Sc-109987

    OR12D2 (Y-13): Sc-109987

    SAN TA C RUZ BI OTEC HNOL OG Y, INC . OR12D2 (Y-13): sc-109987 BACKGROUND PRODUCT Olfactory receptors interact with odorant molecules in the nose to initiate a Each vial contains 200 µg IgG in 1.0 ml of PBS with < 0.1% sodium azide neuronal response that leads to the perception of smell. While they share a and 0.1% gelatin. seven transmembrane domain structure with many neurotransmitter and hor - Blocking peptide available for competition studies, sc-109987 P, (100 µg mone receptors, olfactory receptors are responsible for the recognition and peptide in 0.5 ml PBS containing < 0.1% sodium azide and 0.2% BSA). transduction of odorant signals. The olfactory receptor gene family is the larg- est in the genome. OR12D2 (olfactory receptor 12D2), also known as OR6-28 APPLICATIONS or Hs6M1-20, is a 307 amino acid multi-pass membrane protein that belongs to the G-protein coupled receptor 1 family. The gene that encodes OR12D2 OR12D2 (Y-13) is recommended for detection of OR12D2 of human origin by consists of nearly 1,000 bases and maps to human chromosome 6p22.1. With Western Blotting (starting dilution 1:200, dilution range 1:100-1:1000), immu- 170 million base pairs, chromosome 6 comprises nearly 6% of the human nofluorescence (starting dilution 1:50, dilution range 1:50-1:500) and solid genome. Deletion of a portion of the q arm of chromosome 6 is associated phase ELISA (starting dilution 1:30, dilution range 1:30-1:3000); non cross- with early onset intestinal cancer, suggesting the presence of a cancer sus - reactive with family member OR12D3.
  • Imm Catalog.Pdf

    Imm Catalog.Pdf

    $ Gene Symbol A B 3 C 4 D 9 E 10 F 11 G 12 H 13 I 14 J. K 17 L 18 M 19 N 20 O. P 22 R 26 S 27 T 30 U 32 V. W. X. Y. Z 33 A ® ® Gene Symbol Gene ID Antibody Monoclonal Antibody Polyclonal MaxPab Full-length Protein Partial-length Protein Antibody Pair KIt siRNA/Chimera Gene Symbol Gene ID Antibody Monoclonal Antibody Polyclonal MaxPab Full-length Protein Partial-length Protein Antibody Pair KIt siRNA/Chimera A1CF 29974 ● ● ADAMTS13 11093 ● ● ● ● ● A2M 2 ● ● ● ● ● ● ADAMTS20 80070 ● AACS 65985 ● ● ● ADAMTS5 11096 ● ● ● AANAT 15 ● ● ADAMTS8 11095 ● ● ● ● AATF 26574 ● ● ● ● ● ADAMTSL2 9719 ● AATK 9625 ● ● ● ● ADAMTSL4 54507 ● ● ABCA1 19 ● ● ● ● ● ADAR 103 ● ● ABCA5 23461 ● ● ADARB1 104 ● ● ● ● ABCA7 10347 ● ADARB2 105 ● ABCB9 23457 ● ● ● ● ● ADAT1 23536 ● ● ABCC4 10257 ● ● ● ● ADAT2 134637 ● ● ABCC5 10057 ● ● ● ● ● ADAT3 113179 ● ● ● ABCC8 6833 ● ● ● ● ADCY10 55811 ● ● ABCD2 225 ● ADD1 118 ● ● ● ● ● ● ABCD4 5826 ● ● ● ADD3 120 ● ● ● ABCG1 9619 ● ● ● ● ● ADH5 128 ● ● ● ● ● ● ABL1 25 ● ● ADIPOQ 9370 ● ● ● ● ● ABL2 27 ● ● ● ● ● ADK 132 ● ● ● ● ● ABO 28 ● ● ADM 133 ● ● ● ABP1 26 ● ● ● ● ● ADNP 23394 ● ● ● ● ABR 29 ● ● ● ● ● ADORA1 134 ● ● ACAA2 10449 ● ● ● ● ADORA2A 135 ● ● ● ● ● ● ● ACAN 176 ● ● ● ● ● ● ADORA2B 136 ● ● ACE 1636 ● ● ● ● ADRA1A 148 ● ● ● ● ACE2 59272 ● ● ADRA1B 147 ● ● ACER2 340485 ● ADRA2A 150 ● ● ACHE 43 ● ● ● ● ● ● ADRB1 153 ● ● ACIN1 22985 ● ● ● ADRB2 154 ● ● ● ● ● ACOX1 51 ● ● ● ● ● ADRB3 155 ● ● ● ● ACP5 54 ● ● ● ● ● ● ● ADRBK1 156 ● ● ● ● ACSF2 80221 ● ● ADRM1 11047 ● ● ● ● ACSF3 197322 ● ● AEBP1 165 ● ● ● ● ACSL4 2182 ●
  • Genetic Variation Across the Human Olfactory Receptor Repertoire Alters Odor Perception

    Genetic Variation Across the Human Olfactory Receptor Repertoire Alters Odor Perception

    bioRxiv preprint doi: https://doi.org/10.1101/212431; this version posted November 1, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Genetic variation across the human olfactory receptor repertoire alters odor perception Casey Trimmer1,*, Andreas Keller2, Nicolle R. Murphy1, Lindsey L. Snyder1, Jason R. Willer3, Maira Nagai4,5, Nicholas Katsanis3, Leslie B. Vosshall2,6,7, Hiroaki Matsunami4,8, and Joel D. Mainland1,9 1Monell Chemical Senses Center, Philadelphia, Pennsylvania, USA 2Laboratory of Neurogenetics and Behavior, The Rockefeller University, New York, New York, USA 3Center for Human Disease Modeling, Duke University Medical Center, Durham, North Carolina, USA 4Department of Molecular Genetics and Microbiology, Duke University Medical Center, Durham, North Carolina, USA 5Department of Biochemistry, University of Sao Paulo, Sao Paulo, Brazil 6Howard Hughes Medical Institute, New York, New York, USA 7Kavli Neural Systems Institute, New York, New York, USA 8Department of Neurobiology and Duke Institute for Brain Sciences, Duke University Medical Center, Durham, North Carolina, USA 9Department of Neuroscience, University of Pennsylvania School of Medicine, Philadelphia, Pennsylvania, USA *[email protected] ABSTRACT The human olfactory receptor repertoire is characterized by an abundance of genetic variation that affects receptor response, but the perceptual effects of this variation are unclear. To address this issue, we sequenced the OR repertoire in 332 individuals and examined the relationship between genetic variation and 276 olfactory phenotypes, including the perceived intensity and pleasantness of 68 odorants at two concentrations, detection thresholds of three odorants, and general olfactory acuity.
  • Datasheet Blank Template

    Datasheet Blank Template

    SAN TA C RUZ BI OTEC HNOL OG Y, INC . LRP3 (E-13): sc-109956 BACKGROUND APPLICATIONS Members of the LDL receptor gene family, including LDLR (low density lipo- LRP3 (E-13) is recommended for detection of All LRP3 isoforms 1-3 of mouse, protein receptor), LRP1 (low density lipoprotein related protein), Megalin rat and human origin by Western Blotting (starting dilution 1:200, dilution (also designated GP330), VLDLR (very low density lipoprotein receptor) and range 1:100-1:1000), immunofluorescence (starting dilution 1:50, dilution ApoER2 are characterized by a cluster of cysteine-rich class A repeats, epi - range 1:50-1:500) and solid phase ELISA (starting dilution 1:30, dilution dermal growth factor (EGF)-like repeats, YWTD repeats and an O-linked sugar range 1:30-1:3000); non cross-reactive with other LRP family members. domain. Low-density lipoprotein receptor-related protein 3 (LRP3) is a 770 LRP3 (E-13) is also recommended for detection of All LRP3 isoforms 1-3 in amino acid protein that contains two CUB domains and four LDL-receptor additional species, including equine, canine, bovine and porcine. class A domains. LRP3 is widely expressed with highest expression in skele - tal muscle and ovary and lowest expression in testis, colon and leukocytes. Suitable for use as control antibody for LRP3 siRNA (h): sc-97441, LRP3 LRP3 is potentially a membrane receptor involved in the internalization of siRNA (m): sc-149048, LRP3 shRNA Plasmid (h): sc-97441-SH, LRP3 shRNA lipophilic molecules and/or signal transduction. Plasmid (m): sc-149048-SH, LRP3 shRNA (h) Lentiviral Particles: sc-97441-V and LRP3 shRNA (m) Lentiviral Particles: sc-149048-V.
  • Genome-Wide Prediction of Small Molecule Binding to Remote

    Genome-Wide Prediction of Small Molecule Binding to Remote

    bioRxiv preprint doi: https://doi.org/10.1101/2020.08.04.236729; this version posted August 5, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 Genome-wide Prediction of Small Molecule Binding 2 to Remote Orphan Proteins Using Distilled Sequence 3 Alignment Embedding 1 2 3 4 4 Tian Cai , Hansaim Lim , Kyra Alyssa Abbu , Yue Qiu , 5,6 1,2,3,4,7,* 5 Ruth Nussinov , and Lei Xie 1 6 Ph.D. Program in Computer Science, The Graduate Center, The City University of New York, New York, 10016, USA 2 7 Ph.D. Program in Biochemistry, The Graduate Center, The City University of New York, New York, 10016, USA 3 8 Department of Computer Science, Hunter College, The City University of New York, New York, 10065, USA 4 9 Ph.D. Program in Biology, The Graduate Center, The City University of New York, New York, 10016, USA 5 10 Computational Structural Biology Section, Basic Science Program, Frederick National Laboratory for Cancer Research, 11 Frederick, MD 21702, USA 6 12 Department of Human Molecular Genetics and Biochemistry, Sackler School of Medicine, Tel Aviv University, Tel 13 Aviv, Israel 7 14 Helen and Robert Appel Alzheimer’s Disease Research Institute, Feil Family Brain & Mind Research Institute, Weill 15 Cornell Medicine, Cornell University, New York, 10021, USA * 16 [email protected] 17 July 27, 2020 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.08.04.236729; this version posted August 5, 2020.
  • Edinburgh Research Explorer

    Edinburgh Research Explorer

    Edinburgh Research Explorer International Union of Basic and Clinical Pharmacology. LXXXVIII. G protein-coupled receptor list Citation for published version: Davenport, AP, Alexander, SPH, Sharman, JL, Pawson, AJ, Benson, HE, Monaghan, AE, Liew, WC, Mpamhanga, CP, Bonner, TI, Neubig, RR, Pin, JP, Spedding, M & Harmar, AJ 2013, 'International Union of Basic and Clinical Pharmacology. LXXXVIII. G protein-coupled receptor list: recommendations for new pairings with cognate ligands', Pharmacological reviews, vol. 65, no. 3, pp. 967-86. https://doi.org/10.1124/pr.112.007179 Digital Object Identifier (DOI): 10.1124/pr.112.007179 Link: Link to publication record in Edinburgh Research Explorer Document Version: Publisher's PDF, also known as Version of record Published In: Pharmacological reviews Publisher Rights Statement: U.S. Government work not protected by U.S. copyright General rights Copyright for the publications made accessible via the Edinburgh Research Explorer is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The University of Edinburgh has made every reasonable effort to ensure that Edinburgh Research Explorer content complies with UK legislation. If you believe that the public display of this file breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim. Download date: 02. Oct. 2021 1521-0081/65/3/967–986$25.00 http://dx.doi.org/10.1124/pr.112.007179 PHARMACOLOGICAL REVIEWS Pharmacol Rev 65:967–986, July 2013 U.S.
  • OR2G2 (Human) Recombinant Protein (P01)

    OR2G2 (Human) Recombinant Protein (P01)

    Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic OR2G2 (Human) Recombinant Gene Summary: Olfactory receptors interact with Protein (P01) odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The Catalog Number: H00081470-P01 olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from Regulation Status: For research use only (RUO) single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many Product Description: Human OR2G2 full-length ORF ( neurotransmitter and hormone receptors and are NP_001001915.1, 1 a.a. - 317 a.a.) recombinant protein responsible for the recognition and G protein-mediated with GST-tag at N-terminal. transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The Sequence: nomenclature assigned to the olfactory receptor genes MGMVRHTNESNLAGFILLGFSDYPQLQKVLFVLILILYL
  • Supplementary Figure S4

    Supplementary Figure S4

    18DCIS 18IDC Supplementary FigureS4 22DCIS 22IDC C D B A E (0.77) (0.78) 16DCIS 14DCIS 28DCIS 16IDC 28IDC (0.43) (0.49) 0 ADAMTS12 (p.E1469K) 14IDC ERBB2, LASP1,CDK12( CCNE1 ( NUTM2B SDHC,FCGR2B,PBX1,TPR( CD1D, B4GALT3, BCL9, FLG,NUP21OL,TPM3,TDRD10,RIT1,LMNA,PRCC,NTRK1 0 ADAMTS16 (p.E67K) (0.67) (0.89) (0.54) 0 ARHGEF38 (p.P179Hfs*29) 0 ATG9B (p.P823S) (0.68) (1.0) ARID5B, CCDC6 CCNE1, TSHZ3,CEP89 CREB3L2,TRIM24 BRAF, EGFR (7p11); 0 ABRACL (p.R35H) 0 CATSPER1 (p.P152H) 0 ADAMTS18 (p.Y799C) 19q12 0 CCDC88C (p.X1371_splice) (0) 0 ADRA1A (p.P327L) (10q22.3) 0 CCNF (p.D637N) −4 −2 −4 −2 0 AKAP4 (p.G454A) 0 CDYL (p.Y353Lfs*5) −4 −2 Log2 Ratio Log2 Ratio −4 −2 Log2 Ratio Log2 Ratio 0 2 4 0 2 4 0 ARID2 (p.R1068H) 0 COL27A1 (p.G646E) 0 2 4 0 2 4 2 EDRF1 (p.E521K) 0 ARPP21 (p.P791L) ) 0 DDX11 (p.E78K) 2 GPR101, p.A174V 0 ARPP21 (p.P791T) 0 DMGDH (p.W606C) 5 ANP32B, p.G237S 16IDC (Ploidy:2.01) 16DCIS (Ploidy:2.02) 14IDC (Ploidy:2.01) 14DCIS (Ploidy:2.9) -3 -2 -1 -3 -2 -1 -3 -2 -1 -3 -2 -1 -3 -2 -1 -3 -2 -1 Log Ratio Log Ratio Log Ratio Log Ratio 12DCIS 0 ASPM (p.S222T) Log Ratio Log Ratio 0 FMN2 (p.G941A) 20 1 2 3 2 0 1 2 3 2 ERBB3 (p.D297Y) 2 0 1 2 3 20 1 2 3 0 ATRX (p.L1276I) 20 1 2 3 2 0 1 2 3 0 GALNT18 (p.F92L) 2 MAPK4, p.H147Y 0 GALNTL6 (p.E236K) 5 C11orf1, p.Y53C (10q21.2); 0 ATRX (p.R1401W) PIK3CA, p.H1047R 28IDC (Ploidy:2.0) 28DCIS (Ploidy:2.0) 22IDC (Ploidy:3.7) 22DCIS (Ploidy:4.1) 18IDC (Ploidy:3.9) 18DCIS (Ploidy:2.3) 17q12 0 HCFC1 (p.S2025C) 2 LCMT1 (p.S34A) 0 ATXN7L2 (p.X453_splice) SPEN, p.P677Lfs*13 CBFB 1 2 3 4 5 6 7 8 9 10 11
  • Rabbit Anti-FFAR3/GPR42/FITC Conjugated Antibody-SL16076R

    Rabbit Anti-FFAR3/GPR42/FITC Conjugated Antibody-SL16076R

    SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-FFAR3/GPR42/FITC Conjugated antibody SL16076R-FITC Product Name: Anti-FFAR3/GPR42/FITC Chinese Name: FITC标记的G protein-coupled receptor42抗体 FFA3R; Ffar3; FFAR3_HUMAN; Free fatty acid receptor 3; G protein coupled Alias: receptor 41; G-protein coupled receptor 41; gpcr41; GPR41; gpr42. Organism Species: Rabbit Clonality: Polyclonal React Species: Human, ICC=1:50-200IF=1:50-200 Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 39kDa Form: Lyophilized or Liquid Concentration: 1mg/ml immunogen: KLH conjugated synthetic peptide derived from human FFAR3 Lsotype: IgG Purification: affinitywww.sunlongbiotech.com purified by Protein A Storage Buffer: 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. background: G protein-coupled receptors (GPRs), also known as seven transmembrane receptors, heptahelical receptors or 7TM receptors, comprise a superfamily of proteins that play a Product Detail: role in many different stimulus-response pathways. GPRs translate extracellular signals into intracellular signals (a process called G-protein activation) and they respond to a variety of signaling molecules, such as hormones and neurotransmitters.
  • Technical Note, Appendix: an Analysis of Blood Processing Methods to Prepare Samples for Genechip® Expression Profiling (Pdf, 1

    Technical Note, Appendix: an Analysis of Blood Processing Methods to Prepare Samples for Genechip® Expression Profiling (Pdf, 1

    Appendix 1: Signature genes for different blood cell types. Blood Cell Type Source Probe Set Description Symbol Blood Cell Type Source Probe Set Description Symbol Fraction ID Fraction ID Mono- Lympho- GSK 203547_at CD4 antigen (p55) CD4 Whitney et al. 209813_x_at T cell receptor TRG nuclear cytes gamma locus cells Whitney et al. 209995_s_at T-cell leukemia/ TCL1A Whitney et al. 203104_at colony stimulating CSF1R lymphoma 1A factor 1 receptor, Whitney et al. 210164_at granzyme B GZMB formerly McDonough (granzyme 2, feline sarcoma viral cytotoxic T-lymphocyte- (v-fms) oncogene associated serine homolog esterase 1) Whitney et al. 203290_at major histocompatibility HLA-DQA1 Whitney et al. 210321_at similar to granzyme B CTLA1 complex, class II, (granzyme 2, cytotoxic DQ alpha 1 T-lymphocyte-associated Whitney et al. 203413_at NEL-like 2 (chicken) NELL2 serine esterase 1) Whitney et al. 203828_s_at natural killer cell NK4 (H. sapiens) transcript 4 Whitney et al. 212827_at immunoglobulin heavy IGHM Whitney et al. 203932_at major histocompatibility HLA-DMB constant mu complex, class II, Whitney et al. 212998_x_at major histocompatibility HLA-DQB1 DM beta complex, class II, Whitney et al. 204655_at chemokine (C-C motif) CCL5 DQ beta 1 ligand 5 Whitney et al. 212999_x_at major histocompatibility HLA-DQB Whitney et al. 204661_at CDW52 antigen CDW52 complex, class II, (CAMPATH-1 antigen) DQ beta 1 Whitney et al. 205049_s_at CD79A antigen CD79A Whitney et al. 213193_x_at T cell receptor beta locus TRB (immunoglobulin- Whitney et al. 213425_at Homo sapiens cDNA associated alpha) FLJ11441 fis, clone Whitney et al. 205291_at interleukin 2 receptor, IL2RB HEMBA1001323, beta mRNA sequence Whitney et al.
  • EMR3 (ADGRE3) Hamster Monoclonal Antibody [Clone ID: 3D7] Product Data

    EMR3 (ADGRE3) Hamster Monoclonal Antibody [Clone ID: 3D7] Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for AM01316FC-N EMR3 (ADGRE3) Hamster Monoclonal Antibody [Clone ID: 3D7] Product data: Product Type: Primary Antibodies Clone Name: 3D7 Applications: FC Recommended Dilution: Flow cytometry ( Neat - 1/10): use 10 µl of the suggested working dilution to label 10e6 cells in 100 µl. Reactivity: Human Host: Hamster Isotype: IgG Clonality: Monoclonal Immunogen: ARHO-EMR3-CD97 (EGF1) transfectants. Spleen cells from immunised Armenian hamster were fused with cells of the mouse SP2/0 myeloma cell line. Specificity: This antibody recognises epidermal growth factor (EGF) module-containing mucin-like hormone receptor 3 (EMR3), which is a 56kD member of the EGF-7 transmembrane (TM7) family of adhesion receptors. Formulation: PBS, pH 7.4, containing 0.09% Sodium Azide Label: FITC State: Liquid purified IgG Label: Fluorescein Isothiocyanate Isomer I Concentration: lot specific Purification: Affinity chromatography on Protein G Conjugation: FITC Storage: Store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer. Avoid repeated freezing and thawing. This product is photosensitive and should be protected from light. Stability: Shelf life: one year from despatch. Database Link: Entrez Gene 84658 Human Q9BY15 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 EMR3 (ADGRE3) Hamster Monoclonal Antibody [Clone ID: 3D7] – AM01316FC-N Background: EMR3 is expressed at the cell surface as a heterodimer.
  • Rabbit Anti-OR13C9 Polyclonal Antibody - Middle Region

    Rabbit Anti-OR13C9 Polyclonal Antibody - Middle Region

    Catalog: OM105521 Scan to get more validated information Rabbit anti-OR13C9 polyclonal antibody - middle region Catalog: OM105521 100ug Product profile Product name Rabbit anti-OR13C9 polyclonal antibody - middle region Antibody Type Primary Antibodies Immunogen The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of hum an OR13C9 Key Feature Clonality Polyclonal Isotype IgG Host Species Rabbit Tested Applications WB Species Reactivity Dog Human Concentration 1 mg/ml Purification Affinity purified Target Information Gene Symbol OR13C9 Gene Synonyms OR37L; OR9-13 Gene Full Name Olfactory receptor, family 13, subfamily C, member 9 Gene Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that trigg ers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein- coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transme mbrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family i s the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. Alternative Names OR37L, OR9-13 Alternative Names OR37L, OR9-13 Molecular Weight(MW) 36kDa Sequence 318 amino acids Database Links Entrez Gene 286362 SwissProt ID Q8NGS9 Protein Accession NP_001001956 Application Western blot 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate Application Notes WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher.