Supplementary Table 1
Total Page:16
File Type:pdf, Size:1020Kb
Load more
										Recommended publications
									
								- 
												
												OR12D2 (Y-13): Sc-109987
SAN TA C RUZ BI OTEC HNOL OG Y, INC . OR12D2 (Y-13): sc-109987 BACKGROUND PRODUCT Olfactory receptors interact with odorant molecules in the nose to initiate a Each vial contains 200 µg IgG in 1.0 ml of PBS with < 0.1% sodium azide neuronal response that leads to the perception of smell. While they share a and 0.1% gelatin. seven transmembrane domain structure with many neurotransmitter and hor - Blocking peptide available for competition studies, sc-109987 P, (100 µg mone receptors, olfactory receptors are responsible for the recognition and peptide in 0.5 ml PBS containing < 0.1% sodium azide and 0.2% BSA). transduction of odorant signals. The olfactory receptor gene family is the larg- est in the genome. OR12D2 (olfactory receptor 12D2), also known as OR6-28 APPLICATIONS or Hs6M1-20, is a 307 amino acid multi-pass membrane protein that belongs to the G-protein coupled receptor 1 family. The gene that encodes OR12D2 OR12D2 (Y-13) is recommended for detection of OR12D2 of human origin by consists of nearly 1,000 bases and maps to human chromosome 6p22.1. With Western Blotting (starting dilution 1:200, dilution range 1:100-1:1000), immu- 170 million base pairs, chromosome 6 comprises nearly 6% of the human nofluorescence (starting dilution 1:50, dilution range 1:50-1:500) and solid genome. Deletion of a portion of the q arm of chromosome 6 is associated phase ELISA (starting dilution 1:30, dilution range 1:30-1:3000); non cross- with early onset intestinal cancer, suggesting the presence of a cancer sus - reactive with family member OR12D3. - 
												
												Imm Catalog.Pdf
$ Gene Symbol A B 3 C 4 D 9 E 10 F 11 G 12 H 13 I 14 J. K 17 L 18 M 19 N 20 O. P 22 R 26 S 27 T 30 U 32 V. W. X. Y. Z 33 A ® ® Gene Symbol Gene ID Antibody Monoclonal Antibody Polyclonal MaxPab Full-length Protein Partial-length Protein Antibody Pair KIt siRNA/Chimera Gene Symbol Gene ID Antibody Monoclonal Antibody Polyclonal MaxPab Full-length Protein Partial-length Protein Antibody Pair KIt siRNA/Chimera A1CF 29974 ● ● ADAMTS13 11093 ● ● ● ● ● A2M 2 ● ● ● ● ● ● ADAMTS20 80070 ● AACS 65985 ● ● ● ADAMTS5 11096 ● ● ● AANAT 15 ● ● ADAMTS8 11095 ● ● ● ● AATF 26574 ● ● ● ● ● ADAMTSL2 9719 ● AATK 9625 ● ● ● ● ADAMTSL4 54507 ● ● ABCA1 19 ● ● ● ● ● ADAR 103 ● ● ABCA5 23461 ● ● ADARB1 104 ● ● ● ● ABCA7 10347 ● ADARB2 105 ● ABCB9 23457 ● ● ● ● ● ADAT1 23536 ● ● ABCC4 10257 ● ● ● ● ADAT2 134637 ● ● ABCC5 10057 ● ● ● ● ● ADAT3 113179 ● ● ● ABCC8 6833 ● ● ● ● ADCY10 55811 ● ● ABCD2 225 ● ADD1 118 ● ● ● ● ● ● ABCD4 5826 ● ● ● ADD3 120 ● ● ● ABCG1 9619 ● ● ● ● ● ADH5 128 ● ● ● ● ● ● ABL1 25 ● ● ADIPOQ 9370 ● ● ● ● ● ABL2 27 ● ● ● ● ● ADK 132 ● ● ● ● ● ABO 28 ● ● ADM 133 ● ● ● ABP1 26 ● ● ● ● ● ADNP 23394 ● ● ● ● ABR 29 ● ● ● ● ● ADORA1 134 ● ● ACAA2 10449 ● ● ● ● ADORA2A 135 ● ● ● ● ● ● ● ACAN 176 ● ● ● ● ● ● ADORA2B 136 ● ● ACE 1636 ● ● ● ● ADRA1A 148 ● ● ● ● ACE2 59272 ● ● ADRA1B 147 ● ● ACER2 340485 ● ADRA2A 150 ● ● ACHE 43 ● ● ● ● ● ● ADRB1 153 ● ● ACIN1 22985 ● ● ● ADRB2 154 ● ● ● ● ● ACOX1 51 ● ● ● ● ● ADRB3 155 ● ● ● ● ACP5 54 ● ● ● ● ● ● ● ADRBK1 156 ● ● ● ● ACSF2 80221 ● ● ADRM1 11047 ● ● ● ● ACSF3 197322 ● ● AEBP1 165 ● ● ● ● ACSL4 2182 ● - 
												
												Genetic Variation Across the Human Olfactory Receptor Repertoire Alters Odor Perception
bioRxiv preprint doi: https://doi.org/10.1101/212431; this version posted November 1, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Genetic variation across the human olfactory receptor repertoire alters odor perception Casey Trimmer1,*, Andreas Keller2, Nicolle R. Murphy1, Lindsey L. Snyder1, Jason R. Willer3, Maira Nagai4,5, Nicholas Katsanis3, Leslie B. Vosshall2,6,7, Hiroaki Matsunami4,8, and Joel D. Mainland1,9 1Monell Chemical Senses Center, Philadelphia, Pennsylvania, USA 2Laboratory of Neurogenetics and Behavior, The Rockefeller University, New York, New York, USA 3Center for Human Disease Modeling, Duke University Medical Center, Durham, North Carolina, USA 4Department of Molecular Genetics and Microbiology, Duke University Medical Center, Durham, North Carolina, USA 5Department of Biochemistry, University of Sao Paulo, Sao Paulo, Brazil 6Howard Hughes Medical Institute, New York, New York, USA 7Kavli Neural Systems Institute, New York, New York, USA 8Department of Neurobiology and Duke Institute for Brain Sciences, Duke University Medical Center, Durham, North Carolina, USA 9Department of Neuroscience, University of Pennsylvania School of Medicine, Philadelphia, Pennsylvania, USA *[email protected] ABSTRACT The human olfactory receptor repertoire is characterized by an abundance of genetic variation that affects receptor response, but the perceptual effects of this variation are unclear. To address this issue, we sequenced the OR repertoire in 332 individuals and examined the relationship between genetic variation and 276 olfactory phenotypes, including the perceived intensity and pleasantness of 68 odorants at two concentrations, detection thresholds of three odorants, and general olfactory acuity. - 
												
												Datasheet Blank Template
SAN TA C RUZ BI OTEC HNOL OG Y, INC . LRP3 (E-13): sc-109956 BACKGROUND APPLICATIONS Members of the LDL receptor gene family, including LDLR (low density lipo- LRP3 (E-13) is recommended for detection of All LRP3 isoforms 1-3 of mouse, protein receptor), LRP1 (low density lipoprotein related protein), Megalin rat and human origin by Western Blotting (starting dilution 1:200, dilution (also designated GP330), VLDLR (very low density lipoprotein receptor) and range 1:100-1:1000), immunofluorescence (starting dilution 1:50, dilution ApoER2 are characterized by a cluster of cysteine-rich class A repeats, epi - range 1:50-1:500) and solid phase ELISA (starting dilution 1:30, dilution dermal growth factor (EGF)-like repeats, YWTD repeats and an O-linked sugar range 1:30-1:3000); non cross-reactive with other LRP family members. domain. Low-density lipoprotein receptor-related protein 3 (LRP3) is a 770 LRP3 (E-13) is also recommended for detection of All LRP3 isoforms 1-3 in amino acid protein that contains two CUB domains and four LDL-receptor additional species, including equine, canine, bovine and porcine. class A domains. LRP3 is widely expressed with highest expression in skele - tal muscle and ovary and lowest expression in testis, colon and leukocytes. Suitable for use as control antibody for LRP3 siRNA (h): sc-97441, LRP3 LRP3 is potentially a membrane receptor involved in the internalization of siRNA (m): sc-149048, LRP3 shRNA Plasmid (h): sc-97441-SH, LRP3 shRNA lipophilic molecules and/or signal transduction. Plasmid (m): sc-149048-SH, LRP3 shRNA (h) Lentiviral Particles: sc-97441-V and LRP3 shRNA (m) Lentiviral Particles: sc-149048-V. - 
												
												Genome-Wide Prediction of Small Molecule Binding to Remote
bioRxiv preprint doi: https://doi.org/10.1101/2020.08.04.236729; this version posted August 5, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 Genome-wide Prediction of Small Molecule Binding 2 to Remote Orphan Proteins Using Distilled Sequence 3 Alignment Embedding 1 2 3 4 4 Tian Cai , Hansaim Lim , Kyra Alyssa Abbu , Yue Qiu , 5,6 1,2,3,4,7,* 5 Ruth Nussinov , and Lei Xie 1 6 Ph.D. Program in Computer Science, The Graduate Center, The City University of New York, New York, 10016, USA 2 7 Ph.D. Program in Biochemistry, The Graduate Center, The City University of New York, New York, 10016, USA 3 8 Department of Computer Science, Hunter College, The City University of New York, New York, 10065, USA 4 9 Ph.D. Program in Biology, The Graduate Center, The City University of New York, New York, 10016, USA 5 10 Computational Structural Biology Section, Basic Science Program, Frederick National Laboratory for Cancer Research, 11 Frederick, MD 21702, USA 6 12 Department of Human Molecular Genetics and Biochemistry, Sackler School of Medicine, Tel Aviv University, Tel 13 Aviv, Israel 7 14 Helen and Robert Appel Alzheimer’s Disease Research Institute, Feil Family Brain & Mind Research Institute, Weill 15 Cornell Medicine, Cornell University, New York, 10021, USA * 16 [email protected] 17 July 27, 2020 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.08.04.236729; this version posted August 5, 2020. - 
												
												Edinburgh Research Explorer
Edinburgh Research Explorer International Union of Basic and Clinical Pharmacology. LXXXVIII. G protein-coupled receptor list Citation for published version: Davenport, AP, Alexander, SPH, Sharman, JL, Pawson, AJ, Benson, HE, Monaghan, AE, Liew, WC, Mpamhanga, CP, Bonner, TI, Neubig, RR, Pin, JP, Spedding, M & Harmar, AJ 2013, 'International Union of Basic and Clinical Pharmacology. LXXXVIII. G protein-coupled receptor list: recommendations for new pairings with cognate ligands', Pharmacological reviews, vol. 65, no. 3, pp. 967-86. https://doi.org/10.1124/pr.112.007179 Digital Object Identifier (DOI): 10.1124/pr.112.007179 Link: Link to publication record in Edinburgh Research Explorer Document Version: Publisher's PDF, also known as Version of record Published In: Pharmacological reviews Publisher Rights Statement: U.S. Government work not protected by U.S. copyright General rights Copyright for the publications made accessible via the Edinburgh Research Explorer is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The University of Edinburgh has made every reasonable effort to ensure that Edinburgh Research Explorer content complies with UK legislation. If you believe that the public display of this file breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim. Download date: 02. Oct. 2021 1521-0081/65/3/967–986$25.00 http://dx.doi.org/10.1124/pr.112.007179 PHARMACOLOGICAL REVIEWS Pharmacol Rev 65:967–986, July 2013 U.S. - 
												
												OR2G2 (Human) Recombinant Protein (P01)
Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic OR2G2 (Human) Recombinant Gene Summary: Olfactory receptors interact with Protein (P01) odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The Catalog Number: H00081470-P01 olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from Regulation Status: For research use only (RUO) single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many Product Description: Human OR2G2 full-length ORF ( neurotransmitter and hormone receptors and are NP_001001915.1, 1 a.a. - 317 a.a.) recombinant protein responsible for the recognition and G protein-mediated with GST-tag at N-terminal. transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The Sequence: nomenclature assigned to the olfactory receptor genes MGMVRHTNESNLAGFILLGFSDYPQLQKVLFVLILILYL - 
												
												Supplementary Figure S4
18DCIS 18IDC Supplementary FigureS4 22DCIS 22IDC C D B A E (0.77) (0.78) 16DCIS 14DCIS 28DCIS 16IDC 28IDC (0.43) (0.49) 0 ADAMTS12 (p.E1469K) 14IDC ERBB2, LASP1,CDK12( CCNE1 ( NUTM2B SDHC,FCGR2B,PBX1,TPR( CD1D, B4GALT3, BCL9, FLG,NUP21OL,TPM3,TDRD10,RIT1,LMNA,PRCC,NTRK1 0 ADAMTS16 (p.E67K) (0.67) (0.89) (0.54) 0 ARHGEF38 (p.P179Hfs*29) 0 ATG9B (p.P823S) (0.68) (1.0) ARID5B, CCDC6 CCNE1, TSHZ3,CEP89 CREB3L2,TRIM24 BRAF, EGFR (7p11); 0 ABRACL (p.R35H) 0 CATSPER1 (p.P152H) 0 ADAMTS18 (p.Y799C) 19q12 0 CCDC88C (p.X1371_splice) (0) 0 ADRA1A (p.P327L) (10q22.3) 0 CCNF (p.D637N) −4 −2 −4 −2 0 AKAP4 (p.G454A) 0 CDYL (p.Y353Lfs*5) −4 −2 Log2 Ratio Log2 Ratio −4 −2 Log2 Ratio Log2 Ratio 0 2 4 0 2 4 0 ARID2 (p.R1068H) 0 COL27A1 (p.G646E) 0 2 4 0 2 4 2 EDRF1 (p.E521K) 0 ARPP21 (p.P791L) ) 0 DDX11 (p.E78K) 2 GPR101, p.A174V 0 ARPP21 (p.P791T) 0 DMGDH (p.W606C) 5 ANP32B, p.G237S 16IDC (Ploidy:2.01) 16DCIS (Ploidy:2.02) 14IDC (Ploidy:2.01) 14DCIS (Ploidy:2.9) -3 -2 -1 -3 -2 -1 -3 -2 -1 -3 -2 -1 -3 -2 -1 -3 -2 -1 Log Ratio Log Ratio Log Ratio Log Ratio 12DCIS 0 ASPM (p.S222T) Log Ratio Log Ratio 0 FMN2 (p.G941A) 20 1 2 3 2 0 1 2 3 2 ERBB3 (p.D297Y) 2 0 1 2 3 20 1 2 3 0 ATRX (p.L1276I) 20 1 2 3 2 0 1 2 3 0 GALNT18 (p.F92L) 2 MAPK4, p.H147Y 0 GALNTL6 (p.E236K) 5 C11orf1, p.Y53C (10q21.2); 0 ATRX (p.R1401W) PIK3CA, p.H1047R 28IDC (Ploidy:2.0) 28DCIS (Ploidy:2.0) 22IDC (Ploidy:3.7) 22DCIS (Ploidy:4.1) 18IDC (Ploidy:3.9) 18DCIS (Ploidy:2.3) 17q12 0 HCFC1 (p.S2025C) 2 LCMT1 (p.S34A) 0 ATXN7L2 (p.X453_splice) SPEN, p.P677Lfs*13 CBFB 1 2 3 4 5 6 7 8 9 10 11 - 
												
												Rabbit Anti-FFAR3/GPR42/FITC Conjugated Antibody-SL16076R
SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-FFAR3/GPR42/FITC Conjugated antibody SL16076R-FITC Product Name: Anti-FFAR3/GPR42/FITC Chinese Name: FITC标记的G protein-coupled receptor42抗体 FFA3R; Ffar3; FFAR3_HUMAN; Free fatty acid receptor 3; G protein coupled Alias: receptor 41; G-protein coupled receptor 41; gpcr41; GPR41; gpr42. Organism Species: Rabbit Clonality: Polyclonal React Species: Human, ICC=1:50-200IF=1:50-200 Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 39kDa Form: Lyophilized or Liquid Concentration: 1mg/ml immunogen: KLH conjugated synthetic peptide derived from human FFAR3 Lsotype: IgG Purification: affinitywww.sunlongbiotech.com purified by Protein A Storage Buffer: 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. background: G protein-coupled receptors (GPRs), also known as seven transmembrane receptors, heptahelical receptors or 7TM receptors, comprise a superfamily of proteins that play a Product Detail: role in many different stimulus-response pathways. GPRs translate extracellular signals into intracellular signals (a process called G-protein activation) and they respond to a variety of signaling molecules, such as hormones and neurotransmitters. - 
												
												Technical Note, Appendix: an Analysis of Blood Processing Methods to Prepare Samples for Genechip® Expression Profiling (Pdf, 1
Appendix 1: Signature genes for different blood cell types. Blood Cell Type Source Probe Set Description Symbol Blood Cell Type Source Probe Set Description Symbol Fraction ID Fraction ID Mono- Lympho- GSK 203547_at CD4 antigen (p55) CD4 Whitney et al. 209813_x_at T cell receptor TRG nuclear cytes gamma locus cells Whitney et al. 209995_s_at T-cell leukemia/ TCL1A Whitney et al. 203104_at colony stimulating CSF1R lymphoma 1A factor 1 receptor, Whitney et al. 210164_at granzyme B GZMB formerly McDonough (granzyme 2, feline sarcoma viral cytotoxic T-lymphocyte- (v-fms) oncogene associated serine homolog esterase 1) Whitney et al. 203290_at major histocompatibility HLA-DQA1 Whitney et al. 210321_at similar to granzyme B CTLA1 complex, class II, (granzyme 2, cytotoxic DQ alpha 1 T-lymphocyte-associated Whitney et al. 203413_at NEL-like 2 (chicken) NELL2 serine esterase 1) Whitney et al. 203828_s_at natural killer cell NK4 (H. sapiens) transcript 4 Whitney et al. 212827_at immunoglobulin heavy IGHM Whitney et al. 203932_at major histocompatibility HLA-DMB constant mu complex, class II, Whitney et al. 212998_x_at major histocompatibility HLA-DQB1 DM beta complex, class II, Whitney et al. 204655_at chemokine (C-C motif) CCL5 DQ beta 1 ligand 5 Whitney et al. 212999_x_at major histocompatibility HLA-DQB Whitney et al. 204661_at CDW52 antigen CDW52 complex, class II, (CAMPATH-1 antigen) DQ beta 1 Whitney et al. 205049_s_at CD79A antigen CD79A Whitney et al. 213193_x_at T cell receptor beta locus TRB (immunoglobulin- Whitney et al. 213425_at Homo sapiens cDNA associated alpha) FLJ11441 fis, clone Whitney et al. 205291_at interleukin 2 receptor, IL2RB HEMBA1001323, beta mRNA sequence Whitney et al. - 
												
												EMR3 (ADGRE3) Hamster Monoclonal Antibody [Clone ID: 3D7] Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for AM01316FC-N EMR3 (ADGRE3) Hamster Monoclonal Antibody [Clone ID: 3D7] Product data: Product Type: Primary Antibodies Clone Name: 3D7 Applications: FC Recommended Dilution: Flow cytometry ( Neat - 1/10): use 10 µl of the suggested working dilution to label 10e6 cells in 100 µl. Reactivity: Human Host: Hamster Isotype: IgG Clonality: Monoclonal Immunogen: ARHO-EMR3-CD97 (EGF1) transfectants. Spleen cells from immunised Armenian hamster were fused with cells of the mouse SP2/0 myeloma cell line. Specificity: This antibody recognises epidermal growth factor (EGF) module-containing mucin-like hormone receptor 3 (EMR3), which is a 56kD member of the EGF-7 transmembrane (TM7) family of adhesion receptors. Formulation: PBS, pH 7.4, containing 0.09% Sodium Azide Label: FITC State: Liquid purified IgG Label: Fluorescein Isothiocyanate Isomer I Concentration: lot specific Purification: Affinity chromatography on Protein G Conjugation: FITC Storage: Store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer. Avoid repeated freezing and thawing. This product is photosensitive and should be protected from light. Stability: Shelf life: one year from despatch. Database Link: Entrez Gene 84658 Human Q9BY15 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 EMR3 (ADGRE3) Hamster Monoclonal Antibody [Clone ID: 3D7] – AM01316FC-N Background: EMR3 is expressed at the cell surface as a heterodimer. - 
												
												Rabbit Anti-OR13C9 Polyclonal Antibody - Middle Region
Catalog: OM105521 Scan to get more validated information Rabbit anti-OR13C9 polyclonal antibody - middle region Catalog: OM105521 100ug Product profile Product name Rabbit anti-OR13C9 polyclonal antibody - middle region Antibody Type Primary Antibodies Immunogen The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of hum an OR13C9 Key Feature Clonality Polyclonal Isotype IgG Host Species Rabbit Tested Applications WB Species Reactivity Dog Human Concentration 1 mg/ml Purification Affinity purified Target Information Gene Symbol OR13C9 Gene Synonyms OR37L; OR9-13 Gene Full Name Olfactory receptor, family 13, subfamily C, member 9 Gene Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that trigg ers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein- coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transme mbrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family i s the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. Alternative Names OR37L, OR9-13 Alternative Names OR37L, OR9-13 Molecular Weight(MW) 36kDa Sequence 318 amino acids Database Links Entrez Gene 286362 SwissProt ID Q8NGS9 Protein Accession NP_001001956 Application Western blot 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate Application Notes WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher.