Anti-PRPF19 Monoclonal Antibody, Clone 3F6 (DCABH-13061) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-PRPF19 monoclonal antibody, clone 3F6 (DCABH-13061) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]). Immunogen PRPF19 (NP_055317, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human, Mouse, Rat Clone 3F6 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Transfected lysate); Western Blot (Recombinant protein); Immunofluorescence; Sandwich ELISA (Recombinant protein); ELISA Sequence Similarities MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPS ATSIPAILKALQDEWDAVMLHSF Size 1 ea Buffer In 1x PBS, pH 7.4 Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) [ Homo sapiens ] Official Symbol PRPF19 Synonyms PRPF19; PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae); PRP19, 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved PRP19/PSO4 homolog (S. cerevisiae); pre-mRNA-processing factor 19; hPSO4; NMP200; nuclear matrix protein NMP200 related to splicing factor PRP19; PSO4; UBOX4; PRP19/PSO4 homolog; senescence evasion factor; nuclear matrix protein 200; SNEV; PRP19; Entrez Gene ID 27339 Protein Refseq NP_055317 UniProt ID Q9UMS4 Chromosome Location 11q12.2 Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism- specific biosystem; Ubiquitin mediated proteolysis, organism-specific biosystem; Ubiquitin mediated proteolysis, conserved biosystem; Function DNA binding; identical protein binding; protein binding; ubiquitin-protein ligase activity; ubiquitin- ubiquitin ligase activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Genome-Wide Association Study of Copy Number Variations (Cnvs) with Opioid Dependence
Neuropsychopharmacology (2015) 40, 1016–1026 & 2015 American College of Neuropsychopharmacology. All rights reserved 0893-133X/15 www.neuropsychopharmacology.org Genome-Wide Association Study of Copy Number Variations (CNVs) with Opioid Dependence Dawei Li*,1,2,3,4, Hongyu Zhao5,6, Henry R Kranzler7, Ming D Li8, Kevin P Jensen1, Tetyana Zayats1, Lindsay A Farrer9 and Joel Gelernter1,6,10 1 2 Department of Psychiatry, School of Medicine, Yale University, New Haven, CT, USA; Department of Microbiology and Molecular Genetics, University of Vermont, Burlington, VT, USA; 3Department of Computer Science, University of Vermont, Burlington, VT, USA; 4Neuroscience, Behavior, and Health Initiative, University of Vermont, Burlington, VT, USA; 5Department of Biostatistics, Yale School of Public Health, New Haven, 6 7 CT, USA; Department of Genetics, School of Medicine, Yale University, New Haven, CT, USA; Department of Psychiatry, University of 8 Pennsylvania School of Medicine and VISN 4 MIRECC, Philadelphia VAMC, Philadelphia, PA, USA; Department of Psychiatry and 9 Neurobehavioral Sciences, University of Virginia, Charlottesville, VA, USA; Departments of Medicine (Biomedical Genetics), Neurology, Ophthalmology, Genetics and Genomics, Biostatistics, and Epidemiology, Boston University Schools of Medicine and Public Health, Boston, MA, USA; 10VA Connecticut Healthcare Center, Department of Neurobiology, Yale University School of Medicine, New Haven, CT, USA Single-nucleotide polymorphisms that have been associated with opioid dependence (OD) altogether account for only a small proportion of the known heritability. Most of the genetic risk factors are unknown. Some of the ‘missing heritability’ might be explained by copy number variations (CNVs) in the human genome. We used Illumina HumanOmni1 arrays to genotype 5152 African-American and European-American OD cases and screened controls and implemented combined CNV calling methods.
[Show full text]
Original Article CDC5L Contributes to Malignant Cell Proliferation in Human Osteosarcoma Via Cell Cycle Regulation
Int J Clin Exp Pathol 2016;9(10):10451-10457 www.ijcep.com /ISSN:1936-2625/IJCEP0031885 Original Article CDC5L contributes to malignant cell proliferation in human osteosarcoma via cell cycle regulation Yu Wang1,4*, Hong Chang2,4*, Di Gao3,4, Lei Wang4, Nan Jiang4, Bin Yu4 1Department of Orthopaedics, Chifeng Hospital, Inner Mongolia, China; 2Department of Orthopaedics, 421 Hospital of PLA, Guangzhou, China; 3Department of Orthopaedics, The University of Hong Kang, Shenzhen Hospital, Shenzhen, China; 4Department of Orthopaedics and Traumatology, Nanfang Hospital Southern Medical University, Guangzhou, China. *Equal contributors. Received May 9, 2016; Accepted July 22, 2016; Epub October 1, 2016; Published October 15, 2016 Abstract: Cell division cycle 5-like (CDC5L) has been reported in overexpressed in osteosarcoma (OS). However, its biological function in tumor biology was still unclear. Here, we firstly determined the expression of CDC5L in several OS cell lines, including Saos-2, SF-86, U2OS and SW1353, and found it was commonly upregulated in these four OS cells. Subsequently, Saos-2 and U2OS cells with higher CDC5L expression were transfected with interfering RNA tar- geting CDC5L. A set of functional assay was conducted on the two cell lines, including CCK-8, colony formation and flow cytometry assay. Our results indicated that CDC5L silencing significantly inhibited cell proliferation and arrested cell cycle at G2/M phase. Mechanically, Western blot analysis further confirmed knockdown of CDC5L remarkably down regulated the protein levels of CDK1, Cyclin B and PCNA. There findings further demonstrated that CDC5L play a crucial role in OS development and might be a promising therapeutic target of OS.
[Show full text]
Nuclear PTEN Safeguards Pre-Mrna Splicing to Link Golgi Apparatus for Its Tumor Suppressive Role
ARTICLE DOI: 10.1038/s41467-018-04760-1 OPEN Nuclear PTEN safeguards pre-mRNA splicing to link Golgi apparatus for its tumor suppressive role Shao-Ming Shen1, Yan Ji2, Cheng Zhang1, Shuang-Shu Dong2, Shuo Yang1, Zhong Xiong1, Meng-Kai Ge1, Yun Yu1, Li Xia1, Meng Guo1, Jin-Ke Cheng3, Jun-Ling Liu1,3, Jian-Xiu Yu1,3 & Guo-Qiang Chen1 Dysregulation of pre-mRNA alternative splicing (AS) is closely associated with cancers. However, the relationships between the AS and classic oncogenes/tumor suppressors are 1234567890():,; largely unknown. Here we show that the deletion of tumor suppressor PTEN alters pre-mRNA splicing in a phosphatase-independent manner, and identify 262 PTEN-regulated AS events in 293T cells by RNA sequencing, which are associated with significant worse outcome of cancer patients. Based on these findings, we report that nuclear PTEN interacts with the splicing machinery, spliceosome, to regulate its assembly and pre-mRNA splicing. We also identify a new exon 2b in GOLGA2 transcript and the exon exclusion contributes to PTEN knockdown-induced tumorigenesis by promoting dramatic Golgi extension and secretion, and PTEN depletion significantly sensitizes cancer cells to secretion inhibitors brefeldin A and golgicide A. Our results suggest that Golgi secretion inhibitors alone or in combination with PI3K/Akt kinase inhibitors may be therapeutically useful for PTEN-deficient cancers. 1 Department of Pathophysiology, Key Laboratory of Cell Differentiation and Apoptosis of Chinese Ministry of Education, Shanghai Jiao Tong University School of Medicine (SJTU-SM), Shanghai 200025, China. 2 Institute of Health Sciences, Shanghai Institutes for Biological Sciences of Chinese Academy of Sciences and SJTU-SM, Shanghai 200025, China.
[Show full text]
Prp19 Arrests Cell Cycle Via Cdc5l in Hepatocellular Carcinoma Cells
International Journal of Molecular Sciences Article Prp19 Arrests Cell Cycle via Cdc5L in Hepatocellular Carcinoma Cells Renzheng Huang 1, Ruyi Xue 1, Di Qu 2, Jie Yin 1,* and Xi-Zhong Shen 1,2,3,* 1 Department of Gastroenterology, Zhongshan Hospital of Fudan University, Shanghai 200032, China; [email protected] (R.H.); [email protected] (R.X.) 2 Key Laboratory of Medical Molecular Virology, Shanghai Medical College of Fudan University, Shanghai 200032, China; [email protected] 3 Shanghai Institute of Liver Diseases, Zhongshan Hospital of Fudan University, Shanghai 200032, China * Correspondence: [email protected] (J.Y.); [email protected] (X.-Z.S.); Tel.: +86-21-6404-1990 (ext. 2070) (J.Y. & X.-Z.S.); Fax: +86-21-6403-8038 (J.Y. & X.-Z.S.) Academic Editor: Akihiro Tamori Received: 16 January 2017; Accepted: 31 March 2017; Published: 7 April 2017 Abstract: Pre-mRNA processing factor 19 (Prp19) is involved in many cellular events including pre-mRNA processing and DNA damage response. Recently, it has been identiﬁed as a candidate oncogene in hepatocellular carcinoma (HCC). However, the role of Prp19 in tumor biology is still elusive. Here, we reported that Prp19 arrested cell cycle in HCC cells via regulating G2/M transition. Mechanistic insights revealed that silencing Prp19 inhibited the expression of cell division cycle 5-like (Cdc5L) via repressing the translation of Cdc5L mRNA and facilitating lysosome-mediated degradation of Cdc5L in HCC cells. Furthermore, we found that silencing Prp19 induced cell cycle arrest could be partially resumed by overexpressing Cdc5L.
[Show full text]
Frequent Somatic Mutations in Components of the RNA Processing Machinery in Chronic Lymphocytic Leukemia
Letters to the Editor 1600 CONFLICT OF INTEREST 2 Sokol L, Loughran TP Jr. Large granular lymphocyte leukemia. Oncologist 2006; 11: WK, CH, TH and SS are part owners of the MLL Munich Leukemia Laboratory. AF and 263–273. VG are employed by the MLL Munich Leukemia Laboratory. 3 Koskela HL, Eldfors S, Ellonen P, van Adrichem AJ, Kuusanmaki H, Andersson EI et al. Somatic STAT3 mutations in large granular lymphocytic leukemia. N Engl J Med 2012; 366: 1905–1913. ACKNOWLEDGEMENTS 4 Jerez A, Clemente MJ, Makishima H, Koskela H, Leblanc F, Ng KP et al. STAT3 mutations unify the pathogenesis of chronic lymphoproliferative dis- We thank all clinicians for sending samples to our laboratory for diagnostic purposes, orders of NK cells and T cell large granular lymphocyte leukemia. Blood 2012; 120: and for providing clinical information and follow-up data. In addition, we would like 3048–3057. to thank all co-workers at the MLL Munich Leukemia Laboratory for approaching 5 Kern W, Bacher U, Haferlach C, Alpermann T, Dicker F, Schnittger S et al. together many aspects in the ﬁeld of leukemia diagnostics and research. In addition, Frequency and prognostic impact of the aberrant CD8 expression in 5,523 we are grateful for the data management support performed by Tamara Alpermann. patients with chronic lymphocytic leukemia. Cytometry B Clin Cytom 2012; 82: 145–150. A Fasan, W Kern, V Grossmann, C Haferlach, 6 van Dongen JJ, Langerak AW, Bruggemann M, Evans PA, Hummel M, Lavender FL T Haferlach and S Schnittger et al. Design and standardization of PCR primers and protocols for detection of MLL Munich Leukemia Laboratory, Munich, Germany clonal immunoglobulin and T-cell receptor gene recombinations in suspect lym- E-mail: [email protected] phoproliferations: report of the BIOMED-2 Concerted Action BMH4-CT98-3936.
[Show full text]
Direct Interaction Between Hnrnp-M and CDC5L/PLRG1 Proteins Affects Alternative Splice Site Choice
Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice David Llères, Marco Denegri, Marco Biggiogera, Paul Ajuh, Angus Lamond To cite this version: David Llères, Marco Denegri, Marco Biggiogera, Paul Ajuh, Angus Lamond. Direct interaction be- tween hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice. EMBO Reports, EMBO Press, 2010, 11 (6), pp.445 - 451. 10.1038/embor.2010.64. hal-03027049 HAL Id: hal-03027049 https://hal.archives-ouvertes.fr/hal-03027049 Submitted on 26 Nov 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. scientificscientificreport report Direct interaction between hnRNP-M and CDC5L/ PLRG1 proteins affects alternative splice site choice David Lle`res1*, Marco Denegri1*w,MarcoBiggiogera2,PaulAjuh1z & Angus I. Lamond1+ 1Wellcome Trust Centre for Gene Regulation & Expression, College of Life Sciences, University of Dundee, Dundee, UK, and 2LaboratoriodiBiologiaCellulareandCentrodiStudioperl’IstochimicadelCNR,DipartimentodiBiologiaAnimale, Universita’ di Pavia, Pavia, Italy Heterogeneous nuclear ribonucleoprotein-M (hnRNP-M) is an and affect the fate of heterogeneous nuclear RNAs by influencing their abundant nuclear protein that binds to pre-mRNA and is a structure and/or by facilitating or hindering the interaction of their component of the spliceosome complex.
[Show full text]
Apoptosis Signal-Regulating Kinase 1 Promotes Ochratoxin A-Induced
OPEN Apoptosis Signal-regulating Kinase 1 SUBJECT AREAS: promotes Ochratoxin A-induced renal CELL BIOLOGY RISK FACTORS cytotoxicity Rui Liang1, Xiao Li Shen1,2, Boyang Zhang1, Yuzhe Li1, Wentao Xu1, Changhui Zhao3, YunBo Luo1 Received & Kunlun Huang1 10 November 2014 Accepted 1Laboratory of food safety and molecular biology, College of Food Science and Nutritional Engineering, China Agricultural 5 January 2015 University, Beijing 100083, P.R. China, 2School of Public Health, Zunyi Medical University, Zunyi, Guizhou 563003, P.R. China, 3Department of Nutrition and Food Science, University of Maryland, College Park, MD 20742, USA. Published 28 January 2015 Oxidative stress and apoptosis are involved in Ochratoxin A (OTA)-induced renal cytotoxicity. Apoptosis signal-regulating kinase 1 (ASK1) is a Mitogen-Activated Protein Kinase Kinase Kinase (MAPKKK, Correspondence and MAP3K) family member that plays an important role in oxidative stress-induced cell apoptosis. In this study, we performed RNA interference of ASK1 in HEK293 cells and employed an iTRAQ-based requests for materials quantitative proteomics approach to globally investigate the regulatory mechanism of ASK1 in should be addressed to OTA-induced renal cytotoxicity. Our results showed that ASK1 knockdown alleviated OTA-induced ROS W.X. (xuwentao@cau. generation and Dym loss and thus desensitized the cells to OTA-induced apoptosis. We identified 33 and 24 edu.cn) differentially expressed proteins upon OTA treatment in scrambled and ASK1 knockdown cells, respectively. Pathway classification and analysis revealed that ASK1 participated in OTA-induced inhibition of mRNA splicing, nucleotide metabolism, the cell cycle, DNA repair, and the activation of lipid metabolism. We concluded that ASK1 plays an essential role in promoting OTA-induced renal cytotoxicity.
[Show full text]
Structural Insights Into Nuclear Pre-Mrna Splicing in Higher Eukaryotes
Downloaded from http://cshperspectives.cshlp.org/ on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Structural Insights into Nuclear pre-mRNA Splicing in Higher Eukaryotes Berthold Kastner,1 Cindy L. Will,1 Holger Stark,2 and Reinhard Lührmann1 1Department of Cellular Biochemistry, Max Planck Institute for Biophysical Chemistry, D-37077 Göttingen, Germany 2Department of Structural Dynamics, Max Planck Institute for Biophysical Chemistry, D-37077 Göttingen, Germany Correspondence: [email protected] SUMMARY The spliceosome is a highly complex, dynamic ribonucleoprotein molecular machine that undergoes numerous structural and compositional rearrangements that lead to the formation of its active site. Recent advances in cyroelectron microscopy (cryo-EM) have provided a plethora of near-atomic structural information about the inner workings of the spliceosome. Aided by previous biochemical, structural, and functional studies, cryo-EM has confirmed or provided a structural basis for most of the prevailing models of spliceosome function, but at the same time allowed novel insights into splicing catalysis and the intriguing dynamics of the spliceosome. The mechanism of pre-mRNA splicing is highly conserved between humans and yeast, but the compositional dynamics and ribonucleoprotein (RNP) remodeling of the human spliceosome are more complex. Here, we summarize recent advances in our understanding of the molec- ular architecture of the human spliceosome, highlighting differences between the human and yeast
[Show full text]
CDC5L Drives FAH Expression to Promote Metabolic Reprogramming in Melanoma
www.impactjournals.com/oncotarget/ Oncotarget, 2017, Vol. 8, (No. 69), pp: 114328-114343 Research Paper CDC5L drives FAH expression to promote metabolic reprogramming in melanoma Zhichao Gu1, Huafeng Zhang2, Yong Li3, Susu Shen1, Xiaonan Yin4, Wei Zhang1, Ruimin Cheng1, Yong Zhang1, Xiaoyan Zhang1, Hui Chen1, Bo Huang4 and Yuchun Cao1 1Department of Dermatology, Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan 430030, China 2Department of Biochemistry and Molecular Biology, Tongji Medical College, Huazhong University of Science and Technology, Wuhan 430030, China 3Department of Oncology, Renmin Hospital, Hubei University of Medicine, Shiyan, Hubei 442000, China 4National Key Laboratory of Medical Molecular Biology and Department of Immunology, Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences, Beijing 100005, China Correspondence to: Yuchun Cao, email: [email protected] Keywords: fumarylacetoacetate hydrolase (FAH); anaplerotic reactions; cell division cycle 5-like protein (CDC5L); tumor metabolic reprogramming; melanoma Received: August 09, 2017 Accepted: November 15, 2017 Published: December 07, 2017 Copyright: Gu et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License 3.0 (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT Metabolic reprogramming allows tumor cells to thrive in the typically hypoxic tumor microenvironment. Using immunodetection and clinical data analyses, we demonstrate here that fumarylacetoacetate hydrolase (FAH) is highly expressed in melanoma and correlates with poor survival. FAH knockdown inhibits proliferation and migration, while promoting apoptosis in melanoma cells, result in prolonged survival in tumor-bearing mice.
[Show full text]
Identification of a Novel Tumor Microenvironment Prognostic
cancers Article Identiﬁcation of a Novel Tumor Microenvironment Prognostic Signature for Advanced-Stage Serous Ovarian Cancer Mingjun Zheng 1,†, Junyu Long 2,† , Anca Chelariu-Raicu 1, Heather Mullikin 1,3, Theresa Vilsmaier 1 , Aurelia Vattai 1, Helene Hildegard Heidegger 1, Falk Batz 1, Simon Keckstein 1, Udo Jeschke 1,4,* , Fabian Trillsch 1 , Sven Mahner 1 and Till Kaltofen 1,* 1 Department of Obstetrics and Gynecology, University Hospital, LMU Munich, Marchioninistrasse 15, 81377 Munich, Germany; [email protected] (M.Z.); [email protected] (A.C.-R.); [email protected] (H.M.); [email protected] (T.V.); [email protected] (A.V.); [email protected] (H.H.H.); [email protected] (F.B.); [email protected] (S.K.); [email protected] (F.T.); [email protected] (S.M.) 2 Department of Liver Surgery, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences & Peking Union Medical College, 9 Dongdan 3rd Alley, Dongcheng District, Beijing 100730, China; [email protected] 3 Department of Gynecology and Obstetrics, University Medical Center Regensburg, Landshuter Strasse 65, 93053 Regensburg, Germany 4 Department of Obstetrics and Gynecology, University Hospital Augsburg, Stenglinstrasse 2, 86156 Augsburg, Germany Citation: Zheng, M.; Long, J.; * Correspondence: [email protected] (U.J.); [email protected] (T.K.); Chelariu-Raicu, A.; Mullikin, H.; Tel.: +49-89-440054111 (U.J. & T.K.) Vilsmaier, T.; Vattai, A.; Heidegger, † Mingjun Zheng and Junyu Long contributed equally to this paper.
[Show full text]
Structural and Functional Insights Into Human Nuclear Cyclophilins
Preprints (www.preprints.org) | NOT PEER-REVIEWED | Posted: 2 November 2018 doi:10.20944/preprints201811.0037.v1 Peer-reviewed version available at Biomolecules 2018, 8, 161; doi:10.3390/biom8040161 1 Review 2 Structural and Functional Insights into Human 3 Nuclear Cyclophilins 4 Caroline Rajiv12 and Tara L. Davis13,* 5 1 Department of Biochemistry and Molecular Biology, Drexel University College of Medicine, 6 Philadelphia PA USA 19102. 7 2 Janssen Pharmaceuticals, Inc., 22-21062, 1400 McKean Rd, Spring House, PA 19477; 8 [email protected] 9 3 FORMA Therapeutics, 550 Arsenal St. Ste. 100, Boston, MA 02472; [email protected] 10 11 * Correspondence: [email protected]; Tel.: +01-857-209-2342 12 13 Abstract: The peptidyl-prolyl isomerases of the cyclophilin type are distributed throughout human 14 cells, including eight found solely in the nucleus. Nuclear cyclophilins are involved in complexes 15 that regulate chromatin modification, transcription, and pre-mRNA splicing. This review collects 16 what is known about the eight human nuclear cyclophilins: PPIH, PPIE, PPIL1, PPIL2, PPIL3, PPIG, 17 CWC27, and PPWD1. Each “spliceophilin” is evaluated in relation to the spliceosomal complex in 18 which it has been studied, and current work studying the biological roles of these cyclophilins in 19 the nucleus are discussed. The eight human splicing complexes available in the RCSB are analyzed 20 from the viewpoint of the human spliceophilins. Future directions in structural and cellular biology, 21 and the importance of developing spliceophilin-specific inhibitors, are considered. 22 23 Keywords: Peptidyl-prolyl isomerases; nuclear cyclophilins; spliceophilins; alternative splicing; 24 spliceosomes; NMR; x-ray crystallography 25 26 27 1.
[Show full text]
Functional Splicing Network Reveals Extensive Regulatory Potential of the Core Spliceosomal Machinery
Functional Splicing Network Reveals Extensive Regulatory Potential of the Core Spliceosomal Machinery Panagiotis Papasaikas,1,2,4 J. Ramo´ n Tejedor,1,2,4 Luisa Vigevani,1,2 and Juan Valca´ rcel1,2,3,* 1Centre de Regulacio´ Geno` mica, Dr. Aiguader 88, 08003 Barcelona, Spain 2Universitat Pompeu Fabra, Dr. Aiguader 88, 08003 Barcelona, Spain 3Institucio´ Catalana de Recerca i Estudis Avanc¸ ats, Passeig Lluis Companys 23, 08010 Barcelona, Spain 4Co-first authors SUMMARY quent binding of preassembled U4/5/6 tri-snRNP forms complex B, which after a series of conformational changes forms com- Pre-mRNA splicing relies on the poorly plexes Bact and C, concomitant with the activation of the two understood dynamic interplay between >150 catalytic steps that generate splicing intermediates and prod- protein compo- nents of the spliceosome. The ucts. Transition between spliceosomal subcomplexes involves steps at which splicing can be regulated remain profound dynamic changes in protein composition as well as largely unknown. We sys- tematically analyzed extensive rearrangements of base-pairing interactions between the effect of knocking down the components of snRNAs and between snRNAs and splice site sequences (Wahl the splicing machinery on alterna- tive splicing et al., 2009). RNA structures contributed by base-pairing interac- events relevant for cell proliferation and apoptosis tions between U2 and U6 snRNAs serve to coordinate metal ions and used this information to reconstruct a critical for splicing catalysis (Fica et al., 2013), implying that the network of functional interactions. The network spliceosome is an RNA enzyme whose catalytic center is only accurately captures known physical and established upon assembly of its individual components.
[Show full text]