Anti-PRPF19 Monoclonal Antibody, Clone 3F6 (DCABH-13061) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-PRPF19 monoclonal antibody, clone 3F6 (DCABH-13061) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Antigen Description PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]).

Immunogen PRPF19 (NP_055317, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG2a

Source/Host Mouse

Species Reactivity Human, Mouse, Rat

Clone 3F6

Conjugate Unconjugated

Applications Western Blot (Cell lysate); Western Blot (Transfected lysate); Western Blot (Recombinant protein); Immunofluorescence; Sandwich ELISA (Recombinant protein); ELISA

Sequence Similarities MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPS ATSIPAILKALQDEWDAVMLHSF

Size 1 ea

Buffer In 1x PBS, pH 7.4

Preservative None

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

GENE INFORMATION

Gene Name PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) [ Homo sapiens ]

Official Symbol PRPF19

Synonyms PRPF19; PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae); PRP19,

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved PRP19/PSO4 homolog (S. cerevisiae); pre-mRNA-processing factor 19; hPSO4; NMP200; nuclear matrix protein NMP200 related to splicing factor PRP19; PSO4; UBOX4; PRP19/PSO4 homolog; senescence evasion factor; nuclear matrix protein 200; SNEV; PRP19;

Entrez Gene ID 27339

Protein Refseq NP_055317

UniProt ID Q9UMS4

Chromosome Location 11q12.2

Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism- specific biosystem; Ubiquitin mediated proteolysis, organism-specific biosystem; Ubiquitin mediated proteolysis, conserved biosystem;

Function DNA binding; identical protein binding; protein binding; ubiquitin-protein ligase activity; ubiquitin- ubiquitin ligase activity;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]