DOCSLIB.ORG

Dramatically Reduced Spliceosome in Cyanidioschyzon Merolae

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Dramatically Reduced Spliceosome in Cyanidioschyzon Merolae Dramatically reduced spliceosome in PNAS PLUS Cyanidioschyzon merolae Martha R. Starka, Elizabeth A. Dunnb, William S. C. Dunna, Cameron J. Grisdalec, Anthony R. Danielea, Matthew R. G. Halsteada, Naomi M. Fastc, and Stephen D. Radera,b,1 aDepartment of Chemistry, University of Northern British Columbia, Prince George, BC, V2N 4Z9 Canada; and Departments of bBiochemistry and Molecular Biology, and cBotany, University of British Columbia, Vancouver, BC, V6T 1Z4 Canada Edited by Joan A. Steitz, Howard Hughes Medical Institute, Yale University, New Haven, CT, and approved February 9, 2015 (received for review September 1, 2014) The human spliceosome is a large ribonucleoprotein complex that C. merolae is an acidophilic, unicellular red alga that grows at catalyzes pre-mRNA splicing. It consists of five snRNAs and more temperatures of up to 56 °C (6). At 16.5 million base pairs, its than 200 proteins. Because of this complexity, much work has genome is similar in size to that of S. cerevisiae and contains focusedontheSaccharomyces cerevisiae spliceosome, viewed as a comparable number of genes; however only one tenth as many a highly simplified system with fewer than half as many splicing introns were annotated in C. merolae: 26 intron-containing factors as humans. Nevertheless, it has been difficult to ascribe genes, 0.5% of the genome (6). The small number of introns in a mechanistic function to individual splicing factors or even to dis- C. merolae raises the questions of whether the full complexity cern which are critical for catalyzing the splicing reaction. We have of the canonical splicing machinery has been maintained or C merolae identified and characterized the splicing machinery from the red alga whether . also harbors a reduced set of splicing factors. Cyanidioschyzon merolae We have undertaken a comprehensive bioinformatic survey of , which has been reported to harbor only C merolae 26 intron-containing genes. The U2, U4, U5, and U6 snRNAs contain the . splicing machinery, identifying four snRNAs (U2, expected conserved sequences and have the ability to adopt second- U4, U5, and U6) and 69 splicing proteins, 43 of which are pre- ary structures and form intermolecular base-pairing interactions, as dicted to be associated with small nuclear ribonucleoprotein in other organisms. C. merolae has a highly reduced set of 43 identifi- (snRNPs) or part of complexes that associate directly with the spliceosome. Surprisingly, we were not able to identify any can- able core splicing proteins, compared with ∼90 in budding yeast and didates for the U1 snRNA or U1-associated proteins, leading us ∼140 in humans. Strikingly, we have been unable to find a U1 snRNA to conclude that C. merolae does not contain a U1 snRNP. The candidate or any predicted U1-associated proteins, suggesting that C merolae C merolae profile of splicing proteins retained in . provides a means splicing in . may occur without the U1 small nuclear ribo- of assessing the contribution of specific proteins to the splicing nucleoprotein particle. In addition, based on mapping the identified reaction, at least insofar as the missing ones clearly are not always proteins onto the known splicing cycle, we propose that there is far essential for splicing. The U2 snRNP is the most complex particle, C merolae less compositional variability during splicing in . than in with 10 proteins present in addition to the Sm proteins. Many U5- other organisms. The observed reduction in splicing factors is consis- associated proteins also are retained, whereas the Prp19/CDC5L tent with the elimination of spliceosomal components that play a pe- complex (NTC), step-specific proteins, and tri-snRNP–specific BIOCHEMISTRY ripheral or modulatory role in splicing, presumably retaining those proteins are largely predicted to be absent. Indeed, the C. merolae with a more central role in organization and catalysis. spliceosome is notable for the almost complete absence of proteins that join or leave the spliceosome after B complex formation, pre-mRNA splicing | spliceosome core | U1 snRNP | genome reduction | suggesting that the initial core contains all the components required splicing mechanism to carry out the splicing reaction. The novelty of a splicing system re-mRNA splicing occurs by two transesterification reactions Significance Pthat are catalyzed by the spliceosome, a large macromolec- ular assembly of five snRNAs and more than 200 proteins in The spliceosome—the molecular particle responsible for re- humans (1). These components are thought to assemble onto moving interrupting sequences from eukaryotic messenger each new pre-mRNA transcript in an ordered fashion through RNA—is one of the most complex cellular machines. Consisting the recognition and binding of three highly conserved sequences of five snRNAs and over 200 proteins in humans, its numerous ′ ′ in the transcript: the 5 splice site, the branch site, and the 3 changes in composition and shape during splicing have made it splice site (2, 3). Some of these interactions occur via direct difficult to study. We have characterized an algal spliceosome RNA/RNA base pairing between the transcript and snRNAs; for that is much smaller, with only 43 identifiable core proteins, the ′ example, both U1 and U6 snRNAs base pair to the 5 splice site majority of which are essential for viability in other organisms. of the pre-mRNA transcript, and, similarly, U2 snRNA base We propose that this highly reduced spliceosome has retained pairs to the branch site (3). only the most critical splicing factors. Cyanidioschyzon merolae Given the complexity of the human spliceosome, it is of con- therefore provides a powerful system to examine the spliceo- siderable interest to find a more tractable splicing system with some’s catalytic core, enabling future advances in understanding fewer components to study the core processes of splicing (assembly, Saccharomyces cerevisiae the splicing mechanism and spliceosomal organization that are catalysis, and fidelity). The (yeast) challenging in more complex systems. spliceosome has been proposed as a simplified model system, because it contains only about 100 proteins (4). Indeed, substantial Author contributions: M.R.S., N.M.F., and S.D.R. designed research; M.R.S., E.A.D., W.S.C.D., progress in understanding the spliceosome has been made by C.J.G., A.R.D., M.R.G.H., and S.D.R. performed research; C.J.G. contributed new reagents/ studying yeast splicing (3, 5). Nevertheless, the yeast spliceosome analytic tools; M.R.S., E.A.D., W.S.C.D., C.J.G., A.R.D., N.M.F., and S.D.R. analyzed data; and is still a highly complex system in which to investigate the role of M.R.S., E.A.D., C.J.G., N.M.F., and S.D.R. wrote the paper. individual proteins, let alone attempt to develop a completely The authors declare no conflict of interest. defined splicing system for more incisive experiments. The publi- This article is a PNAS Direct Submission. cation of the Cyanidioschyzon merolae genome sequence revealed 1To whom correspondence should be addressed. Email: [email protected]. that it has only 27 introns (6), indicating that it might be a simpler This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10. system in which to investigate splicing. 1073/pnas.1416879112/-/DCSupplemental. www.pnas.org/cgi/doi/10.1073/pnas.1416879112 PNAS | Published online March 2, 2015 | E1191–E1200 Downloaded by guest on October 4, 2021 reduced to ∼40 proteins suggests that C. merolae may be a more a shorter U2 snNRA. U4 has an 18-nt insertion, relative to the tractable system for studying the central processes of pre-mRNA human sequence, starting at nucleotide 77 (Fig. S1). This in- splicing. sertion falls in the central domain of U4, in the middle of the hypothetical U4/U6 stem III, which is evolutionarily conserved, Results but for which there is no experimental support (10, 11). In ad- C. merolae Transcripts Are Spliced. Twenty-seven introns were dition, the 5′ stem-loop of U6 is ∼10 bp longer than that in other identified computationally in the C. merolae genome (figure S2 in species (Fig. S1). Finally, U2 snRNA lacks ∼60 nucleotides from ref. 6). To ascertain whether the intron-containing transcripts are the 3′ end, after the Sm-binding site, a region that generally in fact spliced, we performed RT-PCR on DNase-treated total forms one or more stem-loops in other organisms (12). No RNA. Each primer pair, except for those for gene CMK245C, C. merolae snRNAs have stem-loops predicted downstream of resulted in two PCR products, a longer intron-containing ampli- their Sm site. con and a shorter amplicon corresponding to spliced mRNA (Fig. U4 and U6 snRNAs in other organisms are known to form an 1). The CMK245C transcript appears to be completely spliced. extended base-pairing interaction, allowing them to comigrate Two junctions (CMQ117C and CMO094C) were confirmed by on a nondenaturing gel. To test whether this interaction also sequencing reverse transcriptase products, and the remaining occurs in C. merolae, we compared cold phenol-extracted total introns were observed to splice at their expected junctions based RNA (Fig. 2B, lanes 1 and 3) with the same samples incubated on our sequencing of background mRNAs in the RNA immuno- for 5 min at 70 °C to disrupt base pairing (Fig. 2B, lanes 2 and 4). precipitation sequencing (RIP-seq) Illumina library (see below Heat treatment resulted in the disappearance of the low-mobility and SI Materials and Methods). band detected by both U4 (lane 1) and U6 (lane 3) probes and the appearance of higher-mobility bands detected by U4 (lane 2) Identification of snRNAs. Given that intron-containing transcripts and U6 (lane 4) probes. Control experiments with S. cerevisiae are spliced in C. merolae, we sought to identify components snRNAs (lanes 5–8) demonstrate the analogous interaction.
Load more

Recommended publications
  • Reconstituting Cell Dynamics with Synthetic Biology
    REVIEW CELL BIOLOGY Toward total synthesis of cell function: Reconstituting cell dynamics with synthetic biology Allen K. Kim,1,2,3 Robert DeRose,1,2* Tasuku Ueno,4† Benjamin Lin,3,5,6† Toru Komatsu,4,7† Hideki Nakamura,1,2 Takanari Inoue1,2,3,7* Biological phenomena, such as cellular differentiation and phagocytosis, are fundamental processes that enable cells to fulfill important physiological roles in multicellular organisms. In the field of synthetic biology, the study of these behaviors relies on the use of a broad range of molecular tools that enable the real-time manipulation and measurement of key components in the underlying signaling pathways. This Review will focus on a subset of synthetic biology tools known as bottom-up techniques, which use technologies such as optogenetics and chemically induced dimerization to reconstitute cellular behavior Downloaded from in cells. These techniques have been crucial not only in revealing causal relationships within signaling networks but also in identifying the minimal signaling components that are necessary for a given cellular function. We discuss studies that used these systems in a broad range of cellular and molecular phenomena, including the time-dependent modulation of protein activity in cellular proliferation and dif- ferentiation, the reconstitution of phagocytosis, the reconstitution of chemotaxis, and the regulation of actin reorganization. Finally, we discuss the potential contribution of synthetic biology to medicine. http://stke.sciencemag.org/ Introduction lation of biomolecules with subcellular resolution. One of the ultimate One of the prevailing aspirations of synthetic biology is the intelligent de- goals of synthetic biology is the recapitulation of these behaviors in a sign of biological systems to perform a specific function, which is achieved cell-free system, in which all of the components are introduced in a through the assembly of modular components consisting of genes and pro- controlled manner.
    [Show full text]
  • Evolutionary Origins of DNA Repair Pathways: Role of Oxygen Catastrophe in the Emergence of DNA Glycosylases
    cells Review Evolutionary Origins of DNA Repair Pathways: Role of Oxygen Catastrophe in the Emergence of DNA Glycosylases Paulina Prorok 1 , Inga R. Grin 2,3, Bakhyt T. Matkarimov 4, Alexander A. Ishchenko 5 , Jacques Laval 5, Dmitry O. Zharkov 2,3,* and Murat Saparbaev 5,* 1 Department of Biology, Technical University of Darmstadt, 64287 Darmstadt, Germany; [email protected] 2 SB RAS Institute of Chemical Biology and Fundamental Medicine, 8 Lavrentieva Ave., 630090 Novosibirsk, Russia; [email protected] 3 Center for Advanced Biomedical Research, Department of Natural Sciences, Novosibirsk State University, 2 Pirogova St., 630090 Novosibirsk, Russia 4 National Laboratory Astana, Nazarbayev University, Nur-Sultan 010000, Kazakhstan; [email protected] 5 Groupe «Mechanisms of DNA Repair and Carcinogenesis», Equipe Labellisée LIGUE 2016, CNRS UMR9019, Université Paris-Saclay, Gustave Roussy Cancer Campus, F-94805 Villejuif, France; [email protected] (A.A.I.); [email protected] (J.L.) * Correspondence: [email protected] (D.O.Z.); [email protected] (M.S.); Tel.: +7-(383)-3635187 (D.O.Z.); +33-(1)-42115404 (M.S.) Abstract: It was proposed that the last universal common ancestor (LUCA) evolved under high temperatures in an oxygen-free environment, similar to those found in deep-sea vents and on volcanic slopes. Therefore, spontaneous DNA decay, such as base loss and cytosine deamination, was the Citation: Prorok, P.; Grin, I.R.; major factor affecting LUCA’s genome integrity. Cosmic radiation due to Earth’s weak magnetic field Matkarimov, B.T.; Ishchenko, A.A.; and alkylating metabolic radicals added to these threats.
    [Show full text]
  • Alterations of RNA Splicing Patterns in Esophagus Squamous Cell Carcinoma
    Ding et al. Cell Biosci (2021) 11:36 https://doi.org/10.1186/s13578-021-00546-z Cell & Bioscience RESEARCH Open Access Alterations of RNA splicing patterns in esophagus squamous cell carcinoma Jiyu Ding1,2, Chunquan Li3, Yinwei Cheng1,2, Zepeng Du4, Qiuyu Wang3, Zhidong Tang3, Chao Song3, Qiaoxi Xia1,2, Wenjing Bai1,2, Ling Lin1,2, Wei Liu1,2, Liyan Xu1,5, Enmin Li1,2* and Bingli Wu1,2* Abstract Alternative splicing (AS) is an important biological process for regulating the expression of various isoforms from a single gene and thus to promote proteome diversity. In this study, RNA-seq data from 15 pairs of matched esopha- geal squamous cell carcinoma (ESCC) and normal tissue samples as well as two cell lines were analyzed. AS events with signifcant diferences were identifed between ESCC and matched normal tissues, which were re-annotated to fnd protein coding genes or non-coding RNAs. A total of 45,439 AS events were found. Of these, 6019 (13.25%) signifcant diferentially AS events were identifed. Exon skipping (SE) events occupied the largest proportion of abnormal splicing events. Fifteen diferential splicing events with the same trends of ΔΨ values in ESCC tissues, as well in the two cell lines were found. Four pathways and 20 biological processes related to pro-metastasis cell junction and migration were signifcantly enriched for the diferentially spliced genes. The upregulated splicing factor SF3B4, which regulates 92 gene splicing events, could be a potential prognostic factor of ESCC. Diferentially spliced genes, includ- ing HNRNPC, VCL, ZNF207, KIAA1217, TPM1 and CALD1 are shown with a sashimi plot.
    [Show full text]
  • SF3B3) and Sin3a Associated Protein 130 (SAP130
    cells Communication Ambiguity about Splicing Factor 3b Subunit 3 (SF3B3) and Sin3A Associated Protein 130 (SAP130) Paula I. Metselaar 1,* , Celine Hos 1, Olaf Welting 1, Jos A. Bosch 2,3, Aletta D. Kraneveld 4 , Wouter J. de Jonge 1 and Anje A. Te Velde 1 1 Tytgat Institute for Liver and Intestinal Research, AGEM, Amsterdam UMC, University of Amsterdam, 1105BK Amsterdam, The Netherlands; [email protected] (C.H.); [email protected] (O.W.); [email protected] (W.J.d.J.); [email protected] (A.A.T.V.) 2 Department of Psychology, University of Amsterdam, 1018WS Amsterdam, The Netherlands; [email protected] 3 Department of Medical Psychology, Amsterdam UMC, University of Amsterdam, 1001NK Amsterdam, The Netherlands 4 Division of Pharmacology, Utrecht Institute for Pharmaceutical Sciences, Faculty of Science, Utrecht University, 3584CG Utrecht, The Netherlands; [email protected] * Correspondence: [email protected] Abstract: In 2020, three articles were published on a protein that can activate the immune system by binding to macrophage-inducible C-type lectin receptor (Mincle). In the articles, the protein was referred to as ‘SAP130, a subunit of the histone deacetylase complex.’ However, the Mincle ligand the authors aimed to investigate is splicing factor 3b subunit 3 (SF3B3). This splicing factor is unrelated to SAP130 (Sin3A associated protein 130, a subunit of the histone deacetylase-dependent Sin3A corepressor complex). The conclusions in the three articles were formulated for SF3B3, Citation: Metselaar, P.I.; Hos, C.; while the researchers used qPCR primers and antibodies against SAP130.
    [Show full text]
  • Responses of Bats to White-Nose Syndrome and Implications for Conservation
    University of New Hampshire University of New Hampshire Scholars' Repository Doctoral Dissertations Student Scholarship Spring 2020 Responses of Bats to White-Nose Syndrome and Implications for Conservation Meghan Stark University of New Hampshire, Durham Follow this and additional works at: https://scholars.unh.edu/dissertation Recommended Citation Stark, Meghan, "Responses of Bats to White-Nose Syndrome and Implications for Conservation" (2020). Doctoral Dissertations. 2518. https://scholars.unh.edu/dissertation/2518 This Dissertation is brought to you for free and open access by the Student Scholarship at University of New Hampshire Scholars' Repository. It has been accepted for inclusion in Doctoral Dissertations by an authorized administrator of University of New Hampshire Scholars' Repository. For more information, please contact [email protected]. RESPONSES OF BATS TO WHITE-NOSE SYNDROME AND IMPLICATIONS FOR CONSERVATION BY MEGHAN A. STARK B.S., University of Alabama at Birmingham, 2013 DISSERTATION Submitted to the University of New Hampshire in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy In Genetics May 2020 i This dissertation was examined and approved in partial fulfillment of the requirements for the degree of Ph.D. in Genetics by: Dissertation Director, Matthew MacManes, Assoc. Prof. UNH MCBS Jeffrey T. Foster, Associate Professor, NAU PMI W. Kelley Thomas, Professor, UNH MCBS Rebecca Rowe, Associate Professor, UNH NREN Thomas Lee, Associate Professor Emeritus, UNH NREN On April 6, 2020 Approval signatures are on file with the University of New Hampshire Graduate School. ii DEDICATION I dedicate this work to all of the strong women in my life: Myra Michele Ange Heather Michelle Coons Kaitlyn Danielle Cagle Brindlee Michelle Coons Patricia Gail Miller Sarah Jean Lane “Here’s to strong women.
    [Show full text]
  • Urabe VK, Et Al. Influences on U2 Snrna Structure U2
    bioRxiv preprint doi: https://doi.org/10.1101/2021.07.05.451154; this version posted July 6, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Urabe VK, et al. Influences on U2 snRNA structure U2 snRNA structure is influenced by SF3A and SF3B proteins but not by SF3B inhibitors Veronica K. Urabe1, Meredith Stevers1, Arun K. Ghosh3 and Melissa S. Jurica1,2 * 1Department of Molecular Cell and Developmental Biology and 2Center for Molecular Biology of RNA, University of California, Santa Cruz, California, United States of America 3Department of Chemistry and Department of Medicinal Chemistry, Purdue University, West Lafayette, Indiana United States of America *Corresponding author E-mail: [email protected] (MSJ) bioRxiv preprint doi: https://doi.org/10.1101/2021.07.05.451154; this version posted July 6, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Urabe VK, et al. Influences on U2 snRNA structure Abstract U2 snRNP is an essential component of the spliceosome. It is responsible for branch point recognition in the spliceosome A-complex via base-pairing of U2 snRNA with an intron to form the branch helix. Small molecule inhibitors target the SF3B component of the U2 snRNP and interfere with A-complex formation during spliceosome assembly.
    [Show full text]
  • SF3B2 Monoclonal Antibody (M01J), Clone 5D2
    SF3B2 monoclonal antibody (M01J), clone 5D2 Catalog # : H00010992-M01J 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Cell lysate) Description: SF3B2. Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 645 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYG PPPSY enlarge Western Blot (Cell lysate) Host: Mouse Reactivity: Human, Mouse, Rat Preparation Cell Culture Production Method: (CX Grade Antibody List) enlarge Isotype: IgG2a Kappa Western Blot (Recombinant protein) Quality Control Antibody Reactive Against Recombinant Protein. Immunofluorescence Testing: enlarge Immunohistochemistry (Formalin/PFA-fixed paraffin- embedded sections) Western Blot detection against Immunogen (31.68 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. enlarge Instruction: Sandwich ELISA (Recombinant protein) MSDS: Download Interspecies Mouse (98); Rat (98) Antigen Sequence: Datasheet: Download enlarge ELISA Applications Western Blot (Cell lysate) Page 1 of 3 2021/6/15 SF3B2 monoclonal antibody (M01J), clone 5D2. Western Blot analysis of SF3B2 expression in Hela S3 NE. Protocol Download Western Blot (Cell lysate) SF3B2 monoclonal antibody (M01J), clone 5D2. Western Blot analysis of SF3B2 expression in Jurkat. Protocol Download Western Blot (Recombinant protein) Protocol Download Immunofluorescence enlarge this image Immunofluorescence of monoclonal antibody to SF3B2 on HeLa cell . [antibody concentration 10 ug/ml] Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlarge this image Page 2 of 3 2021/6/15 Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6 ug/ml] Protocol Download Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged SF3B2 is 0.1 ng/ml as a capture antibody.
    [Show full text]
  • Genome-Wide Association Study of Copy Number Variations (Cnvs) with Opioid Dependence
    Neuropsychopharmacology (2015) 40, 1016–1026 & 2015 American College of Neuropsychopharmacology. All rights reserved 0893-133X/15 www.neuropsychopharmacology.org Genome-Wide Association Study of Copy Number Variations (CNVs) with Opioid Dependence Dawei Li*,1,2,3,4, Hongyu Zhao5,6, Henry R Kranzler7, Ming D Li8, Kevin P Jensen1, Tetyana Zayats1, Lindsay A Farrer9 and Joel Gelernter1,6,10 1 2 Department of Psychiatry, School of Medicine, Yale University, New Haven, CT, USA; Department of Microbiology and Molecular Genetics, University of Vermont, Burlington, VT, USA; 3Department of Computer Science, University of Vermont, Burlington, VT, USA; 4Neuroscience, Behavior, and Health Initiative, University of Vermont, Burlington, VT, USA; 5Department of Biostatistics, Yale School of Public Health, New Haven, 6 7 CT, USA; Department of Genetics, School of Medicine, Yale University, New Haven, CT, USA; Department of Psychiatry, University of 8 Pennsylvania School of Medicine and VISN 4 MIRECC, Philadelphia VAMC, Philadelphia, PA, USA; Department of Psychiatry and 9 Neurobehavioral Sciences, University of Virginia, Charlottesville, VA, USA; Departments of Medicine (Biomedical Genetics), Neurology, Ophthalmology, Genetics and Genomics, Biostatistics, and Epidemiology, Boston University Schools of Medicine and Public Health, Boston, MA, USA; 10VA Connecticut Healthcare Center, Department of Neurobiology, Yale University School of Medicine, New Haven, CT, USA Single-nucleotide polymorphisms that have been associated with opioid dependence (OD) altogether account for only a small proportion of the known heritability. Most of the genetic risk factors are unknown. Some of the ‘missing heritability’ might be explained by copy number variations (CNVs) in the human genome. We used Illumina HumanOmni1 arrays to genotype 5152 African-American and European-American OD cases and screened controls and implemented combined CNV calling methods.
    [Show full text]
  • Coupling of Spliceosome Complexity to Intron Diversity
    bioRxiv preprint doi: https://doi.org/10.1101/2021.03.19.436190; this version posted March 20, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Coupling of spliceosome complexity to intron diversity Jade Sales-Lee1, Daniela S. Perry1, Bradley A. Bowser2, Jolene K. Diedrich3, Beiduo Rao1, Irene Beusch1, John R. Yates III3, Scott W. Roy4,6, and Hiten D. Madhani1,6,7 1Dept. of Biochemistry and Biophysics University of California – San Francisco San Francisco, CA 94158 2Dept. of Molecular and Cellular Biology University of California - Merced Merced, CA 95343 3Department of Molecular Medicine The Scripps Research Institute, La Jolla, CA 92037 4Dept. of Biology San Francisco State University San Francisco, CA 94132 5Chan-Zuckerberg Biohub San Francisco, CA 94158 6Corresponding authors: [email protected], [email protected] 7Lead Contact 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.03.19.436190; this version posted March 20, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. SUMMARY We determined that over 40 spliceosomal proteins are conserved between many fungal species and humans but were lost during the evolution of S. cerevisiae, an intron-poor yeast with unusually rigid splicing signals. We analyzed null mutations in a subset of these factors, most of which had not been investigated previously, in the intron-rich yeast Cryptococcus neoformans.
    [Show full text]
  • SF3B4 Gene Splicing Factor 3B Subunit 4
    SF3B4 gene splicing factor 3b subunit 4 Normal Function The SF3B4 gene provides instructions for making the SAP49 protein, which is part of a complex called a spliceosome. Spliceosomes help process messenger RNA (mRNA), which is a chemical cousin of DNA that serves as a genetic blueprint for making proteins. The spliceosomes recognize and then remove regions from mRNA molecules that are not used in the blueprint (which are called introns). The SAP49 protein may also be involved in a chemical signaling pathway known as the bone morphogenic protein (BMP) pathway. This signaling pathway regulates various cellular processes and is involved in the growth of cells. The SAP49 protein is particularly important for the maturation of cells that build bones and cartilage ( osteoblasts and chondrocytes). Health Conditions Related to Genetic Changes Nager syndrome More than 30 mutations in the SF3B4 gene have been found to cause Nager syndrome, which is primarily characterized by abnormalities of the face, hands, and arms, such as underdeveloped cheek bones (malar hypoplasia), a small lower jaw (micrognathia), and malformed or absent thumbs. The condition can also affect development of other parts of the body. More than half of people with this condition have a mutation in the SF3B4 gene. These mutations prevent the production of SAP49 protein or lead to production of a nonfunctional protein. It is unclear how a shortage of functional SAP49 protein leads to the development problems in Nager syndrome. Researchers suspect that problems with spliceosome formation may impair mRNA processing and alter the activity of genes involved in development of several parts of the body.
    [Show full text]
  • SF3B2-Mediated RNA Splicing Drives Human Prostate Cancer Progression
    Published OnlineFirst August 20, 2019; DOI: 10.1158/0008-5472.CAN-18-3965 Cancer Molecular Cell Biology Research SF3B2-Mediated RNA Splicing Drives Human Prostate Cancer Progression Norihiko Kawamura1,2, Keisuke Nimura1, Kotaro Saga1, Airi Ishibashi1, Koji Kitamura1,3, Hiromichi Nagano1, Yusuke Yoshikawa4, Kyoso Ishida1,5, Norio Nonomura2, Mitsuhiro Arisawa4, Jun Luo6, and Yasufumi Kaneda1 Abstract Androgen receptor splice variant-7 (AR-V7) is a General RNA splicing SF3B2 complex-mediated alternative RNA splicing constitutively active AR variant implicated in U2 castration-resistant prostate cancers. Here, we show U2 snRNA that the RNA splicing factor SF3B2, identified by 3’ 3’ in silico and CRISPR/Cas9 analyses, is a critical 5’ 3’ splice site 5’ SF3B7 AR-V7 5’ A U2AF2 AGA Exon ? determinant of expression and is correlated SF3B6(p14) SF3B4 SF3B1 SF3B4 SF3B1 with aggressive cancer phenotypes. Transcriptome SF3B5 SF3B2 SF3B3 SF3B2 SF3B3 and PAR-CLIP analyses revealed that SF3B2 con- SF3A3 SF3B2 complex SF3A3 SF3A1 SF3A1 SF3b complex trols the splicing of target genes, including AR, to AR pre-mRNA drive aggressive phenotypes. SF3B2-mediated CE3 aggressive phenotypes in vivo were reversed by AR-V7 mRNA AR mRNA AR-V7 knockout. Pladienolide B, an inhibitor of CE3 a splicing modulator of the SF3b complex, sup- Drive malignancy pressed the growth of tumors addicted to high While the SF3b complex is critical for general RNA splicing, SF3B2 promotes inclusion of the target exon through recognizing a specific RNA motif. SF3B2 expression. These findings support the idea © 2019 American Association for Cancer Research that alteration of the splicing pattern by high SF3B2 expression is one mechanism underlying prostate cancer progression and therapeutic resistance.
    [Show full text]
  • Mrna Turnover Philip Mitchell* and David Tollervey†
    320 mRNA turnover Philip Mitchell* and David Tollervey† Nuclear RNA-binding proteins can record pre-mRNA are cotransported to the cytoplasm with the mRNP. These processing events in the structure of messenger proteins may preserve a record of the nuclear history of the ribonucleoprotein particles (mRNPs). During initial rounds of pre-mRNA in the cytoplasmic mRNP structure. This infor- translation, the mature mRNP structure is established and is mation can strongly influence the cytoplasmic fate of the monitored by mRNA surveillance systems. Competition for the mRNA and is used by mRNA surveillance systems that act cap structure links translation and subsequent mRNA as a checkpoint of mRNP integrity, particularly in the identi- degradation, which may also involve multiple deadenylases. fication of premature translation termination codons (PTCs). Addresses Cotransport of nuclear mRNA-binding proteins with mRNA Wellcome Trust Centre for Cell Biology, ICMB, University of Edinburgh, from the nucleus to the cytoplasm (nucleocytoplasmic shut- Kings’ Buildings, Edinburgh EH9 3JR, UK tling) was first observed for the heterogeneous nuclear *e-mail: [email protected] ribonucleoprotein (hnRNP) proteins. Some hnRNP proteins †e-mail: [email protected] are stripped from the mRNA at export [1], but hnRNP A1, Current Opinion in Cell Biology 2001, 13:320–325 A2, E, I and K are all exported (see [2]). Although roles for 0955-0674/01/$ — see front matter these hnRNP proteins in transport and translation have been © 2001 Elsevier Science Ltd. All rights reserved. reported [3•,4•], their affects on mRNA stability have been little studied. More is known about hnRNP D/AUF1 and Abbreviations AREs AU-rich sequence elements another nuclear RNA-binding protein, HuR, which act CBC cap-binding complex antagonistically to modulate the stability of a range of DAN deadenylating nuclease mRNAs containing AU-rich sequence elements (AREs) DSEs downstream sequence elements (reviewed in [2]).
    [Show full text]