Anti-PRPF19 monoclonal antibody, clone 3F6 (DCABH-13061) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]). Immunogen PRPF19 (NP_055317, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human, Mouse, Rat Clone 3F6 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Transfected lysate); Western Blot (Recombinant protein); Immunofluorescence; Sandwich ELISA (Recombinant protein); ELISA Sequence Similarities MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPS ATSIPAILKALQDEWDAVMLHSF Size 1 ea Buffer In 1x PBS, pH 7.4 Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) [ Homo sapiens ] Official Symbol PRPF19 Synonyms PRPF19; PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae); PRP19, 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved PRP19/PSO4 homolog (S. cerevisiae); pre-mRNA-processing factor 19; hPSO4; NMP200; nuclear matrix protein NMP200 related to splicing factor PRP19; PSO4; UBOX4; PRP19/PSO4 homolog; senescence evasion factor; nuclear matrix protein 200; SNEV; PRP19; Entrez Gene ID 27339 Protein Refseq NP_055317 UniProt ID Q9UMS4 Chromosome Location 11q12.2 Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; Spliceosome, Prp19/CDC5L complex, organism- specific biosystem; Ubiquitin mediated proteolysis, organism-specific biosystem; Ubiquitin mediated proteolysis, conserved biosystem; Function DNA binding; identical protein binding; protein binding; ubiquitin-protein ligase activity; ubiquitin- ubiquitin ligase activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-