RBL1 Polyclonal Antibody

RBL1 polyclonal antibody

Catalog # : PAB29467 規格 : [ 100 uL ] List All

Specification Application Image

Product Rabbit polyclonal antibody raised against recombinant human RBL1. Western Blot (Cell lysate) Description:

Immunogen: Recombinant protein corresponding to human RBL1.

Sequence: DAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFEKKRSFAPSTPLTG RRYLRE enlarge

Host: Rabbit Immunohistochemistry (Formalin/PFA-fixed paraffin- Reactivity: Human embedded sections)

Form: Liquid

Purification: Antigen affinity purification

Isotype: IgG enlarge

Recommend Immunohistochemistry (1:500-1:1000) Immunofluorescence Usage: Immunofluorescence (1-4 ug/mL) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.

Storage Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)

Storage Store at 4°C. For long term storage store at -20°C. enlarge Instruction: Aliquot to avoid repeated freezing and thawing.

Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Datasheet: Download

Applications

Western Blot (Cell lysate)

Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp Lane 3: Human plasma (IgG/HSA depleted) Lane 4: Human liver tissue Lane 5: Human tonsil tissue with RBL1 polyclonal antibody (Cat # PAB29467) at 1:250-1:500 dilution. Page 1 of 3 2017/2/16 Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunohistochemical staining of human colon with RBL1 polyclonal antibody (Cat # PAB29467) shows moderate nuclear positivity in glandular cells at 1:500-1:1000 dilution.

Immunofluorescence

Immunofluorescent staining of human cell line U-2 OS with RBL1 polyclonal antibody (Cat # PAB29467) at 1-4 ug/mL concentration shows positivity in nucleus but excluded from the nucleoli.

Gene Information

Entrez GeneID: 5933

Gene Name: RBL1

Gene Alias: CP107,MGC40006,PRB1,p107

Page 2 of 3 2017/2/16 Gene retinoblastoma-like 1 (p107) Description:

Omim ID: 116957

Gene Ontology: Hyperlink

Gene Summary: The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Other 107 kDa retinoblastoma-associated Designations: protein,OTTHUMP00000030892,OTTHUMP00000030893,cellular protein 107,retinoblastoma-like protein 1

Interactome

Gene Pathway Cell cycle TGF-beta signaling pathway

Related Disease Adenocarcinoma Esophageal Neoplasms Genetic Predisposition to Disease Ovarian Neoplasms Tobacco Use Disorder

Page 3 of 3 2017/2/16