DOCSLIB.ORG

United States Patent (19) 11 Patent Number: 6,159,729 Hofmann Et Al

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
United States Patent (19) 11 Patent Number: 6,159,729 Hofmann Et Al USOO6159729A United States Patent (19) 11 Patent Number: 6,159,729 Hofmann et al. (45) Date of Patent: Dec. 12, 2000 54 SYNTHETIC HPV6/11 HYBRID L1 DNA Russo, P.; Saccharomyces cerevisiae mRNA3 End Forming ENCODING HUMAN PAPLLOMAVIRUS Signals are also Involved in Transcription Termination; TYPE 11 L1 PROTEIN Yeast; vol. 11: (1995); pp. 447-453. 75 Inventors: Kathryn J. Hofmann, Collegeville; Thalenfeld, B. E. et al.; olil Transcripts in Wild Type and in Kathrin U. Jansen, Fort Washington; a Cytoplasmic “Petite” Mutant of Yeast; the Journal of Michael P. Neeper, Collegeville; Biological Chemistry; vol. 258; No. 23; Issue of Dec. 10; Joseph G. Joyce, Lansdale, Hugh A. (1983); pp. 14065–14068. George, Schwenksville; E. Dale Lang, W. H. et al.; A Model for Transcription Termination by Lehman, Lansdale, all of Pa. RNA Polymerase I; Cell; vol. 79; (1994); pp. 527–534. 73 Assignee: Merck & Co., Ltd., Rahway, N.J. Heidmann, S. et al.; Flexibility and Interchangeability of Polyadenylation Signals in Saccharomyces cerevisiae, Mol. 21 Appl. No.: 08/913,462 Cell. Biology; vol. 14; No. 7; (1994); pp. 4633-4642. 22 PCT Filed: Mar. 26, 1996 Brambilla, A. et al., A Simple signal element mediates transcription termination and mRNA 3’ end formation in the 86 PCT No.: PCT/US96/04117 DEG1 gene of Saccharomyces cerevisiae, Mol. Gen. Genet; S371 Date: Jan. 26, 1998 vol. 254; (1997); pp. 681–688. S 102(e) Date: Jan. 26, 1998 Henikoff, S. et al.; Transcription Terminates in Yeast Distal to a Control Sequence; Cell; vol. 33; (1983); pp. 607-614. 87 PCT Pub. No.: WO96/30520 Zaret, K. S. et al.; DNA Sequence Required for Efficient PCT Pub. Date: Oct. 3, 1996 Transcription Termination in Yeast; Cell; vol. 28; (1982); pp. 563-573. Related U.S. Application Data Rose et al. (1993) Expression of human papillomavirus type 63 Continuation of application No. 08/413,572, Mar. 30, 1995, 11 L1 protein in insect cells: in Vivo and in vitro assembly abandoned, which is a continuation of application No. of viruslike particles. J. Virol. 67: 1936–1944, Apr. 1993. 08/413,571, Mar. 30, 1995, abandoned. 51) Int. Cl." ............................ C12N 15/11; C12N 15/81 52 U.S. Cl. ...................................... 435/320.1; 536/23.72 Primary Examiner Nancy Degen 58 Field of Search .............................. 424/186.1, 204.1; ASSistant Examiner Robert Schwartzman 435/69.1, 69.3, 235.1, 320.1; 514/2, 44; Attorney, Agent, or Firm Joanne M. Giesser; Jack L. 530/387.9, 388.3, 389.4; 536/23.1, 23.72 Tribble 57 ABSTRACT 56) References Cited The present invention is directed to a synthetic DNA mol PUBLICATIONS ecule encoding purified human papillomavirus type 11 L1 Zaret, K. S. et al.; Mutationally Altered 3 Ends of Yeast protein and derivatives thereof. CYC1 mRNA Affect Transcript Stability and Translational Efficiency; J. Mol. Biol.; vol. 176; (1984); pp. 107-135. 7 Claims, 12 Drawing Sheets U.S. Patent Dec. 12, 2000 Sheet 1 of 12 6,159,729 OLIGOMER DESIGNATIONS: (#241–1) Bg II Sph I Kpn XhoI Bgill 2 3 4 5 6 7 8 9 1 0 1 1 12 24 23 22 21 20 19 18 17 6 5 4 13 FRAGMENT ASSEMBLY: OLIGOMER ANNEAL ING LIGATION A B C D SUBCLONE A,B,C,D SEPARATELY INTO pSP72 SEQUENCE RECLEAVE TO RELEASE INSERTS LIGATE C AND D INTO pSP72 A B CD RELEASE CD FROM pSP72 WITH Kpn I Bg II LIGATE WITH Bgill, Sphi-DIGESTED A AND Sph I, Kpn I-DIGESTED B ISOLATE 1.5 kb Bg III FRAGMENT LIGATE WITH Bomhi DIGESTED pCo. 1-10 Bom/Bg II Bom/Bg II PLASM ID #D361-1 FIG.1 U.S. Patent Dec. 12, 2000 Sheet 2 of 12 6,159,729 10 20 50 40 50 lowy-16Ll ATCTCTCTTT CCCTCCCTAC TGACGCCACT CTCTACTTGC CTCCTCTCCC 50 hpv161.gb ATCTCTCTTT CGCTCCCTAC. TCACCCCACT CTCTACTTCC CTCCTCTCCC 50 hpv161.mr 1 ATCTCTCTTT CGCTCCCTAG TGACCCCACT GTCTACTTCC CTCCTCTCCC 50 60 70 80 90 100 Lowy-16Ll 5 AGTATCTAAG GTTGTAAGCA CGGATGAATA TGTTGCACCC ACAAACATAT 100 hpv1611.gb 5 ACTATCTAAG GTTGTAAGCA CCGATGAATA TGTTGCACGC ACAAACAAT 100 hpv 161.mri 5 AGTATCTAAG GTTGTAAGCA CCGATGAATA TGTTGCACCC ACAAACATAT 100 110 120 130 40 150 Lowy-16Ll 101 ATTATCATCC AGGAACATCC AGACTACTTG CAGTTGGACA TCCCTATTTT 150 hpv61.gb 101 ATTATCATGC AGGAACATCC AGACTACTTG CAGTTCGACA TCCCTATTTT 150 hpv161.mr 10 ATTATCATCC ACGAACATCC AGACTACTTC CAGTTCGACA TCCCTATTTT 150 160 170 180 190 200 Lowy-16L1 151 CCTATTAAAA AACCTAACAATAACAAAATA TTAGTTCCTA AAGTATCACG 200 hpv 161.gb 151 CCTATTAAAA AACCTAACAATAACAAAATA TTAGTTCCTA AACTATCAGG 200 hpv 161.mr 151 CCTATTAAAA AACCTAACAATAACAAAATA TTAGTTCCTA AAGTATCACG 200 210 220 230 240 250 Lowy-16Ll 201 ATTACAATAC AGGGTATTTA GAATACATTT ACCTGACCCC AATAAGTTTC 250 hpv161.gb 201 ATTACAATAC ACCGTATTTA GAATACATTT ACCTGACCCC AATAACTTTC 250 hpv161.mr 20 ATTACAATAC ACCGTATTTA GAATACATTT ACCTCACCCC AATAACTTTC 250 260 270 280 290 300 Lowy-16L 25 GTTTTCCTGA CACCTCATTT TATAATCCAG ATACACACCC GCTCGTTTCC 500 hpv161.gb 25 GTTTTCCTGA CACCTCATTT TATAATCCAC ATACACACCC CCTGGTTTCC 300 hpv16.mri 25 GTTTTCCTCA CACCTCATTT TATAATCCAG ATACACACCC CCTGGTTTCC 500 30 520 50 340 350 Lowy-16L 301 GCCTGTGTAG GTGTTGACGT ACGTCGTGGT CAGCCATTAG GTGTGGGCAT 350 hpv161.gb 301 GCCTGTGTAG GTGTTGACGT ACGTCGTGGT CAGCCATTAG GTGTGGGCAT 350 hpv161.mri 501 GCCTGTGTAC GTGTTGACGT ACGTCGTCGT CAGCCATTAC GTGTGGGCAT 350 360 370 380 590 400 Lowy-16L 35 TAGTCCCCAT CCTTTATTAAATAAATTCGA TGACACAGAA AATCCTACTG 400 hpv161.gb 351 TAGTGGCCAT CCTTTATTAA ATAAATTCGA TGACACAGAAAATCCTACTG 400 hpv1611.mri 551 TAGTGGCCAT CCTTTATTAA ATAAATTGGA TGACACAGAA AATGCTAGTG 400 40 420 450 440 450 Lowy-16L 401 CTTATGCAGC AAATGCAGGT GTGGATAAA GAGAATGTAT ATCTATGGAT 450 hpv1611.gb 401 CTATCCACC AAATCCACGT GTGGATAATA GAGAATGTAT ATCTATGGAT 450 hpv6.mr 401 CTTATCCAGC AAATCCACGT CTCGATAATA CAGAATGTAT ATCTATCGAT 450 FIG.2A U.S. Patent Dec. 12, 2000 Sheet 3 of 12 6,159,729 460 470 480 490 500 Lowy-16Ll 451 TACAAACAAA CACAATTGTG TTTAATTCGT TCCAAACCAC CTATAGGGGA 500 hpv 161.gb 45 TACAAACAAA CACAATTGTG TTTAATTGGT TCCAAACCAC CTATAGGGGA 500 hpv 1611.mr 451 TACAAACAAA CACAATTGTG TTTAATTCGT TCCAAACCAC CTATAGGGGA 500 50 520 530 540 550 Lowy-16Ll 501 ACACTCGGGC AAAGGATCCC CATGTACCAA TGTTCCAGTA AATCCACGTG 550 hpv1611.gb 50 ACACTGGGCC AAACGATCCC CATGTACCAA TGTTCCAGTA AATCCACCTG 550 hpv161.mr 501 ACACTGGCGC AAAGGATCCC CATGTACCAA TGTTCCAGTA AATCCACGTG 550 560 570 580 590 600 Lowy-16L1 551 ATTCTCCACC ATTAGACTTA ATAAACACAG TTATTCACGA TCGTGATATG 600 hpv 1611.gb 551 ATTGTCCACC ATTAGAGTTA ATAAACACAG TTATTCACGA TCGTGATATG 600 hpv161.mri 551 ATTCTCCACC ATTAGAGTTA ATAAACACAG TTATTCACGA TCGTGATATG 600 610 620 630 640 650 Lowy-16Ll 601 CTTGATACTG GCTTTCCTCC TATCGACTTT ACTACATTAC ACCCTAACAA 650 hpv 1611.gb 601 GTTOATACTC CCTTTCCTCC TATCGACTTT ACTACATTACAGCCTAACAA 650 hpv1611, mri 60 GTTGATACTG CCTTTCGTGC TATCGACTTT ACTACATTAC ACGCTAACAA 650 660 670 680 690 700 Lowy-16Ll 651 AACTGAACTT CCACTCGATA TTTGTACATC TATTTCCAAA TATCCAGATT 700 hpv1611.gb 65 AACTGAACTT CCACTCGATA TTTCTACATC TATTTCCAAA TATCCAGATT 700 hpv161.mri 65 AACTGAACTT CCACTCCATA TTTGTACATC TATTTCCAAA TATCCACATT 700 710 720 730 740 750 Lowy-16L1 70 ATATTAAAAT GCTCTCAGAA CCATATCCCG ACACCTTATT TTTTTATTTA 750 hpv 1611.gb 701 ATATTAAAAT CCTGTCAGAA CCATATCGCG ACACCTTATT TTTTTATTTA 750 hpv161.mri 701 ATATTAAAAT CGTGTCAGAA CCATATCCCG ACACCTTATT TTTTTATTTA 750 760 770 780 790 800 Lowy-16L1 751 CCAACCCAAC AAATGTTTCT TAGACATTTA TTTAATACCC CTCCTACTGT 800 hpv 1611.gb 751 CGAAGGGAAC AAATGTTTGT TAGACATTTA TTTAATAGCC CTCCTACTGT 800 hpv61.mr 75 CGAAGGGAAC AAATGTTTGT TAGACATTTA TTTAATACGG CTCGTGCTGT 800 810 820 830 840 850 lowy-16L1 801 TCGTGAAAAT GTACCAGACC ATTTATACAT TAAACGCTCT GCCTCTACTG 850 hpv 1611.gb 80 TCGTGAAAAT GTACCAGACG ATTTATACAT TAAAGGCTCT GGGTCTACTG 850 hpv1611 mri 80 TCCTGAAAAT GTACCAGACC ATTTATACAT TAAACGCTCT CCGTCTACTG 850 860 870 880 890 900 Lowy-16Ll 851 CAAATTTAGC CACTTCAAAT TATTTTCCTA CACCTAGTCG TTCTATGGTT 900 hpv161.gb 851 CAAATTTACC CACTTCAAAT TATTTTCCTA CACCAGTGG TTCTATGGTT 900 hpv1611.mri 851 CAAATTTAGC CAGTTCAAAT TATTTTCCTA CACCTAGTGG TTCTATGGTT 900 FIG.2B U.S. Patent Dec. 12, 2000 Sheet 4 of 12 6,159,729 90 920 950 940 950 Lowy-16L 901 ACCTCTGATG CCCAAATATT CAATAAACCT TATTGGTTAC AACGAGCACA 950 hpv161.gb 901 ACCTCTGATG CCCAAATATT CAATAAACCT TATTGGTTAC AACGAGCACA 950 hpv61.mr 901 ACCTCTCATG CCCAAATATT CAATAAACCT TATTGGTTAC AACGAGCACA 950 960 970 980 990 1000 Lowy-16L1 951 GGGCCACAAT AATCGCATTT GTTGGGGTAA CCAACTATTT GTTACTGTTG 1000 hpv1611.gb 951 GGGCCACAAT AATGGCATTT GTTGGGGTAA CCAACTATTT GTTACTGTTG 1000 hpv161, mri 951 GGGCCACAAT AATCGCATTT GTTCGGGTAA CCAACTATTT GTTACTGTTG 1000 1010 1020 1030 1040 1050 Lowy-16L1 1001 TTGATACTAC ACGCAGTACA AATATGTCAT TATGTGCTCC CATATCTACT 1050 hpv1611.gb 1001 TTGATACTAC ACGCAGTACA AATATGTCAT TATGTGCTGC CATATCTACT 1050 hpv161.mr 1001 TTGATACTAC ACGCAGTACA AATATGTCAT TATCTCCTGC CATATCTACT 1050 1060 1070 1080 1090 1100 Lowy-16L 1051 TCAGAAACTA CATATAAAAA TACTAACTTT AAGGAGTACC TACGACATGG 1100 hpv1611.gb 1051 TCAGAAACTA CATATAAAAA TACTAACTTT AACGAGTACC TACGACATGG 1100 hpv1611.mri 1051 TCAGAAACTA CATATAAAAA TACTAACTTT AAGGAGTACC TACGACATGG 1100 1110 120 1130 140 150 Lowy-16L1 1101 GGAGGAATAT GATTTACAGT TTATTTTTCA ACTGTCCAAA ATAACCTTAA 1150 hpv1611.gb 1101 CGAGGAATAT GATTTACACT TTATTTTTCA ACTCTCCAAA ATAACCTTAA 1150 hpv161.mr 1101 CGACCAATAT GATTTACAGT TTATTTTTCA ACTGTCCAAAATAACCTTAA 1150 1160 170 1180 1190 1200 Lowy-16L1 1151 CTCCAGACGT TATGACATAC ATACATTCTA TGAATTCCAC TATTTTGGAG 1200 hpv161.gb 1151 CTCCAGACGT TATGACATAC ATACATTCTA TGAATTCCAC TATTTTGGAG 1200 hpv1611.mr 1151 CTCCAGACGT TATGACATAC ATACATTCTA TGAATTCCAC TATTTTGGAG 1200 1210 1220 1230 1240 1250 Lowy-16L1 1201 GACTGGAATT TTGGTCTACA ACCTCCCCCA GGAGCCACAC TAGAAGATAC 1250 hpv161.gb 1201 CACTCCAATT TTGGTCTACA ACCICCCCCA CGAGGCACAC TAGAAGATAC 1250 hpv1611.mr 1201 GACTGGAATT TTGGTCTACA ACdCCCCCA CGAGCCACAC
Load more

Recommended publications
  • Proteomic Analysis of Meja-Induced Defense Responses in Rice Against Wounding
    Article Proteomic Analysis of MeJa-Induced Defense Responses in Rice against Wounding Laura Bertini 1,†, Luana Palazzi 2,†, Silvia Proietti 1, Susanna Pollastri 3, Giorgio Arrigoni 4,5, Patrizia Polverino de Laureto 2,* and Carla Caruso 1,* 1 Department of Ecological and Biological Sciences, University of Tuscia, 01100 Viterbo, Italy; [email protected] (L.B.); [email protected] (S.P.) 2 Department of Pharmaceutical and Pharmacological Sciences, University of Padova, 35131 Padova, Italy; [email protected] 3 Institute for Sustainable Plant Protection, National Research Council of Italy, Sesto Fiorentino, 50019 Florence, Italy; [email protected] 4 Department of Biomedical Sciences, University of Padova, 35131 Padova, Italy; [email protected] 5 Proteomics Center of Padova University and Azienda Ospedaliera di Padova, 35131 Padova, Italy. * Correspondence: [email protected] (P.P.d.L.); [email protected] (C.C.); Tel.: +39-049-8276157 (P.P.d.L.); Tel.: +39-0761-357330 (C.C.) † These authors contributed equally to this work. Received: 16 April 2019; Accepted: 20 May 2019; Published: 22 May 2019 Abstract: The role of jasmonates in defense priming has been widely recognized. Priming is a physiological process by which a plant exposed to low doses of biotic or abiotic elicitors activates faster and/or stronger defense responses when subsequently challenged by a stress. In this work, we investigated the impact of MeJA-induced defense responses to mechanical wounding in rice (Oryza sativa). The proteome reprogramming of plants treated with MeJA, wounding or MeJA+wounding has been in-depth analyzed by using a combination of high throughput profiling techniques and bioinformatics tools.
    [Show full text]
  • Physiological Changes in Barley Mlo-11 Powdery Mildew Resistance Conditioned by Tandem Repeat Copy Number
    International Journal of Molecular Sciences Article Physiological Changes in Barley mlo-11 Powdery Mildew Resistance Conditioned by Tandem Repeat Copy Number Cynthia Ge 1, Paula Moolhuijzen 1 , Lee Hickey 2 , Elzette Wentzel 1, Weiwei Deng 1, Eric G. Dinglasan 2 and Simon R. Ellwood 1,* 1 Centre for Crop and Disease Management, School of Molecular and Life Sciences, Curtin University, Bentley, WA 6102, Australia; [email protected] (C.G.); [email protected] (P.M.); [email protected] (E.W.); [email protected] (W.D.) 2 Centre Queensland Alliance for Agriculture and Food Innovation, The University of Queensland, St. Lucia, QLD 4069, Australia; [email protected] (L.H.); [email protected] (E.G.D.) * Correspondence: [email protected] Received: 28 October 2020; Accepted: 17 November 2020; Published: 20 November 2020 Abstract: Wild barley accessions have evolved broad-spectrum defence against barley powdery mildew through recessive mlo mutations. However, the mlo defence response is associated with deleterious phenotypes with a cost to yield and fertility, with implications for natural fitness and agricultural productivity. This research elucidates the mechanism behind a novel mlo allele, designated mlo-11(cnv2), which has a milder phenotype compared to standard mlo-11. Bisulphite sequencing and histone ChIP-seq analyses using near-isogenic lines showed pronounced repression of the Mlo promoter in standard mlo-11 compared to mlo-11(cnv2), with repression governed by 24 nt heterochromatic small interfering RNAs. The mlo-11(cnv2) allele appears to largely reduce the physiological effects of mlo while still endorsing a high level of powdery mildew resistance.
    [Show full text]
  • The Paxfoxo1s Trigger Fast Trans-Differentiation of Chick
    bioRxiv preprint doi: https://doi.org/10.1101/2020.05.18.097618; this version posted May 20, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. The PAXFOXO1s trigger fast trans-differentiation of chick embryonic neural cells into alveolar rhabdomyosarcoma with tissue invasive properties limited by S phase entry inhibition Short Title: PAX3/7FOXO1 drive neural cells into dormant alveolar rhabdomyosarcoma Gloria GONZALEZ CURTO1*, Audrey DER VARTANIAN2*, Youcef FRARMA*1, Line MANCEAU*1, Lorenzo BALDI*1, Selene PRISCO1, Nabila ELAROUCI3, Frédéric CAUSERET4,5, Muriel RIGOLET2, Frédéric AURADE2,6, Aurélien DE REYNIES3, Vincent CONTREMOULINS7, Frédéric RELAIX2, Orestis FAKLARIS7,8, James BRISCOE9, Pascale GILARDI-HEBENSTREIT1, Vanessa RIBES1# 1 Université de Paris, CNRS, Institut Jacques Monod, F-75006, Paris, France 2 Univ Paris Est Créteil, INSERM, EnVA, EFS, IMRB, F-94010 Créteil, France 3 Programme Cartes d'Identité des Tumeurs, Ligue Nationale Contre le Cancer, Paris, France 4 Institute of Psychiatry and Neuroscience of Paris, INSERM U1266, Université de Paris, Paris, France 5 Institut IMAGINE, Université de Paris, Paris, France 6 Sorbonne Université, INSERM, UMRS974, Center for Research in Myology, F-75013, Paris, France 7 ImagoSeine core facility of Institut Jacques Monod and member of France-BioImaging 8 Current address: MRI-CRBM imaging facility, CNRS, 34293 Montpellier cedex, France 9 The Francis Crick Institute, 1 Midland Road, London NW1 1AT, UK * these authors have equally contributed to the work # corresponding authors: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.05.18.097618; this version posted May 20, 2020.
    [Show full text]
  • Whole Genome and Transcriptome Sequencing of Matched Primary And
    www.nature.com/scientificreports OPEN Whole genome and transcriptome sequencing of matched primary and peritoneal metastatic gastric Received: 07 April 2015 Accepted: 04 August 2015 carcinoma Published: 02 September 2015 Zhang J.1,2,*, Huang J. Y.2,3,*, Chen Y. N.1,2,*, Yuan F.4, Zhang H.5, Yan F. H.5, Wang M. J.3, Wang G.6, Su M.6, Lu G.6, Huang Y.6, Dai H.6, Ji J.1,2, Zhang J.1,2, Zhang J. N.1,2, Jiang Y. N.1,2, Chen S. J.2,3, Zhu Z. G.1,2 & Yu Y. Y.1,2 Gastric cancer is one of the most aggressive cancers and is the second leading cause of cancer death worldwide. Approximately 40% of global gastric cancer cases occur in China, with peritoneal metastasis being the prevalent form of recurrence and metastasis in advanced disease. Currently, there are limited clinical approaches for predicting and treatment of peritoneal metastasis, resulting in a 6-month average survival time. By comprehensive genome analysis will uncover the pathogenesis of peritoneal metastasis. Here we describe a comprehensive whole-genome and transcriptome sequencing analysis of one advanced gastric cancer case, including non-cancerous mucosa, primary cancer and matched peritoneal metastatic cancer. The peripheral blood is used as normal control. We identified 27 mutated genes, of which 19 genes are reported in COSMIC database (ZNF208, CRNN, ATXN3, DCTN1, RP1L1, PRB4, PRB1, MUC4, HS6ST3, MUC17, JAM2, ITGAD, IREB2, IQUB, CORO1B, CCDC121, AKAP2, ACAN and ACADL), and eight genes have not previously been described in gastric cancer (CCDC178, ARMC4, TUBB6, PLIN4, PKLR, PDZD2, DMBT1and DAB1).
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2003/0198970 A1 Roberts (43) Pub
    US 2003O19897OA1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2003/0198970 A1 Roberts (43) Pub. Date: Oct. 23, 2003 (54) GENOSTICS clinical trials on groups or cohorts of patients. This group data is used to derive a Standardised method of treatment (75) Inventor: Gareth Wyn Roberts, Cambs (GB) which is Subsequently applied on an individual basis. There is considerable evidence that a significant factor underlying Correspondence Address: the individual variability in response to disease, therapy and FINNEGAN, HENDERSON, FARABOW, prognosis lies in a person's genetic make-up. There have GARRETT & DUNNER been numerous examples relating that polymorphisms LLP within a given gene can alter the functionality of the protein 1300 ISTREET, NW encoded by that gene thus leading to a variable physiological WASHINGTON, DC 20005 (US) response. In order to bring about the integration of genomics into medical practice and enable design and building of a (73) Assignee: GENOSTIC PHARMA LIMITED technology platform which will enable the everyday practice (21) Appl. No.: 10/206,568 of molecular medicine a way must be invented for the DNA Sequence data to be aligned with the identification of genes (22) Filed: Jul. 29, 2002 central to the induction, development, progression and out come of disease or physiological States of interest. Accord Related U.S. Application Data ing to the invention, the number of genes and their configu rations (mutations and polymorphisms) needed to be (63) Continuation of application No. 09/325,123, filed on identified in order to provide critical clinical information Jun. 3, 1999, now abandoned. concerning individual prognosis is considerably less than the 100,000 thought to comprise the human genome.
    [Show full text]
  • Comprehensive Analysis Reveals Novel Gene Signature in Head and Neck Squamous Cell Carcinoma: Predicting Is Associated with Poor Prognosis in Patients
    5892 Original Article Comprehensive analysis reveals novel gene signature in head and neck squamous cell carcinoma: predicting is associated with poor prognosis in patients Yixin Sun1,2#, Quan Zhang1,2#, Lanlin Yao2#, Shuai Wang3, Zhiming Zhang1,2 1Department of Breast Surgery, The First Affiliated Hospital of Xiamen University, School of Medicine, Xiamen University, Xiamen, China; 2School of Medicine, Xiamen University, Xiamen, China; 3State Key Laboratory of Cellular Stress Biology, School of Life Sciences, Xiamen University, Xiamen, China Contributions: (I) Conception and design: Y Sun, Q Zhang; (II) Administrative support: Z Zhang; (III) Provision of study materials or patients: Y Sun, Q Zhang; (IV) Collection and assembly of data: Y Sun, L Yao; (V) Data analysis and interpretation: Y Sun, S Wang; (VI) Manuscript writing: All authors; (VII) Final approval of manuscript: All authors. #These authors contributed equally to this work. Correspondence to: Zhiming Zhang. Department of Surgery, The First Affiliated Hospital of Xiamen University, Xiamen, China. Email: [email protected]. Background: Head and neck squamous cell carcinoma (HNSC) remains an important public health problem, with classic risk factors being smoking and excessive alcohol consumption and usually has a poor prognosis. Therefore, it is important to explore the underlying mechanisms of tumorigenesis and screen the genes and pathways identified from such studies and their role in pathogenesis. The purpose of this study was to identify genes or signal pathways associated with the development of HNSC. Methods: In this study, we downloaded gene expression profiles of GSE53819 from the Gene Expression Omnibus (GEO) database, including 18 HNSC tissues and 18 normal tissues.
    [Show full text]
  • 12P Deletion Spectrum Syndrome: a New Case Report Reinforces The
    Leyser et al. Molecular Cytogenetics (2016) 9:75 DOI 10.1186/s13039-016-0278-0 CASE REPORT Open Access 12p deletion spectrum syndrome: a new case report reinforces the evidence regarding the potential relationship to autism spectrum disorder and related developmental impairments Marcio Leyser1*, Bruno Leonardo Dias1, Ana Luiza Coelho1, Marcio Vasconcelos2 and Osvaldo J. M. Nascimento2 Abstract Background: Autism Spectrum Disorders (ASD) now encompass a broad heterogeneous group of people who present in the early developmental years with a wide range of social and communication deficits, which are typically also associated with complex repetitive behaviors and circumscribed interests. The target goal is to heighten readers’ perception into the trend to personalize the distinct autistic and related developmental conditions encompassing the 12p region. Case Presentation: This is a case-report of a 4-year-old male who presented the core signs of ASD, which were thought to be related to a rare 12p13.2 deletion. We further reviewed the literature in order to outline the related developmental conditions in the 12p region. Aside from this patient reported here, we found an additional number of 43 cases described in the medical literature since 1974, that have been related to deletions in the 12p region. However, to the best of our knowledge, none of the previous had been specifically linked to the 12p13.2 band. Conclusions: The 12p deletion spectrum is rarely described as part of the selective genotypes thought to be related to ASD. Even inside of a small piece of the puzzle, there might be ample variation in the behavioral and clinical phenotypes of children and adults presenting with this particular genetic profile.
    [Show full text]
  • RBL1 Polyclonal Antibody
    RBL1 polyclonal antibody Catalog # : PAB29467 規格 : [ 100 uL ] List All Specification Application Image Product Rabbit polyclonal antibody raised against recombinant human RBL1. Western Blot (Cell lysate) Description: Immunogen: Recombinant protein corresponding to human RBL1. Sequence: DAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFEKKRSFAPSTPLTG RRYLRE enlarge Host: Rabbit Immunohistochemistry (Formalin/PFA-fixed paraffin- Reactivity: Human embedded sections) Form: Liquid Purification: Antigen affinity purification Isotype: IgG enlarge Recommend Immunohistochemistry (1:500-1:1000) Immunofluorescence Usage: Immunofluorescence (1-4 ug/mL) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. Storage Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) Storage Store at 4°C. For long term storage store at -20°C. enlarge Instruction: Aliquot to avoid repeated freezing and thawing. Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. Datasheet: Download Applications Western Blot (Cell lysate) Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp Lane 3: Human plasma (IgG/HSA depleted) Lane 4: Human liver tissue Lane 5: Human tonsil tissue with RBL1 polyclonal antibody (Cat # PAB29467) at 1:250-1:500 dilution. Page 1 of 3 2017/2/16 Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) Immunohistochemical staining of human colon with RBL1 polyclonal antibody (Cat # PAB29467) shows moderate nuclear positivity in glandular cells at 1:500-1:1000 dilution. Immunofluorescence Immunofluorescent staining of human cell line U-2 OS with RBL1 polyclonal antibody (Cat # PAB29467) at 1-4 ug/mL concentration shows positivity in nucleus but excluded from the nucleoli.
    [Show full text]
  • Vacuolar Proteases of Saccharomyces Cerevisiae: Characterization of an Overlooked Homolog Leads to New Functional Insights
    Vacuolar Proteases of Saccharomyces cerevisiae: Characterization of an Overlooked Homolog Leads to New Functional Insights by Katherine Rose Parzych A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Molecular, Cellular, and Developmental Biology) in the University of Michigan 2017 Doctoral Committee: Professor Daniel J. Klionsky, Chair Professor Matthew R. Chapman Professor Anuj Kumar Professor Lois S. Weisman Katherine Rose Parzych [email protected] ORCID iD: 0000-0002-6263-0396 © Katherine Rose Parzych 2017 Dedication To my family, with love. ii Acknowledgements Thank you to the many mentors I have had along the way. Matt Chapman, who gave me my first laboratory technician job and started me on my path towards research. Tom Bernhardt and the whole Bernhardt lab at Harvard, where my graduate career began; I am forever grateful for the solid foundation you gave me as a scientist and the camaraderie and support that made working there a joy. Thank you to my thesis committee, Matt Chapman, Anuj Kumar, and Lois Weisman, for your guidance, support, and encouragement. Thank you to the members of the Klionsky lab, past and present. You have been wonderful colleagues and fabulous friends, and you’re all wickedly smart and talented. Special thanks to Molly Day, who became one of my closest friends. Thank you to my graduate mentor, Dan Klionsky. You have been such a supportive mentor throughout this long journey. When the Rim11 project collapsed and I struggled to find my next steps, you helped me to establish a new project and discover the beauty of vacuolar proteases so that I could achieve my goals of finishing strong and showing who I really am as a scientist.
    [Show full text]
  • Proteomic Analysis of Meja-Induced Defense Responses in Rice Against Wounding
    International Journal of Molecular Sciences Article Proteomic Analysis of MeJa-Induced Defense Responses in Rice against Wounding 1, 2, 1 3 4,5 Laura Bertini y, Luana Palazzi y, Silvia Proietti , Susanna Pollastri , Giorgio Arrigoni , Patrizia Polverino de Laureto 2,* and Carla Caruso 1,* 1 Department of Ecological and Biological Sciences, University of Tuscia, 01100 Viterbo, Italy; [email protected] (L.B.); [email protected] (S.P.) 2 Department of Pharmaceutical and Pharmacological Sciences, University of Padova, 35131 Padova, Italy; [email protected] 3 Institute for Sustainable Plant Protection, National Research Council of Italy, Sesto Fiorentino, 50019 Florence, Italy; [email protected] 4 Department of Biomedical Sciences, University of Padova, 35131 Padova, Italy; [email protected] 5 Proteomics Center of Padova University and Azienda Ospedaliera di Padova, 35131 Padova, Italy * Correspondence: [email protected] (P.P.d.L.); [email protected] (C.C.); Tel.: +39-049-8276157 (P.P.d.L.); Tel.: +39-0761-357330 (C.C.) These authors contributed equally to this work. y Received: 16 April 2019; Accepted: 20 May 2019; Published: 22 May 2019 Abstract: The role of jasmonates in defense priming has been widely recognized. Priming is a physiological process by which a plant exposed to low doses of biotic or abiotic elicitors activates faster and/or stronger defense responses when subsequently challenged by a stress. In this work, we investigated the impact of MeJA-induced defense responses to mechanical wounding in rice (Oryza sativa). The proteome reprogramming of plants treated with MeJA, wounding or MeJA+wounding has been in-depth analyzed by using a combination of high throughput profiling techniques and bioinformatics tools.
    [Show full text]
  • Promoter Mutations That Allow Nifa-Independent Expression Of
    Proc. Nati. Acad.. Sci. USA Vol. 80, pp. 5812-5816, October 1983 Biochemistry Promoter mutations that allow nifA-independent expression of the nitrogen fixation nifHDKY operon (nitrogenase genes/Klebsielia pneumoniae/nifH'-'laeZ fusion/cruciform structure) R. BITOUN*, J. BERMAN*, A. ZILBERSTEIN*, D. HOLLAND*, J. B. COHEN+, D. GIVOLt, AND A. ZAMIR* *Biochemistry Department and tDepartment of Chemical Immunology, Weizmann Institute of Science, Rehovot 76100, Israel Communicated by Michael Sela, May 24, 1983 ABSTRACT The nifHDKY operon of KlebsieUa pneumoniae regulatory region of the nif operon and included insertion se- encodes 'for structural polypeptides of nitrogenase and requires quence 2 (IS2) insertions, a sequence duplication, and a base the nifA gene product for transcription. Mutations that allow tran- substitution. Nucleotide sequence analysis of two mutants in- scription of the niJHDKY operon in absence of the nifA gene dicated that sequences included in the 41 base pairs (bp) up- product were characterized in plasmids containing the regulatory stream to the coding sequence of nifH function in regulation region of nifHDKY and nifH fused in:phase to lacZ. -B-Galacto- of the nifoperon. Furthermore, the results suggest that an in- sidase activity served as a measure for nifHWexpression. Most mu- verted repeat within this region, which theoretically could gen- tations were located in the nifregulatory region and included in- - erate a cruciform structure, is involved in .the transcriptional sertion sequence 2 (IS2) insertions, a sequence duplication, and a control- by nifA. base substitution. In Escherichia coli, 3-pgalactosidase activity ex- pressed from the mutant plasmids in the absence of MfA was 6- MATERIALS AND METHODS 30% of the.nifA-activated, parental level.
    [Show full text]
  • Genome-Wide CNV Investigation Suggests a Role for Cadherin, Wnt, and P53 Pathways in Primary Open-Angle Glaucoma Valeria Lo Faro1,2, Jacoline B
    Lo Faro et al. BMC Genomics (2021) 22:590 https://doi.org/10.1186/s12864-021-07846-1 RESEARCH Open Access Genome-wide CNV investigation suggests a role for cadherin, Wnt, and p53 pathways in primary open-angle glaucoma Valeria Lo Faro1,2, Jacoline B. ten Brink2, Harold Snieder3, Nomdo M. Jansonius1 and Arthur A. Bergen2,4,5* Abstract Background: To investigate whether copy number variations (CNVs) are implicated in molecular mechanisms underlying primary open-angle glaucoma (POAG), we used genotype data of POAG individuals and healthy controls from two case-control studies, AGS (n = 278) and GLGS-UGLI (n = 1292). PennCNV, QuantiSNP, and cnvPartition programs were used to detect CNV. Stringent quality controls at both sample and marker levels were applied. The identified CNVs were intersected in CNV region (CNVR). After, we performed burden analysis, CNV-genome-wide association analysis, gene set overrepresentation and pathway analysis. In addition, in human eye tissues we assessed the expression of the genes lying within significant CNVRs. Results: We reported a statistically significant greater burden of CNVs in POAG cases compared to controls (p- value = 0,007). In common between the two cohorts, CNV-association analysis identified statistically significant CNVRs associated with POAG that span 11 genes (APC, BRCA2, COL3A1, HLA-DRB1, HLA-DRB5, HLA-DRB6, MFSD8, NIPBL, SCN1A, SDHB, and ZDHHC11). Functional annotation and pathway analysis suggested the involvement of cadherin, Wnt signalling, and p53 pathways. Conclusions: Our data suggest that CNVs may have a role in the susceptibility of POAG and they can reveal more information on the mechanism behind this disease.
    [Show full text]