2018 annual report
Sydney Youth Orchestras is supported by the NSW Government through Create NSW. general manager’s report 4 syo strings program 20 opportunity 38 chair’s report 5 stage four 22 Live at Level 28 40 stage three 23 about us 6 The Opportunity Fund: stage two 24 The Impact 41 activity 8 stage one 25 enterprise 42 young people at SYO 9 community engagement 26 the big busk 44 diversity 10 artistic program & collaborations 30 excellence 46 our orchestras 12 2018 in review 32 chair’s dinner 48 the sydney youth orchestra 14 how is it possible? 36 our partners 50 syo philharmonic 16 we support the sound our donors 51 symphonic wind orchestra 17 of the future in 3 ways 37 peter seymour orchestra 18 our people 52 western sydney youth financial report 54 orchestra 19 connect with us 81 general manager’s report chair’s report
I am our Australian community, whatever garnering support for scholarships, SYO exists and awareness. The safety of our particularly Christopher Lawrence, pleased career path they follow. masterclasses, and regional touring because young people is paramount and Alexander Briger, James Pensini to present - important initiatives in creating of our belief we will continue to work with our and our dedicated team of As another group of alumni enter Sydney Youth an accessible SYO. The Big Busk, that every young stakeholders to ensure all SYO conductors who enthusiastically into the world of professional music Orchestras’ Annual Report for apart from being a fundraising musician deserves an opportunity musicians are safe. provide their wisdom to our young making, I am delighted to think of 2018. It was a year that further success, was an immense boost to to explore their creative potential minds. Just as in an orchestra, the former SYO members already 2018 saw more audiences sharing affirmed SYO’s place as the premier SYO’s public profile, achieving news though music. The path for a SYO relies on teamwork and making waves among orchestras in our music. Our children’s concert orchestral education and training coverage across major television young musician is a long discipline, commitment. The SYO staff are Australia and the world. It is rare to series Meet The Orchestra, together organisation in NSW. networks and newspapers. a road that needs navigation remarkable and I would like to attend a concert by a professional with Kid’s Music Café in partnership and support. Providing sustained thank them for working tirelessly to Our artistic program was led again ensemble, whether a chamber All of this is in line with a Board with Sydney Opera House offered engagement from childhood to bring our vision into reality. I’d like by Chief Conductor, Alexander group or a full symphony orchestra, decision some years ago that unique experiences for our littlest adulthood is unique to SYO, and is to especially thank our donors and Briger AO. Alex’s tenure with SYO without seeing at least one and SYO’s long term survival hinged on music lovers. Our most ambitious something special we take pride in. corporate partners for your belief over the past four years has resulted frequently a high percentage of becoming financially independent project took place on one day, This report is a celebration of the in us and your investment in our in a significantly higher standard SYO alumni. It is a truly fulfilling at the same time as keeping fees during the inaugural The Big Busk, dedication of the young musicians journey. Your generosity is a vote of playing, most evident in our SYO and satisfying experience to watch affordable. SYO Summer School, a consisting of 27 free performances at the centre of this wonderful in confidence for our organisation flagship concerts, and reflected our young musicians’ careers week long open program now in its in Sydney and Western Sydney to organisation. Our artistic program and the young people we support. in the accolades we have received bloom from their beginnings in our third year, is a growing factor in our over 50,000 estimated audience is testament to their passion for from both audiences and reviewers. orchestras to joining the orchestras revenue mix. members. This monumental event I would also like to thank another music making. The hundreds Mid-year, we were delighted to of the world. was a vehicle to celebrate our very important part of the team, The main challenge for SYO of hours they commit to music welcome Christopher Lawrence as young musicians, and reach greater our SYO parents. You entrust us to Together with making music, the remains the need for a home of is astonishing. From our Stage our Chief Artistic Advisor. A classical heights of awareness, with coverage guide your young people along a task of running the business of our own. Over the last 10 years 1 players as young as 6, to the musician, author and conductor, on major television networks, radio, creative path and the magnitude SYO responsibly and sustainably we have been forced to find new pre-professionals of The Sydney Christopher has been best known as and news sites reaching 3.22M of your faith is not lost on us. is a critical part of our success, rehearsal space four times, that is, Youth Orchestra, SYO is a place a broadcaster on ABC Classic. The views, a record for SYO. and no easy achievement. 2018 on an average of every 18 months. for them at every point in their Finally, I would like to thank all breadth and depth of his musical was Mia Patoulios’ first full year in That is simply unacceptable and development. Reaching across the state, our our young musicians for your knowledge is adding enormously to the position of General Manager. will be a significant priority for the Summer School open program saw energy, dedication and passion. SYO’s ability to produce innovative I am proud to say that 2018 was Through her expert leadership, Board in 2019. a significant increase in participants You continually astound me with and challenging programs for our incredible, with SYO reaching more and together with the support of for an intensive week of music your ability, commitment and young musicians. As Chair, I would especially like to young musicians than ever. Our her staff, SYO has finished 2018 making, and for the first time adventurous attitude.. acknowledge the SYO Board of core program has grown at our new The Board’s warm thanks are also with a pleasing financial result. we supported regional musicians Directors for their remarkable work home at Santa Sabina College. This SYO stands at the cusp of a new due to our team of conductors The Board congratulates Mia on a through travel, accommodation in 2018. Their careful guidance move has been critical in supporting strategic plan in 2019, and looks for the dedication they display, stellar first year. and scholarships. Three of our has been instrumental in steering our growth and we are grateful to ahead towards its 50th anniversary weekly, to train SYO’s 12 additional orchestras toured regionally, A not-for-profit organisation the strategic direction of this Principal Dr Maree Herrett and her in 2023. As we finish this age and orchestras and ensembles, enabling solidifying a commitment to visit like SYO cannot survive without ambitious enterprise. Each of staff for welcoming us. enter another, I am excited to every one of our 550 students to annually, and we saw the launch of community supporters and these extraordinary volunteers is lead such a vibrant organisation, learn not only to play notes of music SYO continued its commitment the South Coast hub in Bermagui advocates, and I am pleased to say deeply committed to SYO, and I where the outcome of our work but the discipline and teamwork as a Child Safe Organisation with in partnership with the Four Winds that SYO’s reach hit new heights thank them for their counsel and will reverberate and have lasting they need as they progress from the introduction of processes Festival. in 2018. Through our annual events expertise. impact for lifetimes to come. our most junior ensembles to the reflecting our change in status as a and concerts we connected with There are countless people I’d like senior orchestras. Above all, SYO’s Mandatory Reporting Organisation. our loyal group of passionate to acknowledge. First, the SYO commitment to excellence ensures JAN BOWEN AM They reinforce the importance of MIA PATOULIOS supporters and have found many Board led by Chair Jan Bowen, that our young musicians are also Chair, Sydney Youth Orchestras. reporting, vigilance, transparency General Manager, Sydney Youth new ones. Live at Level 28 and The whose commitment to SYO is equipped to make a contribution to and communication, and provide Orchestras Chair’s Dinner were pivotal events in exceptional. Our artistic staff, a renewed focus on staff training
4 5 about us
Sydney Youth Orchestras is In 2018, SYO brought together We celebrate and recognise the our vision our mission syo strategic goals NSW’s premier orchestral over 500 of the most talented thousands of young musicians To educate and nurture young SYO is a place where, through EXCELLENCE: training and education musicians aged 6 – 25 years in who have nurtured their love of people to achieve musical music, talented young Nurturing artistic talent and provider. Founded as a single 12 orchestras, offering intensive orchestral music, learnt important excellence through a structured instrumentalists come together to delivering great education orchestra in 1973 by visionary ensemble training and a dynamic life skills, had formative experiences program of orchestral training and program of live performances. Our and made lifelong friends in SYO. grow, to learn and to contribute to music educator Peter Seymour, performance. PROFESSIONALISM: musicians are from all over Sydney Australia’s cultural landscape. SYO has shaped Australian Continually improving our and Regional NSW, representing culture by training thousands business systems to best-practice over 200 communities and 300 of young musicians. contemporary standards schools and universities. SYO prides itself on offering an educational ENGAGEMENT: pathway progressing members Creating a consistent reliable from the primary, secondary, and experience for all in contact with tertiary segments through to the SYO pre-professional stage. Countless OPPORTUNITY: alumni are found in Australian and Being entrepreneurial and planning International ensembles. for increased revenue and business growth
6 7 activity young people at SYO Whale Beach Dubbo Mosman 1 Sydney Youth Orchestras repertoire is studied and performed. tutors, staff and musicians – to Mudgee Chatswood 2 is an organisation which This leaves no space for thoughts, be advocates for the vision and North 3 1 Lane Cove 3 is wholly dedicated to the words or physicals acts which are mission of SYO. We are proud to Sydney Narrabeen 1 advancement, support and not in the best interests of SYO’s be unequivocally resolute in our Orange 2 Forbes Double 3 young musicians. Nor is there space requirement for a best-practice, 1 wellbeing of young people who 1 Bay Elizabeth are passionate about music. in any aspect of the SYO program child-safe organisation. 1 Bay Watsons where negative or unacceptable Bay For more information on policies 1 We strive to create an environment behaviour is allowed. We encourage Sydney CBD and procedures that ensure the Moore 1 where talent is acknowledged, hard all who interact with our program Parramatta Balmain 78 Park safety of our young musicians, work is rewarded, and the very – students, parents, friends, 4 1 1 Centennial greatest music from the classical please visit our website. Penrith Park volunteers, teachers, conductors, 1 Spring- 1 Moruya wood Newtown Nowra 1 1 Leichhardt 1 1 Liverpool Annandale 1 1 1 Pambula SYO Bodalla 1 Strathfield Bermagui child safe 1 Canberra 17 Bellview 6 policy Hill Gilgandra 1 1 1
SYO SYO child safe annual program young 22 activities in Regional NSW rosh 540 musicians 22 guidelines guidelines 12 orchestras 86 people employed activities (concerts, events, attendance SYO staff, SYO SYO workshops, commercial and participation contractors & reportable participant 498 opportunities) 75,000 volunteer code conduct code of of conduct procedures conduct 52 activities in Western Sydney 4,830,060 digital and broadcast reach
8 9 diversity languages other than English are spoken in 167 households
Armenian 2 Macedonian 2 Chinese Cantonese 21 Portugese 3 Chinese Mandarin 45 Russian 4 Chinese unspecified dialect 10 age ranges Serbian 1 Croatian 1 Shanghainese 2 Farsi/Persian 2 Sinhala 1 aged 6: 2 aged 8: 5 aged 10: 36 aged 15: 53 aged 20: 14 aged 23: 6 aged 7: 5 aged 9: 27 aged 11: 39 aged 16: 49 aged 21: 14 aged 24: 3 French 2 Spanish 6 aged 12: 48 aged 17: 63 aged 22: 12 aged 25: 3 German 4 Swedish 2 aged 13: 44 aged 18: 42 aged 14: 44 aged 19: 31 Greek 1 Tagalog 5 Indonesian (Bahasa or other) 7 Tamil 2 Italian 1 Turkish 4 Japanese 13 Vietnamese 8 Korean 18
where we are from education level
Upper
Northern North Shore 68 Suburbs 86 beyond Sydney 51 26 Inner West Northern Central Coast - 4 5 : 10 Central Tablelands - 2 101 Beaches and 52 209 ry tia Central West Slopes - 1 Forest District er 05 Hunter Valley - 1 t : 3 36 ry Mid North Coast - 1 Sydney da Murray & Riverina - 1 Lower n city co Newcastle - 4 North Shore e 0 s 12 Southern Highlands - 3 4 : 59 ry Wollongong & 79 a Illawarra - 9 Greater im 0 294 r Western Sydney Southern 1 p : members also play Sydney r 62 1 e 15 h in their school or 40 t 102 Blue Mountains - 14 11 o university ensemble Canterbury/Bankstown - 23 St George - 22 3 Hawkesbury - 3 Sutherland - 18 Eastern Hills District - 5 Suburbs Liverpool/Fairfield - 2 Macarthur/Camden - 4 61 • public primary • independent Parramatta - 6 school Western Sydney - 19 • tertiary • public high undergraduate school • tertiary • selective public post graduate high school • other • home schooled • unknown
10 11 our orchestras our orchestras our orchestras our
the sydney youth orchestra Conductor: Alexander Briger AO
members concerts 66 Bernstein Candide, Sydney Opera House age range Bruckner Symphony No. 8, Verbruggen 16-25 Hall, Sydney Conservatorium of Music average age Celebrating Strauss, Verbruggen Hall, 20 Sydney Conservatorium of Music performances 7 Copland by the Sea, Four Winds Sound Shell, Bermagui The Sydney Youth Orchestra Mahler Symphony No.10, Adagio & “Joining the SYO has been is SYO’s most senior orchestra Stravinsky Firebird Suite, Verbruggen Hall, Sydney Conservatorium of Music one of the best decisions and the place to learn the I’ve made for my pathway valuable practical skills that repertoire into the musical profession. transform students into BERNSTEIN Candide It has given me unique professionals. The Sydney COPLAND Appalachian Spring for 13 performance opportunities, Youth Orchestra provides Musicians including at Sydney Opera outstanding intensive HAYDN Horn Concerto No.2, Mvt. II, Adagio House. I have made many training and performance MAHLER Symphony No.10, Adagio contacts and friends with opportunities that lead to the SCHUBERT Octet in F Major D803 Mvt. II, continued development of Adagio people I’ve met through SYO, each musician’s technical and STRAUSS Don Juan I’ve been given opportunities artistic excellence. Programs STRAUSS Excerpts from Der Rosenkavalier to work with and learn from are generally broad ranging, STRAVINSKY Firebird Suite (1911 Suite) great conductors and music but the SYO Orchestral STRAUSS Four Last Songs educators as well as being Training Framework stipulates challenged to be the best a focus on repertoire from the musician I can be.” Romantic and 20th century –Josh periods, as those significant symphonic works most often provide the complexity that will appropriately challenge these advanced musicians.
14 15 our orchestras our orchestras our
syo philharmonic symphonic wind orchestra Conductor: Brian Buggy OAM Conductor: James Pensini
members concerts members concerts 68 Autumn Symphonic Orchestral Showcase, 61 Autumn Symphonic Orchestral Showcase, Riverside Theatres, Parramatta Riverside Theatres, Parramatta age range age range 13-23 European Winter, Eugene Goossens Hall, 12-22 Mosman Concert Series, Blessed average age Ultimo average age Sacrament Church, Mosman 18 European Winter, Llewellyn Hall, Canberra 16 Summer Showcase, Verbrugghen Hall, performances Sydney Conservatorium of Music 10 performances Mahler Symphony No.10, Adagio & 11 Stravinsky Firebird Suite, Verbruggen Hall, Symphonic Orchestral Program Camp SYO’s second most Sydney The Symphonic Wind Orchestra Concert, Sydney Academy of Sport and “My experience with SYO has Recreation, North Narrabeen “Playing with the SYO has senior ensemble, the SYO Mosman Concert Series, Blessed was established in 2005 and is been the most rewarding Sacrament Church, Mosman Winter Showcase, Monte Sant’Angelo, been the best experience for Philharmonic, is a full- an opportunity for many young North Sydney and stimulating thing for me Symphonic Orchestral Program Camp me. All of the conductors, as a young musician. The scale symphony orchestra Concert, Sydney Academy of Sport and wind, brass and percussion tutors and staff are so Recreation, North Narrabeen repertoire breadth of opportunities I comprising strings, harp, musicians from across NSW encouraging. The playing Tchaikovsky Symphony No.4, Balmain to extend their skills. SWO AGAPKIN A Slavic Farewell have been offered through triple woodwind, brass and of your instrument excels percussion. Musicians learn Town Hall rehearses and performs a BERNSTEIN Four Dances from West Side SYO has been highlight of my Story rapidly, like no other group I orchestral technique and Together Live, The Concourse, Chatswood diverse range of repertoire musical experience and has COATES The Dam Busters know. It is wonderful to get ensemble skills with great Together Live, IPAC Theatre, Wollongong from popular 20th century film shaped me into the musician works of the 19th and 20th Winter Showcase, Monte Sant’Angelo, scores and jazz classics, as well GRAINGER Irish Tune form County Derry together with an awesome I am today. I am proud to be century. This orchestra is North Sydney as core orchestral repertoire GRAINGER Molly On The Shore lot of people who just want a member of Sydney Youth frequently involved in the repertoire by composers who wrote HOLST Mars and Jupiter from The Planets to produce and perform Orchestras.” major presentations by The ADAM Giselle Act II specifically for this type of JONES Streets of Forbes beautiful music. The people –Mia Sydney Youth Orchestra where KOEHNE Powerhouse ensemble. SMITH Declaration Overture are great, the music is the SYO Philharmonic performs MINKUS Paquita WAGNER Elsa’s Procession to the Cathedral fantastic. Heaps of friends to the overture to the concert. from Lohengrin RAVEL Bolero be made.” WALTON Crown Imperial RIMSKY-KORSAKOV Russian Easter Festival –Sean Overture, Op. 36 SIBELIUS Symphony No.2 TCHAIKOVSKY Symphony No.4
16 17 18 –Isabeau opportunity.” for allowing us this amazing everyone’s smiles. Thank SYO off, and the joy was evident in hours of rehearsing had paid in Mudgee. We could tell our performance our after up light to seeing be everyone’s faces my favourite would part have so many highlights on tour, is priceless. While there were have that same experience me, seeing regional students joined that same year! For I loved it so much that I came to my hometown, tours. Iremember when SYO “I’ve always loved the regional our orchestras Haydn, and Beethoven. Mozart specifically symphoniesthe of repertoire, romantic early working classical on and while – skills communication and listening reading, sight and symphonic form, style of ensemble skills, understanding technique, instrumental of orchestral training – Students learn the foundations major orchestral repertoire. their first chance to tackle many of our musicians get Seymour Orchestra is where the Peter Association, the Sydney Youth Orchestra the founder after of Named 13 16 14-19 45 seymourpeter orchestra Conductor: John Ockwell
performances average age age range members STAMITZ Concerto for Viola in D Major DMajor in Viola for STAMITZ Concerto No. 4“Tragic”SCHUBERT Symphony Figaro of to Marriage the MOZART Overture HAYDN No. 101 Symphony “Clock” HAYDN No. Eb 99 Major in Symphony HAYDN No. 94 Symphony “Surprise” Funebre II. Marcia – No. Eb Major 3in Symphony BETTHOVEN No. Cminor 3in Concerto Piano BEETHOVEN repertoire Sydney North Winter Showcase Narrabeen Recreation, North Concert Camp Program Orchestral Symphonic Orchestra The Meet Orchestra The Meet Hush for Heart Strathfield Classical Discovery Theatres, ParramattaRiverside Autumn Symphonic Orchestral Showcase concerts , Sydney Academy of Sport and and Sport of Academy , Sydney , City Recital Hall, Sydney Sydney Hall, Recital , City , Monte Sant’Angelo, , Santa Sabina College, College, Sabina , Santa , Leichardt Town , Leichardt Hall Gallery Art , Mosman , opportunities theyopportunities can seize. where musicians live and the removes the barriers between in Western Sydney and music teachers and schools excellent work undertaken by thecomplements already aspirational musicians, WSYO to the of needs young and respondingcommunity in consultation with the local Sydney.Western Established musicians from across together young the best in Parramatta, WSYO brings Launched in 2017 and based 14 16 13-21 28 Conductor: James Pensini western sydney youth orchestra
performances average age age range members VIVALDI Four Seasons The No.MOZART 35 Symphony ‘Haffner’ Overture Hebrides MENDELSSOHN MANUEL-MIRANDA Selections from Moana Frozen from LOPEZ Selections No. 7 BEETHOVEN Symphony repertoire Sydney North Winter Showcase Centre Arts Festival West Way Out Narrabeen Recreation, North Concert Camp Program Orchestral Symphonic Music of Conservatorium Sydney Summer Showcase Annan Mt Garden, Orchestra The Meet Hub Community and Theatre Orchestra The Meet concerts , Sydney Academy of Sport and and Sport of Academy , Sydney , Monte Sant’Angelo, , Verbrugghen Hall, Hall, , Verbrugghen , Australian Botanic Mountains , Blue , Casula Powerhouse Powerhouse , Casula –James encouraged to keep playing.” me feeling enthusiastic and Everyone atWSYO leaves to play and perform music. players who like me want togethergetting with awesome players and the part best tutorials with professional working with our conductor, to rehearsals each week and own playing. forward look I players has help broaden my Western Sydney and access to to music instrumental to bring opportunity The experience. has been an amazing to lead and play with WSYO “Being given the opportunity 19 our orchestras our orchestras our orchestras our
The SYO Strings Program, with its carefully selected repertoire, is designed to provide a progressive pathway for talented, young string musicians to hone ensemble skills, sight reading, aural awareness and general string technique. Highly trained and respected conductors rehearse these ensembles each week, combined with regular sectional tutorials taken by professional string players. syo strings program The SYO Strings Program is divided into 4 stages comprised of 7 ensembles. Stage 1 ensembles Corelli and Vivaldi; Stage 2 ensembles Mozart and Haydn; Stage 3 ensembles Greig and Brahms; and Stage 4 ensemble Sinfonia. 22 –Sakura have been offered.” forever grateful for everything I accommodating, and I’ll be nothing encouraging but and SYO community has been friends along the way. The also made some really great composers and tutors, and Australia’s conductors, finest have also been exposed to for someone of my level, I imaginable dreamed never I experience in playing repertoire Not only have Igained alot of exceeded all my expectations. wow, this last year has knowing what to expect. But, “I came into SYO not really our orchestras technical skills. of orchestral playing and strong understanding mature a requiring baroque to late romantic periods, explore core repertoire from the Program. Players in Stage Four to the Symphonic Orchestral Stage Four is the springboard 5 15 11-20 56 stage four Conductor: Brian Buggy performances average age age range members OAM SINFONIA SCHUBERT Symphony No. 8“Unfinished” SCHUBERT Symphony Royal the Fireworks for Music HANDEL 1 Suite WaterHANDEL Music No. 8 Dance Slavonic DVORAK No. 5&6 Dances Hungarian BRAHMS BUGGY Integration Overture No.1 Suite BIZET Carmen repertoire Sydney North Winter Showcase Music of Conservatorium Sydney Summer Showcase Music of Spring Showcase Showcase Fundamentals Orchestral Autumn concerts , Santa Sabina College, Strathfield College, Sabina , Santa , Sydney Conservatorium Conservatorium , Sydney , Monte Sant’Angelo, , Verbrugghen Hall, Hall, , Verbrugghen knowledge of style.. ensemble skills and sophisticated technical proficiency, superior engaging repertoire, demanding and challenging increasingly of musicians will discover arange aural skills. These and technical playing while extending their develop their ensemble players the chance to further Stage Three offers intermediate 6 13 9-17 75 Conductors: Rachel Pogson and Peter Corkill three stage performances average age age range members GRIEG AND BRAHMS AND GRIEG SCULTHORPE Little Suite for Strings Strings for Suite SCULTHORPE Little K136 DMajor in MOZART Divertimento St.HOLST Paul’s Suite Symphony Simple BRITTEN Typewriter The ANDERSON repertoire Sydney North Winter Showcase Music of Conservatorium Sydney Summer Showcase of Music Spring Showcase Showcase Fundamentals Orchestral Autumn concerts , Santa Sabina College, Strathfield College, Sabina , Santa
, Sydney Conservatorium Conservatorium , Sydney , Monte Sant’Angelo, , Verbrugghen Hall, Hall, , Verbrugghen –Philip experience.” I am forever thankful for the am constantly creating more. have made many friends and years Ihave been atSYO I satisfaction. Over the two and Iget agreat sense of music becomes beautiful I finally overcome them, the theirhad challenges, when All the music Iplayed have group with the same goals. belong, and Iam of a part aspiring musicians. Ifeel I is exciting to play with other to attend every practice. It atmosphere making me eager staff create a welcoming conductors, students, and gateways in music. The “SYO has revealed many 23 our orchestras 24 –Nelum friends.”wonderful in music, and also make music and show your talent yourself, amazing some play a really good place to express “Sydney Youth Orchestras is our orchestras
deeper stylistic understanding. stylistic deeper with markings interpret musical challenging rhythms, and sight read, progressively master to effectively and confidently and refine the skills required complex orchestral concepts to increasingly introduced Students in Stage Two are 7 12 8-17 76 Conductors: Joanne Waples and Kathryn Crossing stage two performances average age age range members MOZART HAYDN AND for Strings (arr. Strings for Meyer) TCHAIKOVSKY Serenade from Russe Theme 1(arr.Mvmt McCashin) – No. 8“Unfinished” SCHUBERT Symphony (arr.PIAZZOLA Libertango Kazis) FAURE Pavane (arr. Philips) (arr. Meyer) No. 5 Symphony from BEETHOVEN Finale 1 No. 5–Mvmt Concerto BACH Brandenburg repertoire Sydney North Winter Showcase Music of Conservatorium Sydney Summer Showcase of Music Spring Showcase Foyer House Opera Concert Pre Candide Bernstein Showcase Fundamentals Orchestral Autumn concerts , Santa Sabina College, Strathfield College, Sabina , Santa , Sydney Conservatorium Conservatorium , Sydney , Monte Sant’Angelo, , Verbrugghen Hall, Hall, , Verbrugghen , Sydney , Sydney markings. interpret basic dynamic and style and tonal skills, and learn to Stage will One develop rhythmic technical requirements, players in exposure to music with arange of vital ensemble skills. Through instrumental and learn section are introduced to playing in an Youngexperience. musicians players gain their first ensemble Stage is One where many young 4 10 6-12 69 Conductors: Dr. Irina Andreeva and Heloise Meisel stage one performances average age age range members CORELLI AND VIVALDI AND CORELLI (arr. Hopkins) Suite TELEMANN Baroque (arr. Manookian) No. World” 9“New Symphony DVORAK (arr. Manookian) No. 5 BEETHOVEN Symphony repertoire Music of Conservatorium Sydney Summer Showcase, Verbrugghen Hall, Music of Conservatorium Spring Showcase, Music Workshop, Sydney Sydney North Winter Showcase, Monte Sant’ Angelo, Music of Conservatorium Sydney Suite, Verbruggen Firebird Stravinsky Hall, Mahler Symphony No.10, Adagio & Sydney Candide, Bernstein Opera House Strathfield Showcase, Santa College, Sabina Fundamentals Orchestral Autumn concerts
–Dara Dance.”Soldiers’ favourite piece is Russian are my favourite and my Orchestra. Russian composers conductor in Sydney Youth or aviolin teacher or a I want to apaediatrician be the piano too. When Igrow up baby and my passion. Iplay it didn’t work. The violin is my tried to talk me out of it but the present Iwanted. Mum fifth birthday. The violin was “I started playing violin on my
25 our orchestras community engagement syo state south coast concerts at Pambula and Bodalla. “The best part of the summer anzac day football don’t stop the music 7 – 8 April WSYO’s final performance was workshop would have to SYO State, SYO’s regional 25 April November 17 at the Youth Music Festival at outreach and engagement 14 musicians from The Sydney be playing on stage in the Four Winds. This festival brought The Symphonic Wind The Peter Seymour Orchestra program, is designed to Youth Orchestra travelled to Verbrugghen Hall, at the together over 1000 pupils from Orchestra performed to over performed at Centennial Park at increase participation and Bermagui to run workshops Sydney Conservatorium of local primary schools with a 40,000 people at the ANZAC Day ABC’s Family Fun Day, celebrating access to orchestral music and perform as part of SYO’s Music. It was the opportunity variety of musical ensembles NRL game between the Roosters the launch of the ABC’s landmark across NSW. In 2018, SYO South Coast Hub. After an of a life time, and a moment including the Western Sydney and the Dragons for the ANZAC new TV series Don’t Stop The musicians toured to the interactive performance at in my life that I will always Youth Orchestra. Commemorative Service. Music, which promotes the Central West and twice to the Moruya High School, they remember with amazement. I transformative powers of music South Coast of NSW. headed to Bermagui to rehearsal syo summer school hope I get the opportunity to heart for hush in education. The day included Copland’s Appalachian Spring at central west 8-12 January come back next year.” 21 May musical performances, workshops the beautiful Four Winds. Local 31 May – 3 June –Charlotte, Violinist, Dubbo for kids, giveaways, appearances musicians of the South Coast SYO Summer School was a The Peter Seymour Orchestra from ABC personalities, and the The Peter Seymour Orchestra and participated in a workshop with success with many young featured in the ‘Heart for Hush’ Salvation Army collecting second- Symphonic Wind Orchestra toured SYO Chief Conductor Alexander musicians from all over Sydney fundraiser concert for The Hush hand instruments to help get to the Central West, performing Briger AO. Four Winds Artistic and NSW at all ages and levels kid’s music café Foundation, an organisation that them to schools and to students at Nepean Performing Arts High Director and musician James attending the week-long program Season from 16 February – 30 transforms the culture of health in need. School, Katoomba High School, Crabb delivered a mentoring at St Mary’s Cathedral School. November care through the arts. The evening Gilgandra High School, Dubbo session about the journey of was organised by our friends at SYO Summer School was Christian College, Gilgandra Shire becoming a musician. On the final Presented in the Western Foyers Macquarie Group Foundation and packed with choir rehearsals, Hall, Forbes Town Hall, Cook Park day, the musicians performed in of the Sydney Opera House, Kid’s featured performances from a large ensemble playing, Orange, and Craigmoor Pavilion the Four Winds Pavilion to a large Music Café is a family friendly café variety of musicians including the masterclasses and tutorials, Mudgee. These musicians were audience. experience designed especially Macquarie Group Choir. music theory and info sessions, joined by 30 young musicians for toddlers and their parents 16-18 November as well as the opportunity to The Peter Seymour Orchestra from the Central West region for as a perfect introduction to the The Western Sydney Youth make friends and have fun. was a highlight of the concert, workshops and a performance at classics. Held monthly, musicians Orchestra toured to the South The program culminated with performing music from the HUSH Dubbo Christian School. Five local from Sydney Youth Orchestras Coast to take part in the 2 concerts at Verbrugghen repertoire, performing with musicians also joined them for performed in brass, string, inaugural Youth Music Festival Hall, Sydney Conservatorium of distinguished pianist Konstantin our Join an Orchestra program to woodwind and other ensembles, at Four Winds. During the tour Music, to showcase everyone’s Shamray, and a PSO quintet experience life on tour. entertaining and delighting our they performed a ‘Meet the achievements during the week. youngest music lovers. joined vocal quartet The Idea of Orchestra’ concert for children North for a number of specially and families at Shoalhaven, and arranged songs.
28 29 artistic program & collaborations 2018 in review
“laudable professionalism and contagious The orchestras and ensembles of Leonard Bernstein’s birth centenary SYO continued to fulfil the tricky was celebrated in SYO’s annual enthusiasm that belied their youth” dual roles of sustaining both collaboration with the Sydney pedagogical and artistic excellence Philharmonia Choirs in semi-staged – Sounds Like Sydney in 2018. performances of Candide that again had the critics raving. The year was notable for Chief Conductor Alexander Briger AO’s By taking on and excelling in these “Close your eyes and you could be listening to a strategy for the flagship orchestra Everests of the repertoire, players of riding full tilt at some of the at this level of development add fully-fledged professional symphony orchestra.” most challenging and monumental more than discipline, rigour, and works of the orchestral canon and improved technique to their 2018 – The Daily Telegraph waiting to see who came out the check-list of achievements; they other side. also evolve confidence in their powers, a readiness to assay what The tantalising chunk of Mahler’s seems insurmountable, and the “Australia’s leading youth orchestra” Symphony No 10, Stravinsky’s joy of the view from the top. Mine Firebird Suite, Richard Strauss’ was largely a spectator role during – The Sunday Telegraph Don Juan, and – biggest of all the season following my mid-year – Bruckner’s Eighth Symphony appointment by the Board, yet the (replete with battery of so-called results from my stalls seat were ‘Wagner’ tubas) are assignments consistently thrilling – much more that raise sweats in any fully- “they are a force to be reckoned with.” so than many professional concerts professional orchestra. Flagship not I heard elsewhere. Bravi Maestro merely played these works end- – The Daily Telegraph Briger and the flagship players! to-end; they gave renditions that elicited favourable comparisons CHRISTOPHER LAWRENCE with full-time ensembles and Chief Artistic Advisor “fun and interactive” had reviewers making the case that Sydney now had a Number - Spectrum Two orchestra after the Sydney Symphony. “a sterling performance” “raw energy and power”, “scintillating” – Limelight
32 33 gold dinner way out west festival, nārūtu: Assyrian folk together live foreigner carols in the domain Casula Powerhouse music concert 10 May 18 July 7 October 13-14 September 18 October 22 December
Musicians from The Sydney After performances in 2017, The The Western Sydney Youth Back by popular demand Musicians from the Sydney 49 musicians from Sydney Youth Youth Orchestra and Sydney Western Sydney Youth Orchestra Orchestra performed at Narutu: following its acclaimed premiere Youth Orchestra Philharmonic, Orchestras performed in the Youth Orchestra Philharmonic were invited back to the Way Assyrian Folk Music Concert in 2017, the Sydney City Youth together with musicians from the annual Carols in the Domain, performed at the 21st annual Out West Festival at Casula presented by The Assyrian Church Ballet together with the Sydney Australian National University Sydney’s largest outdoor Gold Dinner, an event regarded Powerhouse. The Way Out West of the East’s Youth Association Youth Orchestra Philharmonic and conducted by Kenneth Christmas concert, sharing the as the most exclusive charity gala Children’s Festival is the premier Sydney (ACEYA) and Relief presented Together Live at Lampl, performed with rock stage with Australia’s most in Australia. The Gold Dinner, interactive festival celebrating Organisation (ACERO Australia) at The Concourse, Chatswood. band Foreigner at the Sydney popular performers. attended by a who’s who of young people’s curiosity and EVAN Theatre, Penrith. The Together Live was a triple bill Opera House during the Sydney The event was attended by a live industry, is Sydney Children’s imagination, in partnership evening featured iconic Assyrian featuring the power and the leg of their Australian Tour. audience of more than 50,000 Hospital Foundation’s major with some of Australia’s leading folk music by William Daniel, passion of Paquita, Maina Performing orchestral and was broadcast nationally on annual fundraiser. artists creating work with, by, Alexander (Shoora) Michailian, Gielgud’s production of Giselle arrangements of Foreigner’s The Seven Network. and for young people, held in one and many others, performed with Act II and the brand new Our young musicians, conducted music, SYO’s young musicians of Australia’s most unique arts the Nārūtu Choral Ensemble and contemporary POWERHOUSE by by Simon Kenway and received a unique experience centres, the Casula Powerhouse. conducted by Mesopotamian international choreographic performing with soloist Bennet playing alongside a rock band in WSYO performed a new Night’s John Kendall Bailey. sensation Lucas Jervies. Tsai, entertained guests at this Sydney’s most iconic venue. interactive version of Vivaldi’s Four exclusive event with repertoire Seasons at two sold out outdoor from Carousel and Popper’s concerts. Hungarian Rhapsody.
34 35 how is it possible? we support the sound of the future in 3 ways
2018 $ % opportunity enterprise excellence We at Sydney Youth Orchestras The Enterprise Fund supports the Excellence in music education is at Sponsorship 99,742 5.76% believe the love of music organisation’s long-term strategic the core of all our activities. The transcends all social, cultural goals, by helping us maintain and generous gifts to the Excellence Government Funding 115,000 6.64% and economic backgrounds. The improve our business functions, Fund enable us to provide access to Opportunity Fund ensures that provide instruments, and grow and world class conductors, professional Open Programs and Touring 167,363 9.67% talented young musicians can be commercialise our music library. performance opportunities, Performance and Audience Sales 254,439 14.70% part of an orchestra, and have renowned Australian and access to exceptional teachers International musicians, as well as Donations and Fundraising 321,378 18.57% and conductors, regardless of supporting our future orchestral their financial or geographic leaders through Principal Chair Core Program Orchestral Training 736,892 42.57% circumstances. scholarships.
Other Income 36,153 2.09%
Sydney Youth Orchestras is a With less than 7% of our funding 100% of funds raised are used not-for-profit incorporated derived from government sources to support young musicians and association and is directed by (Create NSW), we rely on the encourage the love of music in the a dedicated voluntary Board generosity of our private and broader community. who meet monthly. SYO’s corporate supporters to help daily business is operated us continue developing the top by the Board’s appointed orchestral musicians of the future. management team.
36 37 opportunity Live at Level 28 The Opportunity Fund: The Impact 7 June
Live at Level 28 is Sydney Youth Guests were treated to Allens’ curator Umberto Clerici, principal regional summer school scholarships Orchestra’s major fundraising private Australian art collection, cellist of the Sydney Symphony 16 gala for the Opportunity Fund, panoramic views of Sydney Orchestra, while enjoying premium regional tours held at Allens Linklaters office Harbour, and performances by Australian wines and mouth- 3 in Deutsche Bank Place. SYO’s young, talented musicians watering food. regional musicians accessing educational under the guidance of music 50+ and artistic experiences 1 western sydney youth orchestra supported 33 financial hardship scholarships
40 41 enterprise the big busk 9 October over 2000 pieces of media Hundreds of young SYO musicians Every dollar up to the value of minutes of live 27 coverage and alumni took over the city of $50,000 raised from The Big 2,000+ music estimated Sydney and Parramatta for the Busk was matched by Creative audience 3.22M coverage views inaugural The Big Busk, raising Partnerships through Plus1. 50,000+ members social shares funds to purchase instruments, 77 music, and supporting SYO’s readership critical business infrastructure. 995K
44 45 Financials to insert....
excellence chair’s dinner 12 September
The Annual Chair’s Gala Sydney Youth Orchestras’ closest The night began with guests This was followed by a three- The dinner was complemented Dinner is Sydney Youth friends and supporters attended enjoying canapes and champagne course dinner with matching wines with performances by musicians of Orchestra’s major fundraiser this exclusive event hosted by Jan in the Dangar Room, with the supplied by BackVintage Wines in the Sydney Youth Orchestra, who for the Excellence Fund. Bowen AM, Chair, and the Board talented young musicians of Stage the Main Dining Room, featuring an performed Massenet’s Meditation of Directors of Sydney Youth Three, Grieg performing with interview with Marcus Michelsen, from Thais, and Copland’s Orchestras, held at the Union, conductor Rachel Pogson. concertmaster of the Sydney Appalachian Spring Suite for 13 University and School’s Club. Youth Orchestra and Christopher instruments, conducted by SYO’s Lawrence, Chief Artistic Director of conducting fellow, Sam Weller. SYO.
48 49 our partners our donors
Sydney Youth Orchestras would like to thank our generous donors in 2018. Your contribution has helped SYO forge the pathway for young musicians to champion orchestral music.
The future of music in NSW is bright, thanks to your donation.
government partners $20,000+ Annalise Fairfax Kathryn Bellach Steven Proud Daryl & Kate Dixon J. Matthew Fifield Natalie Berney Miranda Purnell Michael Gleeson-White Marianne Birch Belle Rafferty $10,000-$19,999 Anthony Gregg & Deanne Chris Bosch Cooper Rands Steve Bell Whittleston Rev. Dr. Arthur Bridge OAM Victoria Rands The Howarth Foundation Stephanie & Ian Hardy Carden Calder Eve Reddy Pam & Ian McGaw Dr Rachael Kohn Suzanne Campbell Emma Reid John Lamble Foundation The Cheng & Li Family David Rogers
Sydney Youth Orchestras is supported by the Sydney Youth Orchestras is supported by the $5,000-$9,999 David Landa OAM Ben Chesterman John Rome NSW Government through Create NSW Creative Partnerships Australia through Plus1 The Arcus Foundation Emma Maple-Brown Myee Clohessy Anthony Rossiter Ursula & Martin Armstrong Suzanne Maple-Brown Martin Cohen Jane Rowden Carrie Bellotti Julianne Maxwell - Stanford A Cole Michael Ryan Thomas Coates Brown Charitable Foundation Belinda & Sean Cooney Anne Ryrie digital education partner corporate music partners Kate Jackson Deidre and Kevin McCann AM Selina Corkill Vennisa Santoro John & Irene Garran Andrew McKinnon Phillip Cornwell Gieta Seymour Wallis Graham Rosemary Quinn Kelvin Cremen Frank Shapcott The Key Foundation Pieter & Liz Oomens Michael Crivelli The Sharpe Family Macquarie Group Foundation Greeba Pritchard Daniel Cronin Phillip Shovk Jon & Suzanne North Patricia H Reid Endowment Pty Rae Dahm Ken Siegers Tasker Ryrie & Sarah Sherwood Ltd John Dean The Simkovic Family Peter Weiss AO Dr Félicité Ross Luke Doran Casimir Skillecorn Richard Willis Robyn Smiles Jeremy Eccles Kamilla Soos Anonymous Ezekiel Solomon AM Sam & Alicia Elliot The Still Family Peter St George Sandra Forbes Barbara Sullivan $2,500-$4,999 The Stanford Family Hoi Shan Fung Monika Tan Aluxor Industries Sophie Thomas Rajiv Gohil Alice Tang Anthony Bell Mike Thompson Camilla Goodwin Jeffrey Temple international tour partners event partners Jan Bowen AM Graham Tribe Ian Gordon Patricia Terrey Dr James Choi & Dr Anita Paul Uren Miriam Greenbaum Patrick Thompson Mardirossian Peter Warne Grill’d Pty Ltd Neil & Gabrielle Thompson Geraldine Doogue AO Watkins Taylor Stone Alan Hauserman Joanne Trinh Tim Downing Anthony & Annie Whealy Rachel Heriot Lanné Tucker Ari & Lisa Droga Gail Windsor Roger Hudson Gabriel van Aalst Bunny Gardiner-Hill Robin Windsor Jeff Hughes Kay Vernon James Graham Nicholas Hume Moritz von Hauenschild Ian Hutchinson $500-$999 Mavis Hutton Elaine Walker Greg Levy Colleen and Michael Kristen Jung Leela Wesiak syo state partners western sydney Helen & Michael Long AM Chesterman Gaynor Kaad Alex Whiteside The Hon. Jane Mathews AO Julie & Terry Clarke Patricia Karedis Elizabeth Whittle youth orchestra partners Tim Samway & Jemima Susie & Martin Dickson AM Ian Kelly Shemara Wikramanayake Littlemore Jan Figgis Hercules Konstantopoulos Conrad Williams Tom Story Carolyn Fletcher Terence Kwan Georgia Wilson on behalf of Sydney Lyceum Club Dimity Hall Ken Lee Wendy Pritchard & Brent Wilson Cameron Williams Geoff Hogbin Matthew Lee Ying Wang Dr John Hughes The Lee & Lim Family The Woo Family $1,000-$2,499 Dawn Kidd Kate Lidbetter The Zhang Family Antoinette Albert Philip Levy Norman Long Anonymous (8) The Alfonzetti Family Mary McCarter Tony Lonn David & Rae Allen The Mellefont Family Elden Loomes Peter Andrews of Haverick Dr Robert Mitchell Stephen Lyndon Meats Melinda Muth & Ian Hill Carlo Manfredini supporting partners Alina & Scott Barlow Wendy Nash Nikolas Margerrison Angela & Marco Belgiorno- Anonymous (2) The Marshall Family Zegna AM Deborah Ricci Sabrina Blasco $0-$499 Dara & Bettina Minogue Kelly Bookmyer Toni Addison-Lafferty Michael Monaghan Neil Burns Simon Andrew Christine Oldham John Charrington Robert Andujar Lisa Pan Joan Connery OAM Peter Arnold Alan Parry Kirsten Dale Rosalind Baker Freya & Madeleine Patoulios Emma Dunch Deborah Barber Liz Pensini Ron & Suellen Enestrom James Bell Jerome Prince-Foster
50 51 our people board business artistic staff symphonic patron JAN BOWEN AM MIA PATOULIOS KATIE GARMAN ALEXANDER BRIGER AO orchestral program His Excellency General Chair General Manager Operations Coordinator, Senior Chief Conductor ALEXANDER BRIGER AO The Honourable Orchestras The Sydney Youth Orchestra DAVID HURLEY AC DSC (Ret’d), ANTHONY BELL SUSAN HART CHRISTOPHER LAWRENCE Governor of NSW Deputy Chair Finance Manager ANGUS DAVISON Chief Artistic Advisor BRIAN BUGGY OAM Operations Coordinator, SYO Philharmonic URSULA ARMSTRONG DANIEL PLACIDO Orchestral Fundamentals conductors Executive Administrator JOHN OCKWELL GERALDINE DOOGUE AO Program orchestral Peter Seymour Orchestra MARITA CRANWELL SERGIO INSUASTI TIM DOWNING Events Coordinator fundamentals program Operations Coordinator, JAMES PENSINI BRIAN BUGGY WALLIS GRAHAM Symphonic Orchestral Program Symphonic Wind Orchestra, BELLA MAZZAROLO Stage 4 Sinfonia (From February) Western Sydney Youth Orchestra GREG LEVY Development Coordinator PETER CORKILL NIAMH ARMSTRONG CLAIRE TREDINNICK MALCOLM LONG AM Stage 3 Brahms Development Coordinator Operations Coordinator, Western JON NORTH (June to July) Sydney (February to May) RACHEL POGSON Stage 3 Grieg PIETER OOMENS ALEXANDRIA SIEGERS GAIL PRYOR Marketing and Digital Coordinator Archivist KATHRYN CROSSING Stage 2 Haydn CASEY GREEN SUE ELLYARD Orchestras and Operations Volunteer JOANNE WAPLES Manager (Until October) Stage 2 Mozart ALAN HAUSERMAN Volunteer DR IRINA ANDREEVA Stage 1 Corelli
HELOISE MEISEL Stage 1 Vivaldi
52 53 financial report
Director’s Report Director’s Report 6\GQH\ 6\GQH\ Director’s Report Director’s Report 6\GQH\ 6\GQH\ Director’s Report 6\GQH\ 6\GQH\ 6WDWHPHQWRI3URILWDQG/RVVDQG2WKHU&RPSUHKHQVLYH,QFRPH 6WDWHPHQWRI)LQDQFLDO3RVLWLRQ )RUWKH\HDUHQGHG'HFHPEHU $VDW'HFHPEHU 6\GQH\ 6\GQH\ 6WDWHPHQWRI&KDQJHVLQ(TXLW\ 6WDWHPHQWRI&DVK)ORZV )RUWKH\HDUHQGHG'HFHPEHU )RUWKH\HDUHQGHG'HFHPEHU 6\GQH\ &DVKIORZVIURPRSHUDWLQJDFWLYLWLHV %DODQFHDW-DQXDU\ &DVKUHFHLSWVIURPPHPEHUV FRQFHUWSHUIRUPDQFHV &DVKSDLGWRVXSSOLHUVDQGHPSOR\HHV 7RWDOFRPSUHKHQVLYHORVVIRUWKH\HDU *UDQWVUHFHLYHG &DPSDQGWRXUIHHVUHFHLYHG 6SRQVRUVKLSUHFHLYHG %DODQFHDW'HFHPEHU 'RQDWLRQVUHFHLYHG ,QWHUHVWFKDUJHVSDLG 1HWFDVKSURYLGHGIURPRSHUDWLQJDFWLYLWLHV $FFXPXODWHG )XQGV &DVKIORZVIURPLQYHVWLQJDFWLYLWLHV %DODQFHDW-DQXDU\ ,QWHUHVWUHFHLYHG $FTXLVLWLRQRISURSHUW\SODQWDQGHTXLSPHQW 7RWDOFRPSUHKHQVLYHVXUSOXVIRUWKH\HDU $FTXLVLWLRQRILQWDQJLEOHDVVHW %DODQFHDW'HFHPEHU 1HWFDVK XVHGLQ SURYLGHGIURPLQYHVWLQJ DFWLYLWLHV 1HWLQFUHDVHLQFDVK FDVKHTXLYDOHQWV &DVKDQGFDVKHTXLYDOHQWVDW-DQXDU\ &DVKDQGFDVKHTXLYDOHQWVDW'HFHPEHU 1RQFDVKWUDQVDFWLRQV - %DUWHUWUDQVDFWLRQRIWKHVHUYLFH 7KH VWDWHPHQW RI FKDQJHV LQ HTXLW\ LV WR EH UHDG LQ FRQMXQFWLRQ ZLWK WKH QRWHV WR WKH ILQDQFLDO 7KHVWDWHPHQWRIFDVKIORZVLVWREHUHDGLQFRQMXQFWLRQZLWKWKHQRWHVWRWKHILQDQFLDOVWDWHPHQWVVHW VWDWHPHQWVVHWRXWRQSDJHV RXWRQSDJHV 6\GQH\ 6\GQH\ 6\GQH\ 6\GQH\ 5HYHQXH &RQWULEXWLRQV &RQWULEXWLRQLQFRPHLVUHFRJQLVHGDWWKHIDLUYDOXHRIWKHFRQWULEXWLRQVUHFHLYHG LQFOXGLQJDQ\DVVHWV UHFHLYHGZKHUHWKHUHLVDQRQUHFLSURFDOWUDQVIHU *UDQWVIURP $UWV16: 'RQDWLRQV 2WKHU 'RQDWLRQV FROOHFWHG LQFOXGLQJ FDVK DQG JRRGV IRU UHVDOH DUH UHFRJQLVHG DV UHYHQXH ZKHQ WKH /RFDO*RYHUQPHQW ,QNLQG DVVRFLDWLRQ JDLQV FRQWURO HFRQRPLF EHQHILWV DUH SUREDEOH DQG WKH DPRXQW RI WKH GRQDWLRQ FDQ EH PHDVXUHGUHOLDEO\ 7RWDO*UDQW5HYHQXH 6SRQVRUVKLS 0HPEHUVKLSDQGDXGLWLRQIHHV 6SRQVRUVKLSFRPPLWPHQWVDUHEURXJKWWRDFFRXQWDVLQFRPHLQWKH\HDULQZKLFKVSRQVRUVKLSEHQHILWV 7LFNHWVDOHVSHUIRUPDQFHIHHVDQGPHUFKDQGLVH DUH EHVWRZHG 6RPH VSRQVRUVKLS DFWLYLWLHV ZKLFK LQYROYH FRQWUD WUDQVDFWLRQV DUH UHFRJQLVHG E\ 'RQDWLRQVDQGIXQGUDLVLQJHYHQWV UHIHUHQFHWRWKHIDLUYDOXHRIQRQFRQWUDWUDQVDFWLRQV 6SRQVRUVKLSIHHV LQFOXGLQJLQNLQG ,QWHUHVWLQFRPH 5HYHQXHIURPPXVLFFDPSVDQGWRXUV ,QWHUHVWLQFRPHLVUHFRJQLVHGDVLWDFFUXHVXVLQJWKHHIIHFWLYHLQWHUHVWUDWHPHWKRG %XVLQHVVUHODWHGLQFRPH 7RWDO(DUQHG5HYHQXH *RYHUQPHQWIXQGLQJ *UDQWUHYHQXHLVUHFRJQLVHGLQWKHVWDWHPHQWRIFRPSUHKHQVLYHLQFRPHZKHQWKHDVVRFLDWLRQREWDLQV 7RWDOUHYHQXH FRQWURORIWKHJUDQWDQGLWLVSUREDEOHWKDWWKHHFRQRPLFEHQHILWVJDLQHGIURPWKHJUDQWZLOOIORZWRWKH DVVRFLDWLRQDQGWKHDPRXQWRIWKHJUDQWFDQEHPHDVXUHGUHOLDEO\ $FFRXQWLQJ3ROLF\ ,I FRQGLWLRQV DUH DWWDFKHG WR WKH JUDQW ZKLFK PXVW EH VDWLVILHG EHIRUH LW LV HOLJLEOH WR UHFHLYH WKH 5HYHQXHLVUHFRJQLVHGZKHQWKHDVVRFLDWLRQLVOHJDOO\HQWLWOHGWRWKHLQFRPHDQGWKHDPRXQW FRQWULEXWLRQWKHUHFRJQLWLRQRIWKHJUDQWDVUHYHQXHZLOOEHGHIHUUHGXQWLOWKRVHFRQGLWLRQVDUHPHW FDQEHTXDQWLILHGZLWKUHDVRQDEOHDFFXUDF\5HYHQXHVDUHUHFRJQLVHGQHWRIWKHDPRXQWVRI JRRGVDQGVHUYLFHVWD[ *67 SD\DEOHWRWKH$XVWUDOLDQ7D[DWLRQ2IILFH :KHQJUDQWUHYHQXHLVUHFHLYHGZKHUHE\WKHDVVRFLDWLRQLQFXUVDQREOLJDWLRQWRGHOLYHUHFRQRPLFYDOXH GLUHFWO\EDFNWRWKHFRQWULEXWRUWKLVLVFRQVLGHUHGDUHFLSURFDOWUDQVDFWLRQDQGWKHJUDQWUHYHQXHLV UHFRJQLVHGLQWKHEDODQFHVKHHWDVDOLDELOLW\XQWLOWKHVHUYLFHKDVEHHQGHOLYHUHGWRWKHFRQWULEXWRU RWKHUZLVHWKHJUDQWLVUHFRJQLVHGDVLQFRPHRQUHFHLSW 6\GQH\ 6\GQH\ 0XVLFDO 0XVLF 2IILFH 0RWRU 7RWDO 'HSUHFLDWLRQ ,QVWUXPHQW /LEUDU\ )XUQLWXUH 9HKLFOH ,WHPVRISODQWDQGHTXLSPHQWDUHGHSUHFLDWHGRYHUWKHLUXVHIXOOLYHVWRWKHDVVRFLDWLRQ FRPPHQFLQJ IURPWKHWLPHWKHDVVHWLVKHOGUHDG\IRUXVH'HSUHFLDWLRQLVFDOFXODWHGRQDVWUDLJKWOLQHEDVLVRYHU DQG WKHH[SHFWHGXVHIXOHFRQRPLFOLYHVRIWKHDVVHWVDVIROORZV (TXLSPHQW 0XVLFDOLQVWUXPHQWV 2IILFHHTXLSPHQW 0XVLFOLEUDU\ &RVW 0RWRUYHKLFOHV 6RIWZDUH %DODQFHDW-DQXDU\ $FTXLVLWLRQV ,PSDLUPHQW %DODQFHDW'HFHPEHU 7KHFDUU\LQJYDOXHVRISODQWDQGHTXLSPHQWDUHUHYLHZHGIRULPSDLUPHQWDWHDFKUHSRUWLQJGDWHZLWK WKHUHFRYHUDEOHDPRXQWEHLQJHVWLPDWHGZKHQHYHQWVRUFKDQJHVLQFLUFXPVWDQFHVLQGLFDWHWKDWWKH FDUU\LQJYDOXHPD\EHLPSDLUHG 'HSUHFLDWLRQDQGLPSDLUPHQW ORVVHV 7KHUHFRYHUDEOHDPRXQWRISODQWDQGHTXLSPHQWLVWKHKLJKHURIIDLUYDOXHOHVVFRVWVWRVHOODQGYDOXH LQXVH'HSUHFLDWHGUHSODFHPHQWFRVWLVXVHGWRGHWHUPLQHYDOXHLQXVH'HSUHFLDWHGUHSODFHPHQWFRVW LVWKHFXUUHQWUHSODFHPHQWFRVWRIDQLWHPRISODQWDQGHTXLSPHQWOHVVZKHUHDSSOLFDEOHDFFXPXODWHG %DODQFHDW-DQXDU\ GHSUHFLDWLRQWRGDWHFDOFXODWHGRQWKHEDVLVRIVXFKFRVW,PSDLUPHQWH[LVWVZKHQWKHFDUU\LQJYDOXH 'HSUHFLDWLRQFKDUJHIRUWKH\HDU RIDQDVVHWH[FHHGVLWVHVWLPDWHGUHFRYHUDEOHDPRXQW7KHDVVHWLVWKHQZULWWHQGRZQWRLWVUHFRYHUDEOH ,PSDLUPHQWORVVHV DPRXQW %DODQFHDW'HFHPEHU )RUSODQWDQGHTXLSPHQWLPSDLUPHQWORVVHVDUHUHFRJQLVHGLQWKHVWDWHPHQWRIFRPSUHKHQVLYHLQFRPH &DUU\LQJDPRXQWV 'HUHFRJQLWLRQDQGGLVSRVDO $W'HFHPEHU $QLWHPRISURSHUW\SODQWDQGHTXLSPHQWLVGHUHFRJQLVHGXSRQGLVSRVDOZKHQWKHLWHPLVQRORQJHU $W'HFHPEHU XVHG LQ WKH RSHUDWLRQV RI WKH DVVRFLDWLRQ RU ZKHQ LW KDV QR VDOH YDOXH $Q\ JDLQ RU ORVV DULVLQJ RQ GHUHFRJQLWLRQRIWKHDVVHW FDOFXODWHGDVWKHGLIIHUHQFHEHWZHHQWKHQHWGLVSRVDOSURFHHGVDQGWKH FDUU\LQJDPRXQWRIWKHDVVHW LVLQFOXGHGLQVXUSOXVRUGHILFLWLQWKH\HDUWKHDVVHWLVGHUHFRJQLVHG $FFRXQWLQJ3ROLF\ 3ODQW DQG HTXLSPHQW DUH VWDWHG DW FRVW OHVV DFFXPXODWHG GHSUHFLDWLRQ DQG DQ\ DFFXPXODWHG 7UDGHDQGRWKHUSD\DEOHV LPSDLUPHQWORVVHV $Q\SODQWDQGHTXLSPHQWGRQDWHGWRWKHDVVRFLDWLRQRUDFTXLUHGIRUQRPLQDOFRVWLVUHFRJQLVHGDW IDLUYDOXHDWWKHGDWHWKHDVVRFLDWLRQREWDLQVFRQWURORIWKHDVVHWV 3$<*DQGVXSHUDQQXDWLRQFRQWULEXWLRQV 2WKHUSD\DEOHVDQGDFFUXDOV 6\GQH\ 6\GQH\ 6\GQH\ 6\GQH\ Crowe Horwath Sydney 6\GQH\ Crowe Horwath Sydney ABN 97 895 683 573 Member Crowe Horwath International Audit and Assurance Services Responsibilities of the directors for the Financial Report Level 15 1 O’Connell Street Sydney NSW 2000 Australia The directors are responsible for the preparation and fair presentation of the financial report in accordance Tel +61 2 9262 2155 Fax +61 2 9262 2190 with the financial reporting requirements of the applicable legislation and for such internal control as the www.crowehorwath.com.au directors determine is necessary to enable the preparation and fair presentation of a financial report that is free from material misstatement, whether due to fraud or error. Independent Auditor’s Report to the members of Sydney Youth In preparing the financial report, the directors are responsible for assessing the Entity’s ability to continue as a going concern, disclosing, as applicable, matters relating to going concern and using the going Orchestras Incorporated concern basis of accounting unless the directors either intends to liquidate the Entity or to cease operations, or has no realistic alternative but to do so. Those charged with governance are responsible for overseeing the Entity’s financial reporting process. Report on the Audit of the Financial Report Auditor’s Responsibilities for the Audit of the Financial Report Opinion Our objectives are to obtain reasonable assurance about whether the financial report as a whole is free We have audited the financial report of Sydney Youth Orchestras Incorporated (the Entity), which from material misstatement, whether due to fraud or error, and to issue an auditor’s report that includes comprises the statement of financial position as at 31 December 2018, the statement of comprehensive our opinion. Reasonable assurance is a high level of assurance, but is not a guarantee that an audit income, the statement of changes in equity and the statement of cash flows for the year then ended, and conducted in accordance with the Australian Auditing Standards will always detect a material notes to the financial statements, including a summary of significant accounting policies, and the misstatement when it exists. Misstatements can arise from fraud or error and are considered material if, statement by the directors. individually or in the aggregate, they could reasonably be expected to influence the economic decisions of users taken on the basis of this financial report. In our opinion, the accompanying financial report of Sydney Youth Orchestras Incorporated has been prepared in accordance with Division 60 of the Australian Charities and Not-for-profits Commission Act As part of an audit in accordance with the Australian Auditing Standards, the auditor exercises 2012 and the Associations Incorporation Act NSW 2009, including: professional judgement and maintains professional scepticism throughout the audit. The auditor also: ◼ Identifies and assesses the risks of material misstatement of the financial report, whether due to fraud (a) giving a true and fair view of Sydney Youth Orchestras Incorporated financial position as at 31 or error, designs and performs audit procedures responsive to those risks, and obtains audit evidence December 2018 and of its financial performance and cash flows for the year then ended; and that is sufficient and appropriate to provide a basis for the auditor’s opinion. The risk of not detecting a – (b) complying with Australian Accounting Standards Reduced Disclosure Requirements and Division 60 material misstatement resulting from fraud is higher than for one resulting from error, as fraud may of the Australian Charities and Not-for-profits Commission Regulation 2013 and the Associations involve collusion, forgery, intentional omissions, misrepresentations, or the override of internal control. Incorporation Regulation. ◼ Obtains an understanding of internal control relevant to the audit in order to design audit procedures that are appropriate in the circumstances, but not for the purpose of expressing an opinion on the effectiveness of the Entity’s internal control. Basis for Opinion ◼ Evaluates the appropriateness of accounting policies used and the reasonableness of accounting We conducted our audit in accordance with Australian Auditing Standards. Our responsibilities under estimates and related disclosures made by management. Auditor’s Responsibilities for the Audit of the those standards are further described in the Financial Report ◼ Concludes on the appropriateness of management’s use of the going concern basis of accounting section of our report. We are independent of Sydney Youth Orchestras Incorporated in accordance with and, based on the audit evidence obtained, whether a material uncertainty exists related to events or the ethical requirements of the Accounting Professional and Ethical Standards Board’s APES 110 Code of conditions that may cast significant doubt on the Entity’s ability to continue as a going concern. If the Ethics for Professional Accountants (the Code) that are relevant to our audit of the financial report in auditor concludes that a material uncertainty exists, the auditor is required to draw attention in the Australia. We have also fulfilled our other ethical responsibilities in accordance with the Code. auditor’s report to the related disclosures in the financial report or, if such disclosures are inadequate, to modify the auditor’s opinion. The auditor’s conclusions are based on the audit evidence obtained up We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for to the date of the auditor’s report. However, future events or conditions may cause the Entity to cease our opinion. to continue as a going concern. ◼ Evaluates the overall presentation, structure and content of the financial report, including the disclosures, and whether the financial report represents the underlying transactions and events in a manner that achieves fair presentation Crowe Horwath Sydney is a member of Crowe Horwath International, a Swiss verein. Each member of Crowe Horwath is a separate and independent legal entity. Liability limited by a scheme approved under Professional Standards Legislation. Liability limited other than for the acts or omissions of financial services licensees. 6\GQH\ 182 Cumberland Street The Rocks NSW 2000 02 9251 2422 [email protected] syo.com.au SydneyYouthOrchestras twitter.com/SYOrchestras SydneyYouthOrchestras SYOrchestras SydneyYouthOrchestras SydneyYouthOrchestras ABN 63 886 284 698 published June 2019 | design BKA+D