RNF2 monoclonal antibody (M01), the transcription repression of various involved in clone 6C2 development and cell proliferation. The encoded by this is one of the PcG . It has been Catalog Number: H00006045-M01 shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the Regulation Status: For research use only (RUO) mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as Product Description: Mouse monoclonal antibody well as in cell proliferation in early development. This raised against a partial recombinant RNF2. protein was also found to interact with interacting protein 2 (HIP2), an ubiquitin-conjugating Clone Name: 6C2 , and possess ubiquitin ligase activity. [provided by RefSeq] Immunogen: RNF2 (NP_009143, 192 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the References: GST tag alone is 26 KDa. 1. Scmh1 Has E3 Ubiquitin Ligase Activity for Geminin and Histone H2A and Regulates Geminin Stability Sequence: Directly or Indirectly via Transcriptional Repression of PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIEL Hoxa9 and Hoxb4. Yasunaga S, Ohtsubo M, Ohno Y, VFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAV Saeki K, Kurogi T, Tanaka-Okamoto M, Ishizaki H, Shirai RLALEELRSKGESNQMNLDTASEKQ M, Mihara K, Brock HW, Miyoshi J, Takihara Y. Mol Cell Biol. 2013 Feb;33(4):644-60. doi: Host: Mouse 10.1128/MCB.00974-12. Reactivity: Human,Mouse 2. Inaugural Article: Distinct histone modifications in stem cell lines and tissue lineages from the early mouse Applications: ELISA, RNAi-Ab, S-ELISA, WB-Ce, embryo. Rugg-Gunn PJ, Cox BJ, Ralston A, Rossant J. WB-Re, WB-Tr Proc Natl Acad Sci U S A. 2010 May 17. [Epub ahead of (See our web site product page for detailed applications print] information) 3. Polycomb-group complex 1 acts as an E3 ubiquitin ligase for Geminin to sustain hematopoietic stem cell Protocols: See our web site at activity. Ohtsubo M, Yasunaga S, Ohno Y, Tsumura M, http://www.abnova.com/support/protocols.asp or product Okada S, Ishikawa N, Shirao K, Kikuchi A, Nishitani H, page for detailed protocols Kobayashi M, Takihara Y. Proc Natl Acad Sci U S A. 2008 Jul 29;105(30):10396-401. Epub 2008 Jul 23. Isotype: IgG2a Kappa

Storage Buffer: In 1x PBS, pH 7.4

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 6045

Gene Symbol: RNF2

Gene Alias: BAP-1, BAP1, DING, HIPI3, RING1B, RING2

Gene Summary: Polycomb group (PcG) of proteins form the multiprotein complexes that are important for

Page 1/1

Powered by TCPDF (www.tcpdf.org)