RNF2 Monoclonal Antibody (M01), Clone

RNF2 Monoclonal Antibody (M01), Clone

RNF2 monoclonal antibody (M01), the transcription repression of various genes involved in clone 6C2 development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been Catalog Number: H00006045-M01 shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the Regulation Status: For research use only (RUO) mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as Product Description: Mouse monoclonal antibody well as in cell proliferation in early development. This raised against a partial recombinant RNF2. protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating Clone Name: 6C2 enzyme, and possess ubiquitin ligase activity. [provided by RefSeq] Immunogen: RNF2 (NP_009143, 192 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the References: GST tag alone is 26 KDa. 1. Scmh1 Has E3 Ubiquitin Ligase Activity for Geminin and Histone H2A and Regulates Geminin Stability Sequence: Directly or Indirectly via Transcriptional Repression of PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIEL Hoxa9 and Hoxb4. Yasunaga S, Ohtsubo M, Ohno Y, VFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAV Saeki K, Kurogi T, Tanaka-Okamoto M, Ishizaki H, Shirai RLALEELRSKGESNQMNLDTASEKQ M, Mihara K, Brock HW, Miyoshi J, Takihara Y. Mol Cell Biol. 2013 Feb;33(4):644-60. doi: Host: Mouse 10.1128/MCB.00974-12. Reactivity: Human,Mouse 2. Inaugural Article: Distinct histone modifications in stem cell lines and tissue lineages from the early mouse Applications: ELISA, RNAi-Ab, S-ELISA, WB-Ce, embryo. Rugg-Gunn PJ, Cox BJ, Ralston A, Rossant J. WB-Re, WB-Tr Proc Natl Acad Sci U S A. 2010 May 17. [Epub ahead of (See our web site product page for detailed applications print] information) 3. Polycomb-group complex 1 acts as an E3 ubiquitin ligase for Geminin to sustain hematopoietic stem cell Protocols: See our web site at activity. Ohtsubo M, Yasunaga S, Ohno Y, Tsumura M, http://www.abnova.com/support/protocols.asp or product Okada S, Ishikawa N, Shirao K, Kikuchi A, Nishitani H, page for detailed protocols Kobayashi M, Takihara Y. Proc Natl Acad Sci U S A. 2008 Jul 29;105(30):10396-401. Epub 2008 Jul 23. Isotype: IgG2a Kappa Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 6045 Gene Symbol: RNF2 Gene Alias: BAP-1, BAP1, DING, HIPI3, RING1B, RING2 Gene Summary: Polycomb group (PcG) of proteins form the multiprotein complexes that are important for Page 1/1 Powered by TCPDF (www.tcpdf.org).

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    1 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us