Loss of Function CHCHD10 Mutations in Cytoplasmic TDP-43 Accumulation and Synaptic Integrity

Total Page:16

File Type:pdf, Size:1020Kb

Load more

ARTICLE Received 22 Aug 2016 | Accepted 7 Apr 2017 | Published 6 Jun 2017 DOI: 10.1038/ncomms15558 OPEN Loss of function CHCHD10 mutations in cytoplasmic TDP-43 accumulation and synaptic integrity Jung-A. A. Woo1,2,*, Tian Liu1,2,*, Courtney Trotter1,2,*, Cenxiao C. Fang1,2, Emillio De Narvaez1,2, Patrick LePochat1,2, Drew Maslar1,2, Anusha Bukhari1,2, Xingyu Zhao1,2, Andrew Deonarine3, Sandy D. Westerheide3 & David E. Kang1,2,4 Although multiple CHCHD10 mutations are associated with the spectrum of familial and sporadic frontotemporal dementia–amyotrophic lateral sclerosis (FTD–ALS) diseases, neither the normal function of endogenous CHCHD10 nor its role in the pathological milieu (that is, TDP-43 pathology) of FTD/ALS have been investigated. In this study, we made a series of observations utilizing Caenorhabditis elegans models, mammalian cell lines, primary neurons and mouse brains, demonstrating that CHCHD10 normally exerts a protective role in mitochondrial and synaptic integrity as well as in the retention of nuclear TDP-43, whereas FTD/ALS-associated mutations (R15L and S59L) exhibit loss of function phenotypes in C. elegans genetic complementation assays and dominant negative activities in mammalian systems, resulting in mitochondrial/synaptic damage and cytoplasmic TDP-43 accumulation. As such, our results provide a pathological link between CHCHD10-associated mitochon- drial/synaptic dysfunction and cytoplasmic TDP-43 inclusions. 1 USF Health Byrd Alzheimer’s Institute, University of South Florida, Morsani College of Medicine, Tampa, Florida 33613, USA. 2 Department of Molecular Medicine, University of South Florida, Morsani College of Medicine, Tampa, Florida 33613, USA. 3 Department of Cell Biology, Microbiology & Molecular Biology, University of South Florida, College of Arts and Sciences, Tampa, Florida 33620, USA. 4 James A. Haley Veteran’s Administration Hospital, Tampa, Florida 33612, USA. * These authors contributed equally to this work. Correspondence and requests for materials should be addressed to D.E.K. (email: [email protected]). NATURE COMMUNICATIONS | 8:15558 | DOI: 10.1038/ncomms15558 | www.nature.com/naturecommunications 1 ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms15558 rontotemporal dementia (FTD) is a progressive neurode- found in a small proportion of ALS and FTLD-TDP, TDP-43 generative disease classically characterized by the selective pathology is associated with the vast majority of ALS and Fdegeneration of the frontal and temporal lobes, associated FTLD4,9. Increasing evidence indicates that TDP-43 is highly with executive impairments, changes in personality and language neurotoxic, in large part, by inducing mitochondrial dysfunction. It is now clear, however, that FTD is frequently dysfunction10–12. Specifically, TDP-43 is co-localized with accompanied by motor neuron disease or amyotrophic lateral mitochondria and reduces mitochondrial length by promoting sclerosis (ALS), and common genetic mutations in multiple genes mitochondrial fission, resulting in mitochondrial transport have been associated with both FTD and ALS1,2. Indeed, B15% defects10. The mitochondrial fusion protein Mfn2 prevents of FTD patients also suffer from ALS, and up to 50% of classical mitochondrial fragmentation, superoxide production and ALS patients also suffer from symptoms of FTD or mild cognitive depolarization (DCm) induced by TDP-43 mutations10, and impairment2. The unifying pathological link between the vast blockade of TDP-43 translocation to mitochondria also blocks majority of ALS and FTD patients is the accumulation of its neurotoxicity12. In line with these observations, TDP-43 cytoplasmic TDP-43 inclusions, the latter in the majority FTD overexpression in transgenic mice increases mitochondrial fission subtype, frontotemporal lobar degeneration with TDP-43 proteins Drp1 and Fis1, reduces the mitochondrial fusion pathology (FTLD-TDP)3,4. protein Mfn1, and promotes mitochondrial fragmentation and TAR DNA-binding protein 43 (TDP-43) is a nuclear protein in aggregation11. the family of heterogeneous ribonucleoproteins (hnRNPs) that Coiled-coil-helix-coiled-coil-helix domain containing 10 plays a major role in regulating RNA splicing, stability and (CHCHD10) encodes a protein that is localized to the transport5. However, in pathological neurons, TDP-43 is often intermembrane space of mitochondria13 associated with the found in the cytoplasm in a ubiquitinated and fragmented form, mitochondrial contact site and cristae organizing system which are prone to aggregation6–8. While TDP-43 mutations are (MICOS) together with mitofusin, mitophilin, CHDHD3 and a R15L 110 20 30 40 CHCHD10 har-1 1 10 20 30 40 50 60 b c d ## n.s. S59L har-1 150 150 N2 43 5070 80 90 ## ## KO CHCHD10 100 100 har-1 61 70 80 90 100 110 50 50 BLPS (% of N2) BBPS (% of N2) 100 110 120 130 142 0 0 CHCHD10 N2 N2 TDP43 TDP43 har-1 har-1 KO har-1 KO 114 120 130 140 154 Identical Conserved Semi-conserved Not conserved ef g h ## N2 har-1 KO TDP43 ## 125 15 ## ** 300 100 10 GFP 75 200 PhC/ N2 5 50 har-1 KO ## % Time curling 100 Percent survival 0 Mitosox (% of N2) 25 0 N2 TDP43 Mitosox N2 0 har-1 KO TDP43 0 10203040 har-1 KO Survival (days since hatched) Figure 1 | Loss of har-1 impairs locomotion mitochondrial health and longevity in C. elegans. (a) Protein sequence alignment between human CHCHD10 and C. elegans har-1. Note that C. elegans har-1 shares 41% identity, 12% conserved similarity, and 18% semi-conserved similarity to human CHCHD10 (http://useast.ensembl.org/index.html). (b–e) Age-synchronized worms per strain (3-day adults: N2, har-1 KO (har-1 À / À ) and TDP43) transferred to fresh NGM plate or M9 buffer and videotaped to measure motility, liquid thrashing rate, and curling behaviour (1-way ANOVA, post hoc Tukey, ##Po0.0001). (b) Motility (measured in BLPS) on NGM plate measured at ambient room temperature (22 °C) and normalized to N2 control from 90 to 94 worms per strain. (c) Liquid thrashing rate (BBPS) measured in M9 buffer at ambient room temperature (22 °C) and normalized to N2 control from 50 worms per strain. (d,e) Representative images of curling posture (red arrows). Per cent time spent curling measured at ambient room temperature (22 °C) from 50 worms per strain (scale bar, 100 mm). (f,g) Age-synchronized worms stained with 5 mM mitosox-red in M9 buffer for 45 min, mounted live on agar pads, imaged by confocal microscopy, quantified with Image J, and normalized to N2 control (one-way ANOVA, **Po0.01, ##Po0.0001, n ¼ 29 worms/ strain, scale bar, 100 mm). Average intensity of head region excluding mouth, pharynx, and intestine quantified. (h) Lifespan analysis (% of worms surviving since days hatching) of N2 and har-1 KO worms at 16 °C (Log-rank Mantel–Cox test, ##Po0.0001, n ¼ 170 worms/strain). All quantitative graphs with error bars were expressed as mean±s.e.m. ANOVA, analysis of variance; KO, knockout. 2 NATURE COMMUNICATIONS | 8:15558 | DOI: 10.1038/ncomms15558 | www.nature.com/naturecommunications NATURE COMMUNICATIONS | DOI: 10.1038/ncomms15558 ARTICLE CHCHD6 (ref. 14). Recent human genetic studies have identified between C. elegans har-1 and human CHCHD10 proteins multiple CHCHD10 mutations in sporadic and familial FTD–ALS (Fig. 1a). To gain insights to the function of CHCHD10 in vivo, spectrum disorders from independent cohorts and ethnic we utilized the VC3169 har-1 À / À C. elegans model (gk3124)to groups13–17, implicating the critical role of mitochondria in assess locomotion in comparison with wild-type N2 ancestral and FTD–ALS diseases. CHCHD10 mutations have also been TDP-43 transgenic strains. TDP-43 expression in the TDP-43 associated with Charcot–Marie–Tooth disease type 2 (ref. 18), transgenic C. elegans CL6049 is driven by the neuron-specific mitochondrial myopathy and spinal muscular atrophy Jokela snb-1 promoter, a strain with impairments in locomotion at room type19. However, despite the role of the FTD/ALS-linked temperature that worsens with heat exposure20. In motility tests CHCHD10 S59L mutation in reducing mitochondrial length at ambient temperature, we observed significantly slower rates of and disorganization of mitochondrial cristae morphology13, movement in both har-1 À / À and TDP-43 transgenic worms by neither the normal function of endogenous CHCHD10 nor the 32 and 80%, respectively, as compared to N2 (Fig. 1b). In liquid nature of the FTD/ALS CHCHD10 mutations has been thrashing tests at ambient temperature, har-1 À / À worms showed investigated. Moreover, whether and how CHCHD10 mutations no significant reduction in body bends per second (BBPS), alter the pathological landscape (that is, TDP-43 inclusions) of whereas the TDP-43 worms displayed a significant 50% reduction FTD–ALS spectrum diseases is completely unknown, and no in BBPS (Fig. 1c). Upon exposure to heat (30 °C for 30 min), both FTD/ALS mutations other than S59L have been functionally TDP-43 and har-1 À / À strains showed dramatically reduced characterized. Here we show in Caenorhabditis elegans models, liquid thrashing rates compared to N2 controls (Supplementary cultured cells, primary neurons, and mouse brains that Fig. 1a), indicating that heat exposure renders the har-1 À / À CHDHD10 normally plays a neuroprotective role and that strain more vulnerable to the loss of har-1 possibly due to FTD/ALS CHCHD10 mutations (R15L and S59L) display loss of proteostatic stress. Next, we tested the strains for the percentage function phenotypes and function in concert with TDP-43 to of time spent in a curled posture in liquid curling tests, since both induce its cytoplasmic mislocalization, resulting in mitochondrial TDP-43 and har-1 À / À worms showed salient abnormalities in and synaptic damage. their pattern of thrashing in liquid (Fig. 1d, Supplementary Fig. 1b and Supplementary Movies 1,2). Interestingly, abnormal curling behaviour increases with age in C. elegans and is reflective Results of a defect in motor coordination21. At ambient temperature, Loss of har-1 loss impairs movement and mitochondria in har-1 À / À and TDP-43 strains showed 4.9-fold and 2.1 increases C.
Recommended publications
  • Whole Exome Should Be Preferred Over Sanger Sequencing in Suspected Mitochondrial Myopathy

    Whole Exome Should Be Preferred Over Sanger Sequencing in Suspected Mitochondrial Myopathy

    Neurobiology of Aging 78 (2019) 166e167 Contents lists available at ScienceDirect Neurobiology of Aging journal homepage: www.elsevier.com/locate/neuaging Letter to the editor Whole exome should be preferred over Sanger sequencing in suspected mitochondrial myopathy With interest we read the article by Rubino et al. about Sanger X-linked trait of inheritance, whole exome sequencing rather than sequencing of the genes CHCHD2 and CHCHD10 in 62 Italian pa- Sanger sequencing of single genes is recommended to detect the tients with a mitochondrial myopathy without a genetic defect underlying genetic defect. In case of a maternal trait of inheritance, (Rubino et al., 2018). The authors found the previously reported however, sequencing of the mtDNA is recommended. Whole exome variant c.307C>A in the CHCHD10 gene (Perrone et al., 2017)in1of sequencing is preferred over Sanger sequencing as myopathies or the 62 patients (Rubino et al., 2018). We have the following com- phenotypes in general that resemble an MID are in fact due to ments and concerns. mutations in genes not involved in mitochondrial functions, rep- If no mutation was found in 61 of the 62 included myopathy resenting genotypic heterogeneity. patients, how can the authors be sure that these patients had We do not agree that application of SIFT and polyphem 2 is indeed a mitochondrial disorder (MID). We should be informed on sufficient to confirm pathogenicity of a variant. Confirmation of the which criteria and by which means the diagnosis of an MID was pathogenicity requires documentation of the variant in other established in the 61 patients, who did not carry a mutation in the populations, segregation of the phenotype with the genotype CHCHD2 and CHCHD10 genes, respectively.
  • © 2019 Jan C. Lumibao

    © 2019 Jan C. Lumibao

    © 2019 Jan C. Lumibao CHCHD2 AND THE TUMOR MICROENVIRONMENT IN GLIOBLASTOMA BY JAN C. LUMIBAO DISSERTATION Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in Nutritional Sciences in the Graduate College of the University of Illinois at Urbana-Champaign, 2019 Urbana, Illinois Doctoral Committee: Professor Brendan A. Harley, Chair Professor H. Rex Gaskins, Director of Research Assistant Professor Andrew J. Steelman Professor Rodney W. Johnson Professor Emeritus John W. Erdman ABSTRACT Glioblastoma (GBM) is the most common, aggressive, and deadly form of primary brain tumor in adults, with a median survival time of only 14.6 months. GBM tumors present with chemo- and radio-resistance and rapid, diffuse invasion, making complete surgical resection impossible and resulting in nearly universal recurrence. While investigating the genomic landscape of GBM tumors has expanded understanding of brain tumor biology, targeted therapies against cellular pathways affected by the most common genetic aberrations have been largely ineffective at producing robust survival benefits. Currently, a major obstacle to more effective therapies is the impact of the surrounding tumor microenvironment on intracellular signaling, which has the potential to undermine targeted treatments and advance tumor malignancy, progression, and resistance to therapy. Additionally, mitochondria, generally regarded as putative energy sensors within cells, also play a central role as signaling organelles. Retrograde signaling occurring from
  • Metabolic and Muscle-Derived Serum Biomarkers Define CHCHD10-Linked Late-Onset Spinal Muscular Atrophy

    Metabolic and Muscle-Derived Serum Biomarkers Define CHCHD10-Linked Late-Onset Spinal Muscular Atrophy

    medRxiv preprint doi: https://doi.org/10.1101/2021.04.07.21254960; this version posted April 9, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted medRxiv a license to display the preprint in perpetuity. All rights reserved. No reuse allowed without permission. Metabolic and muscle-derived serum biomarkers define CHCHD10-linked late-onset spinal muscular atrophy Julius Järvilehto, MB1, Sandra Harjuhaahto, MSc1, Edouard Palu, MD2, Mari Auranen, MD, PhD2, Jouni Kvist, PhD1, Henrik Zetterberg, MD, PhD3,4,5,6, Johanna Koskivuori, MSc7, Marko Lehtonen, PhD7, Anna Maija Saukkonen, MD8, Manu Jokela, MD, PhD9,10, Emil Ylikallio, MD, PhD1,2*, Henna Tyynismaa, PhD1,11,12* 1Stem Cells and Metabolism Research Program, Faculty of Medicine, University of Helsinki, Helsinki, Finland 2Clinical Neurosciences, Neurology, Helsinki University Hospital, Helsinki, Finland 3Clinical Neurochemistry Laboratory, Sahlgrenska University Hospital, Mölndal, Sweden 4Department of Psychiatry and Neurochemistry, Institute of Neuroscience and Physiology, the Sahlgrenska Academy at the University of Gothenburg, Mölndal, Sweden 5Department of Neurodegenerative Disease, UCL Institute of Neurology, London, United Kingdom 6UK Dementia Research Institute at UCL, London, United Kingdom 7School of Pharmacy, University of Eastern Finland, Kuopio, Finland 8Department of Neurology, Central Hospital of Northern Karelia, Joensuu, Finland 9Division of Clinical Neurosciences, Turku University Hospital and University of Turku, Turku, Finland 10Department of Neurology, Neuromuscular Research Center, Tampere University Hospital and Tampere University, Tampere, Finland 11Neuroscience Center, Helsinki Institute of Life Science, University of Helsinki, Helsinki, Finland 12Department of Medical and Clinical Genetics, University of Helsinki, Helsinki, Finland *Corresponding Author: Henna Tyynismaa, Biomedicum Helsinki, Haartmaninkatu 8, 00014 University of Helsinki, Finland.
  • CHCHD2 (NM 016139) Human Tagged ORF Clone Product Data

    CHCHD2 (NM 016139) Human Tagged ORF Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC209806 CHCHD2 (NM_016139) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: CHCHD2 (NM_016139) Human Tagged ORF Clone Tag: Myc-DDK Symbol: CHCHD2 Synonyms: C7orf17; MIX17B; MNRR1; NS2TP; PARK22 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC209806 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGCGTGGAAGCCGAAGCCGCACCTCCCGCATGGCCCCTCCGGCCAGCCGGGCCCCTCAGATGAGAG CTGCACCCAGGCCAGCACCAGTCGCTCAGCCACCAGCAGCGGCACCCCCATCTGCAGTTGGCTCTTCTGC TGCTGCGCCCCGGCAGCCAGTTCTGATGGCCCAGATGGCAACCACTGCAGCTGGCGTGGCTGTGGGCTCT GCTGTGGGGCACACATTGGGTCACGCCATTACTGGGGGCTTCAGTGGAGGAAGTAATGCTGAGCCTGCGA GGCCTGACATCACTTACCAGGAGCCTCAGGGAACCCAGCCAGCACAGCAGCAGCAGCCTTGCCTCTATGA GATCAAACAGTTTCTGGAGTGTGCCCAGAACCAGGGTGACATCAAGCTCTGTGAGGGTTTCAATGAGGTG CTGAAACAGTGCCGACTTGCAAACGGATTGGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC209806 protein sequence Red=Cloning site Green=Tags(s) MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPVLMAQMATTAAGVAVGS AVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEV LKQCRLANGLA myc-FLAG tag Restriction Sites: SgfI-MluI This product
  • Mutation Analysis of CHCHD10 in Different Neurodegenerative Diseases

    Mutation Analysis of CHCHD10 in Different Neurodegenerative Diseases

    Mutation analysis of CHCHD10 in neurodegenerative diseases, including Parkinson’s disease Ekaterina Rogaeva Tanz Centre for Research in Faculty of Medicine, Neurodegenerative Diseases, Neurology Division University of Toronto Objective is to update on recent genetic findings related to CHCHD10 & CHCHD2 International Conference on Parkinson’s disease and Movement disorder Frankfurt, Germany, Aug 11-13 2015 CHCHD10 is novel ALS/FTD gene FTD & ALS: genetic, clinical & histopathology data [Hardy J & Rogaeva E, Experimental Neurology, 2013] Novel disease genes: MATR3 (RNA/DNA-binding protein): ALS [ Johnson et al, Nature Neur, 2014] CHCHD10 (mitochondrial protein): ALS/FTD [Bannwarth et al., Brain, 2014] Patients of the French family presented with a complex phenotype, including: • ALS (main) • ALS/FTLD • mitochondrial myopathy • cerebellar ataxia • parkinsonism Bannwarth et al., Brain 2014 Result of whole exome sequencing of 2 affected family members p.S59L is found in all 8 affected cases Bannwarth et al., Brain 2014 CHCHD10 is located in mitochondrial intermembrane space Bannwarth et al., Brain 2014 Immunoelectron microscopy of CHCHD10 CHCHD10 protein is enriched at cristae junctions mitochondria Destruction of the mitochondrial network in CHCHD10 patients Bannwarth et al., Brain 2014 Muscle biopsy shows respiratory chain deficiency Defect in assembly of mitochondrial Complex V Deletions in mitochondrial DNA MT WT MT WT MT WT MT MT WT MT WT Brain pathology in mutation carriers is unknown CHCHD10 is confirmed as ALS gene: novel p.R15L in
  • Regulation of COX Assembly and Function by Twin CX9C Proteins—Implications for Human Disease

    Regulation of COX Assembly and Function by Twin CX9C Proteins—Implications for Human Disease

    cells Review Regulation of COX Assembly and Function by Twin CX9C Proteins—Implications for Human Disease Stephanie Gladyck 1, Siddhesh Aras 1,2, Maik Hüttemann 1 and Lawrence I. Grossman 1,2,* 1 Center for Molecular Medicine and Genetics, Wayne State University School of Medicine, Detroit, MI 48201, USA; [email protected] (S.G.); [email protected] (S.A.); [email protected] (M.H.) 2 Perinatology Research Branch, Division of Obstetrics and Maternal-Fetal Medicine, Division of Intramural Research, Eunice Kennedy Shriver National Institute of Child Health and Human Development, National Institutes of Health, U.S. Department of Health and Human Services, Bethesda, Maryland and Detroit, MI 48201, USA * Correspondence: [email protected] Abstract: Oxidative phosphorylation is a tightly regulated process in mammals that takes place in and across the inner mitochondrial membrane and consists of the electron transport chain and ATP synthase. Complex IV, or cytochrome c oxidase (COX), is the terminal enzyme of the electron transport chain, responsible for accepting electrons from cytochrome c, pumping protons to contribute to the gradient utilized by ATP synthase to produce ATP, and reducing oxygen to water. As such, COX is tightly regulated through numerous mechanisms including protein–protein interactions. The twin CX9C family of proteins has recently been shown to be involved in COX regulation by assisting with complex assembly, biogenesis, and activity. The twin CX9C motif allows for the import of these proteins into the intermembrane space of the mitochondria using the redox import machinery of Mia40/CHCHD4. Studies have shown that knockdown of the proteins discussed in this review results in decreased or completely deficient aerobic respiration in experimental models ranging from yeast to human cells, as the proteins are conserved across species.
  • Genomic Portrait of a Sporadic Amyotrophic Lateral Sclerosis Case in a Large Spinocerebellar Ataxia Type 1 Family

    Genomic Portrait of a Sporadic Amyotrophic Lateral Sclerosis Case in a Large Spinocerebellar Ataxia Type 1 Family

    Journal of Personalized Medicine Article Genomic Portrait of a Sporadic Amyotrophic Lateral Sclerosis Case in a Large Spinocerebellar Ataxia Type 1 Family Giovanna Morello 1,2, Giulia Gentile 1 , Rossella Spataro 3, Antonio Gianmaria Spampinato 1,4, 1 2 3 5, , Maria Guarnaccia , Salvatore Salomone , Vincenzo La Bella , Francesca Luisa Conforti * y 1, , and Sebastiano Cavallaro * y 1 Institute for Research and Biomedical Innovation (IRIB), Italian National Research Council (CNR), Via Paolo Gaifami, 18, 95125 Catania, Italy; [email protected] (G.M.); [email protected] (G.G.); [email protected] (A.G.S.); [email protected] (M.G.) 2 Department of Biomedical and Biotechnological Sciences, Section of Pharmacology, University of Catania, 95123 Catania, Italy; [email protected] 3 ALS Clinical Research Center and Neurochemistry Laboratory, BioNeC, University of Palermo, 90127 Palermo, Italy; [email protected] (R.S.); [email protected] (V.L.B.) 4 Department of Mathematics and Computer Science, University of Catania, 95123 Catania, Italy 5 Department of Pharmacy, Health and Nutritional Sciences, University of Calabria, Arcavacata di Rende, 87036 Rende, Italy * Correspondence: [email protected] (F.L.C.); [email protected] (S.C.); Tel.: +39-0984-496204 (F.L.C.); +39-095-7338111 (S.C.); Fax: +39-0984-496203 (F.L.C.); +39-095-7338110 (S.C.) F.L.C. and S.C. are co-last authors on this work. y Received: 6 November 2020; Accepted: 30 November 2020; Published: 2 December 2020 Abstract: Background: Repeat expansions in the spinocerebellar ataxia type 1 (SCA1) gene ATXN1 increases the risk for amyotrophic lateral sclerosis (ALS), supporting a relationship between these disorders.
  • Chchd10, a Novel Bi-Organellar Regulator of Cellular Metabolism: Implications in Neurodegeneration

    Chchd10, a Novel Bi-Organellar Regulator of Cellular Metabolism: Implications in Neurodegeneration

    Wayne State University Wayne State University Dissertations January 2018 Chchd10, A Novel Bi-Organellar Regulator Of Cellular Metabolism: Implications In Neurodegeneration Neeraja Purandare Wayne State University, [email protected] Follow this and additional works at: https://digitalcommons.wayne.edu/oa_dissertations Part of the Molecular Biology Commons Recommended Citation Purandare, Neeraja, "Chchd10, A Novel Bi-Organellar Regulator Of Cellular Metabolism: Implications In Neurodegeneration" (2018). Wayne State University Dissertations. 2125. https://digitalcommons.wayne.edu/oa_dissertations/2125 This Open Access Dissertation is brought to you for free and open access by DigitalCommons@WayneState. It has been accepted for inclusion in Wayne State University Dissertations by an authorized administrator of DigitalCommons@WayneState. CHCHD10, A NOVEL BI-ORGANELLAR REGULATOR OF CELLULAR METABOLISM: IMPLICATIONS IN NEURODEGENERATION by NEERAJA PURANDARE DISSERTATION Submitted to the Graduate School of Wayne State University, Detroit, Michigan in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY 2018 MAJOR: MOLECULAR BIOLOGY AND GENETICS Approved By: Advisor Date © COPYRIGHT BY NEERAJA PURANDARE 2018 All Rights Reserved ACKNOWLEDGEMENTS First, I would I like to express the deepest gratitude to my mentor Dr. Grossman for the advice and support and most importantly your patience. Your calm and collected approach during our discussions provided me much needed perspective towards prioritizing and planning my work and I hope to carry this composure in my future endeavors. Words cannot describe my gratefulness for the support of Dr. Siddhesh Aras. You epitomize the scientific mind. I hope that I have inculcated a small fraction of your scientific thought process and I will carry this forth not just in my career, but for everything else that I do.
  • CHCHD2 Antibody Cat

    CHCHD2 Antibody Cat

    CHCHD2 Antibody Cat. No.: 19-066 CHCHD2 Antibody Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human IMMUNOGEN: A synthetic Peptide of human CHCHD2 TESTED APPLICATIONS: Flow, IHC, WB WB: ,1:200 - 1:500 APPLICATIONS: IHC: ,1:50 - 1:100 Flow: ,1:20 - 1:50 POSITIVE CONTROL: 1) A-549 2) MCF7 PREDICTED MOLECULAR Observed: 17kDa WEIGHT: Properties PURIFICATION: Affinity purification CLONALITY: Polyclonal September 30, 2021 1 https://www.prosci-inc.com/chchd2-antibody-19-066.html ISOTYPE: IgG CONJUGATE: Unconjugated PHYSICAL STATE: Liquid BUFFER: PBS with 0.02% sodium azide, pH7.3. STORAGE CONDITIONS: Store at 4˚C. Avoid freeze / thaw cycles. Additional Info OFFICIAL SYMBOL: CHCHD2 Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial, Aging- ALTERNATE NAMES: associated gene 10 protein, HCV NS2 trans-regulated protein, NS2TP, CHCHD2, C7orf17 GENE ID: 51142 USER NOTE: Optimal dilutions for each application to be determined by the researcher. Background and References The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress, the protein translocates from the mitochondrial intermembrane space to the nucleus where it binds to a highly conserved 13 nucleotide oxygen responsive element in the promoter of cytochrome oxidase 4I2, a subunit of the terminal enzyme of the electron transport BACKGROUND: chain. In concert with recombination signal sequence-binding protein J, binding of this protein activates the oxygen responsive element at four percent oxygen. In addition, it has been shown that this protein is a negative regulator of mitochondria-mediated apoptosis.
  • Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration

    Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration

    International Journal of Molecular Sciences Review Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration Baojin Ding * and Masood Sepehrimanesh Department of Biology, University of Louisiana at Lafayette, 410 East Saint Mary Boulevard, Lafayette, LA 70503, USA; [email protected] * Correspondence: [email protected] Abstract: Nucleocytoplasmic transport (NCT) across the nuclear envelope is precisely regulated in eukaryotic cells, and it plays critical roles in maintenance of cellular homeostasis. Accumulating evidence has demonstrated that dysregulations of NCT are implicated in aging and age-related neurodegenerative diseases, including amyotrophic lateral sclerosis (ALS), frontotemporal dementia (FTD), Alzheimer’s disease (AD), and Huntington disease (HD). This is an emerging research field. The molecular mechanisms underlying impaired NCT and the pathogenesis leading to neurodegener- ation are not clear. In this review, we comprehensively described the components of NCT machinery, including nuclear envelope (NE), nuclear pore complex (NPC), importins and exportins, RanGTPase and its regulators, and the regulatory mechanisms of nuclear transport of both protein and transcript cargos. Additionally, we discussed the possible molecular mechanisms of impaired NCT underlying aging and neurodegenerative diseases, such as ALS/FTD, HD, and AD. Keywords: Alzheimer’s disease; amyotrophic lateral sclerosis; Huntington disease; neurodegenera- tive diseases; nuclear pore complex; nucleocytoplasmic transport; Ran GTPase Citation: Ding, B.; Sepehrimanesh, M. Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration. 1. Introduction Int. J. Mol. Sci. 2021, 22, 4165. As a hallmark of eukaryotic cells, the genetic materials are separated from the cyto- https://doi.org/10.3390/ijms plasmic contents by a highly regulated membrane, called nuclear envelope (NE), which 22084165 has two concentric bilayer membranes, the inner nuclear membrane (INM), and outer nuclear membrane (ONM).
  • Amyotrophic Lateral Sclerosis and Frontotemporal Lobar Degenerations: Similarities in Genetic Background

    Amyotrophic Lateral Sclerosis and Frontotemporal Lobar Degenerations: Similarities in Genetic Background

    diagnostics Review Amyotrophic Lateral Sclerosis and Frontotemporal Lobar Degenerations: Similarities in Genetic Background Eva Parobkova 1 and Radoslav Matej 1,2,3,* 1 Department of Pathology and Molecular Medicine, Third Faculty of Medicine, Charles University and Thomayer University Hospital, 14059 Prague, Czech Republic; [email protected] 2 Department of Pathology, First Faculty of Medicine, Charles University, and General University Hospital, 14059 Prague, Czech Republic 3 Department of Pathology, Third Faculty of Medicine, Charles University, and University Hospital Kralovske Vinohrady, 14059 Prague, Czech Republic * Correspondence: [email protected] Abstract: Amyotrophic lateral sclerosis (ALS) is a devastating, uniformly lethal progressive degen- erative disorder of motor neurons that overlaps with frontotemporal lobar degeneration (FTLD) clinically, morphologically, and genetically. Although many distinct mutations in various genes are known to cause amyotrophic lateral sclerosis, it remains poorly understood how they selectively impact motor neuron biology and whether they converge on common pathways to cause neuronal degeneration. Many of the gene mutations are in proteins that share similar functions. They can be grouped into those associated with cell axon dynamics and those associated with cellular phagocytic machinery, namely protein aggregation and metabolism, apoptosis, and intracellular nucleic acid transport. Analysis of pathways implicated by mutant ALS genes has provided new insights into the pathogenesis of both familial forms of ALS (fALS) and sporadic forms (sALS), although, regrettably, this has not yet yielded definitive treatments. Many genes play an important role, with TARDBP, Citation: Parobkova, E.; Matej, R. SQSTM1, VCP, FUS, TBK1, CHCHD10, and most importantly, C9orf72 being critical genetic players Amyotrophic Lateral Sclerosis and in these neurological disorders.
  • [KO Validated] CHCHD2 Rabbit Pab

    [KO Validated] CHCHD2 Rabbit Pab

    Leader in Biomolecular Solutions for Life Science [KO Validated] CHCHD2 Rabbit pAb Catalog No.: A16645 KO Validated Basic Information Background Catalog No. The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins A16645 characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress, the Observed MW protein translocates from the mitochondrial intermembrane space to the nucleus where 16kDa it binds to a highly conserved 13 nucleotide oxygen responsive element in the promoter of cytochrome oxidase 4I2, a subunit of the terminal enzyme of the electron transport Calculated MW chain. In concert with recombination signal sequence-binding protein J, binding of this 15kDa protein activates the oxygen responsive element at four percent oxygen. In addition, it has been shown that this protein is a negative regulator of mitochondria-mediated Category apoptosis. In response to apoptotic stimuli, mitochondrial levels of this protein decrease, allowing BCL2-associated X protein to oligomerize and activate the caspase Primary antibody cascade. Pseudogenes of this gene are found on multiple chromosomes. Alternative splicing results in multiple transcript variants. Applications WB, IHC, IF Cross-Reactivity Human, Mouse, Rat Recommended Dilutions Immunogen Information WB 1:500 - 1:2000 Gene ID Swiss Prot 51142 Q9Y6H1 IHC 1:50 - 1:200 Immunogen 1:50 - 1:200 IF Recombinant fusion protein containing a sequence corresponding to amino acids 75-145 of human CHCHD2 (NP_057223.1). Synonyms CHCHD2;C7orf17;MNRR1;NS2TP;PARK22 Contact Product Information www.abclonal.com Source Isotype Purification Rabbit IgG Affinity purification Storage Store at -20℃.