DOCSLIB.ORG

2 Euro Kibris 2008

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
2 Euro Kibris 2008 2 euro kibris 2008 click here to download We offer the lowest price online for the Cyprus 2 euros coin. The coin depicst a cruciform idol from the Chalcolithic period ( BC). [eur]. Jul 10, As from 1 February , only euro banknotes and coins may be The Cypriot 2 euro coin edge inscription Image of Cyprus 2 euros coin. Detailed information about the coin 2 Euro, Cyprus, with pictures and collection Lettering: ΚΥΠΡΟΣ KIBRIS Engraver: Tatiana Sotiropoulou, Erik Maell. Cypriot euro coins feature three separate designs for the three series of coins. Cyprus has been In and , the Mint of Finland was chosen to mint the coins (except the €2 1 Cypriot euro design; 2 Circulating Mintage quantities; 3 Identifying marks; 4 Design National Identifier, "ΚΥΠΡΟΣ (Kypros) and KIBRIS". Worth - Cyprus 2 euro in the coin catalog at www.doorway.ru Edge description, '2 EYPΩ 2 EURO 2 EYPΩ 2 EURO' Obverse, KIBRIS / ΚΥΠΡΟΣ. Find 2 euro kibris from a vast selection of Coins. Get great deals #e Zypern Kursmünzensatz Euro-Set Cyprus * Kibris 1 Cent bis 2 Euro. EUR Find great deals for Cyprus 2 Euro, Shop with confidence on eBay!. Find great deals for Cyprus Euro, Shop with 2 Euro Coin Cyprus Gem Uncirculated Cyprus 2 Euro Cents~Double Ram~Free Shipping. Text picture side: ΚΥΠΡΟΣ KIBRIS (CYPRUS) Text value side: 2 EURO. Design, Picture side: Tatiana Sotiropoulou, Erik Maell Value side: Luc Luycx. www.doorway.ru is a complete online catalog of values for euro coins with daily updated market prices for your Click here to access Cyprus 2 Cent Coin 1 cent, 2 cent, 5 cent, Cyprus, подробнее. 1 euro, Cyprus, подробнее. 2 euro, Cyprus, подробнее. Cypriot Euro coins and Euro coin sets, Euro coins of Cyprus, Cypriot 2 Euro stage of the EMU and adopted the euro as its official currency on 1 January in Greek and Turkish, that is, ΚΥΠΡΟΣ and KIBRIS in the design for the coins. 2-euro,KIBRIS in category: Collecting, Coins, Regions, Southern Europe ( Item ID ). in February - the Euro becoming the official currency on 1st January . The first motif (1,2 and5 cent coins)is the Cyprus Mollon - a wild Cypriot Goat. They are Cypros (in the Greek alphabet) and Kibris which is the Turkish for. Results 1 - 24 of CYPRUS REP 20 EURO CENTS UNC THE SHIP OF Grades Extra Fine Cyprus Copper-Nickel 2 Schillings Coin KM # €2 commemorative side. Feature: Ten years of the Euro. Description: The inner part of the coin, designed by Helmut Andexlinger of the Austrian Mint and chosen . Obverse: Twelve stars surround two moufflons, legend KYΠPOΣ· (date) · KIBRIS from above to right. Reverse: 2 on the left-hand side follow by EURO CENT in. y12choisir sells an item at a starting price of € until Monday, 18 June CEST in the Greece category on Delcampe. 2 cents 18,75 mm 3,06 g steel, copper, 2 centesimi di euro di Cipro in the design of the coins the name of Cyprus in Greek (ΚΥΠΡΟΣ), Turkish (KIBRIS) . coins - Cypriot euro [EUR] coinage from ; coins description including: 1, 2, 5, 10, 20 and 50 euro cent and 1 and 2 euro with commemorative coins. The trilingual description was replaced by bilingual "ΚΥΠΡΟΣ KIBRIS" the name of. Results 1 - 48 of Cyprus 2 Euro commemorative coin "Paphos" UNC. Date of issue: . 2 Euro coin Cyprus 2 Euro coin from Cyprus 2€ Übersicht. ΚΥΠΡΟΣ KIBRIS/ΟΝΕ Mintmark: None. © European Union, , Official Journal of the European Union, /C / items 2 Euro UNC EUROPÄISCHE KULTURHAUPTSTADT PAPHOS 2 Euro AU() Bi-Metallic, KM, US$+ US$ shipping. Turkish shops now display their prices in euros, the Greek branch of variety of Labour Party, based on strong trade unions and farmers' cooperatives (2). to be a member of this looter's club”, Friends of Cyprus Report n° 50, London, Currency converter from Euro (EUR) to Indian Rupee (INR): convert from 2c, 5c , 10c, 20c, 50c, €1, €2; Euro banknotes available: €5, €10, €20, €50, € Cyprus KM# 79 coin 2 Euro Cent ( - ) full numismatic specifications with clear reverse and observe photos. Lettering: ΚΥΠΡΟΣ · · KIBRIS 2 EURO. 2 euro commemorative coin, Brilliant Uncirculated. The country of issue « ΚΥΠΡΟΣ KIBRIS» and the phrase «Πάφος - Πολιτιστική πρωτεύουσα Ευρώπης» (Paphos – San Marino – 2 € “European Year of Intercultural Dialogue”. Country: Cyprus Mintage year: Issue date: Face value: 2 euro Diameter: e il millesimo di conio inserito tra i due, “ΚΥΠΡΟΣ KIBRIS“, sono incisi a. 2 Euro Holstein I ; 2 Euro Reinland ; 2 Euro Berlin ; 2 Euro Vorpommern ; 2 Euro Kibris ; 2 Euro Slovenko ; 2 Euro Athens ;. [1] In and , the Mint of Finland was chosen to mint the coins). €1 and €2: The Idol of Pomos, a cross-shaped idol dating back to the Cypriot chalcolithic and Turkish, that is, ΚΥΠΡΟΣ (Kypros) and KIBRIS in the design for the coins. Central Bank. 2 Euro , KM# 85, Cyprus (a small copy of) itself. Engravers: Tatiana Sotiropoulou, Erik Maell. ΚΥΠΡΟΣ KIBRIS Reverse. 2 euro, a portrait of Bertha von Suttner, first woman to win the Nobel Peace Prize, – the design of national sides of coins, Belgium has updated its national design for euro coins issued from Country code: KYΠPOΣ - KIBRIS. In and , the Mint of Finland was chosen to mint the coins (except the € 2 2 ΕΥΡΩ 2 EURO National Identifier, "ΚΥΠΡΟΣ (Kypros) and KIBRIS". Jun 5, 2 EURO CENT Coin KIBRIS - £ To sell a 2 Euro dent coin, KIBRIS Find great deals on eBay for 2 euro Shop with BRILLIANT!! CYPRUS *BU 25 COINSX2 EURO IN MINT ROLL* GREECE,ZYPERN,KIBRIS. One Euro. First circulation The dawn of an era. First founded in . icin yılında Kıbrıs Cumhuriyeti Euro para birimine geçtiginde 1 ve 2 Euro. CYPRUS 1 OFFICIAL ROLL 50 COINS UNC 1 EURO CENT COPPER PLATED . PROOF COIN IN OFFICIAL CASE + 1 SET 8 COINS 1C-2 EUROS This seller SET 6 www.doorway.ru COINS LAST CENT,ZYPERN CHYPRE KIBRIS, GREECE. This special high-value commemorative coin is not to be confused with €2 commemorative ΔΗΜΟΚΡΑΤΙΑ» and «KIBRIS CUMHURİYETİ» and the dates «». " Silver Collector Coin - Accession of Cyprus to the euro area. Nov 3, yli: Euro-Master Received a 2 euro Cyprus coin today at a tiny shop between Kotor and Tivat, . Yesterday I received 10 cent Kibris ). YuriBS Homepage, Euro coins (Cyprus 2 EURO ) culture and civilization. Last updated: (6 years 2 months 17 days) Cyprus (Κύπρος/Kıbrıs). 2 euro coin The 2 euro coin (€2) is the highest value euro coin and has been used Cyprus and Malta joined in , Slovakia in and Estonia in , It includes the name of Cyprus in Greek and Turkish (ΚΥΠΡΟΣ and KIBRIS) on . 2. Despite all the EU promises as to million euros as financial aid to northern Cyprus, as ofJanuary 4, , only Cyprus Mail, Kibris, online, June 4, Pure Gold Pendant Coin *Elizabeth II And Kibris* - % Gold Genuine Gold Coin Cook Islands Coin in 24karat % Solid gold 18kt Cyprus 1 euro cent, Kibris, Ram. Sheep, animal wildlife coin 1 of 2 Cyprus 1 euro cent, Kibris, Ram. Sheep, animal wildlife coin 2 of 2 See More. di conio inserito tra i due, “ΚΥΠΡΟΣ KIBRIS“, sono incisi a semicerchio sul lato destro sopra la nave. 2 Euro Commemorativi Olanda Moneta. Nov 27, Cyprus (» ); ISSUE DATE: ; DESIGNER: Tatiana Soteropoulos & Erik KIBRIS'. comum coin of Euro 2€ Sep 13, Wikipedia Cypriot euro coins feature three separate designs for the three CYPRUS SET 8 COIN 1 2 5 10 20 50 CENT 1 2 EURO AUNC. In and , the Mint of Finland was chosen to mint the coins (except the € 2 1 Cypriot euro design; 2 Circulating Mintage quantities; 3 Identifying marks and Turkish, that is, ΚΥΠΡΟΣ (Kypros) and KIBRIS in the design for the coins. 2. Date of Birth: 3. Academic Rank: Assoc. Prof. Dr. 4. Line on the 1st January ”, (Kıbrıs'ta 'de Euro'ya Geçiş” Konferansı) Man-. Center. Kıbrıs Cumhuriyeti (Turkish) Cyprus introduced the euro (€) on 1 January In .. 2 euro commemorative coins - Image: 2 Euro Italien 60 Jahre. Kibris synonyms, Kibris pronunciation, Kibris translation, English dictionary definition of Kibris. Currency: euro and Turkish lira. cy•prus. (ˈsaɪ prəs) n. cypress. October Ericsson to supply WCDMA/HSPA network for Kuzey Kibris. Cyprus 2-EURO CENT (KM79) Cyprus Mouflon. The Mouflon is a very old they are quite rare. In , Cyprus switched to the Euro. ΚΥΠΡΟΣ [date] KIBRIS. This Cyprus 2 euro commemorative coin commemorates the 10th anniversary of the Economic and Monetary Union. (UNCirculated). Birinci aşamada, AB'nin Kıbrıs politikalarını şartlılık bağlamında tartışmayı Union (EU) conditionality that worked in favour of GCA interests.2 The GCA's. Il nome greco e quello turco dell'isola, e il millesimo di conio inserito tra i due, “ ΚΥΠΡΟΣ KIBRIS“, sono incisi a semicerchio sul lato destro sopra la nave. Commemorative 2 euro coins from San Marino conio inserito tra i due, “ ΚΥΠΡΟΣ KIBRIS“, sono incisi a semicerchio sul lato destro sopra ai due animali. Pièce de 2 Euros - Monaco - Pièce neuve - Deuxième série Also find us. 3 (): – Kirişçi “Erdoğan: Kibris diye bir Ülke yok. Accessed March 28, www.doorway.ru 2 (): – “Between Europeanization and Euro-Asianism: Foreign Policy Activism in. Cyprus Ship of Kyrenia 4th century B.C. Bimetallic €2 Pattern BU. $ Probe Euro Coin Zypern/Cyprus/Kibris $ Cyprus set of 8 euro. 50 euro cent Belgium Belgique Years 2 euro 14 Сoins 14 countries Money European Union Numismatic Video cent Chypre Cipro Zypern Chypr КИПР ЕВРО ЦЕНТ Kıbrıs Euro Cent. Toyota Corolla. € · Jeep Patriot. € · Mercedes-Benz E Klasse. € · Mazda 2. € · Mitsubishi Colt. € Aug 27, Cyprus 1 euro [eur] - Fleur de Coin We offer the lowest price online for the Cyprus 1 euro coin.
Load more

Recommended publications
  • ANNUAL REPORT 2014 in Charts, the Dots Indicate the Actual Data, and the Lines Reflect the Smoothing Approximation of the Data
    ISSN 1407–1800 LATVIJAS BANKA: ANNUAL REPORT 2014 In Charts, the dots indicate the actual data, and the lines reflect the smoothing approximation of the data. The smoothing approximation of the daily data is more distinguished than the curve of the actual data. Details may not add because of rounding-off. – no transactions or no outstanding amounts in the period. x no data available or no computation of indicators possible. 0 the indicator is below 0.5 but over 0, or the result of the computation of the indicator is 0. © Latvijas Banka, 2015 The source is to be indicated when reproduced. Photos: Ieva Lūka and Andris Tenass The cut-off date is 27 April 2015. ISSN 1407–1800 Latvijas Banka K. Valdemāra iela 2A, Riga, LV-1050 Tel.: +371 67022300 Fax: +371 67022420 http://www.bank.lv [email protected] CONTENTS Foreword of the Governor 5 3 Statements of Vision, Mission and Values of Latvijas Banka 8 Economic Environment 9 Global and Euro Area Economic Environment 10 Currency and Financial Markets 10 Real Sector 12 Latvia's Economic Environment 14 Inflation and Prices 14 Gross Domestic Product 15 Labour Market 18 Foreign Trade, Balance of Payments and External Debt 19 Fiscal Developments 21 Credit Institution Developments 23 Money Supply 24 Lending and Deposit Rates 28 Foreign Exchange and Interbank Market 30 Securities Market 33 LATVIJAS BANKA: ANNUAL REPORT 2014 REPORT ANNUAL BANKA: LATVIJAS Operations and Activities of Latvijas Banka 35 Legal Framework and Functions. Latvijas Banka in the Eurosystem and Institutions of the European Union 36 Development,
    [Show full text]
  • Coin Accessories Catalogue 2021
    COIN ACCESSORIES CATALOGUE 2021 www.leuchtturm.com Dear collectors, Passion and pleasure are two terms that have linked us, at LIGHTHOUSE, with our accessories for more than 100 years. We are very pleased to publish this Accessories for Numismatists catalogue, containing our extensive range of accessories for coin enthusiasts. More than 6,000 products now bear the LIGHTHOUSE brand name, which has become a symbol of practicality and quality. We are always on the lookout for new, original products which will make your hobby even more enjoyable. Your feedback is very important to us. Please support us with your comments, suggestions and even criticisms. Why not take a look at our bestsellers as well as exciting new arrivals: the new safe disguised as a book can be hidden away elegantly in your bookcase, providing an excellent hiding place for your valuables. Then there are new magnifiers, LIGHTHOUSE ring binders in attractive metallic colours as well as accessories for gold bars that we wish to present to you. If you would like to know more about our coin capsules that actively stop the tarnishing of coins (INTERCEPT®), we would be more than happy to send you our separate flyer. For further details, please contact your local store, or visit www.leuchtturm.com/intercept Here’s wishing you hours of pleasure with your hobby along with our matching accessories for your collection! Kurt StürkenAxel Stürken Max Stürken LEUCHTTURM GRUPPE GMBH & CO. KG · Am Spakenberg 45 · D-21502 Geesthacht · Germany Tel. +49 (0) 4152 / 8 01 - 0 · Fax +49 (0) 4152 / 801 - 222 · E-Mail: [email protected] www.leuchtturm.com GB EURO • Effective 1 October, 2019 • Ref.
    [Show full text]
  • E Euro Symbol Was Created by the European Commission
    e eu ro c o i n s 1 unity an d d i v e r s i t The euro, our currency y A symbol for the European currency e euro symbol was created by the European Commission. e design had to satisfy three simple criteria: ADF and BCDE • to be a highly recognisable symbol of Europe, intersect at D • to have a visual link with existing well-known currency symbols, and • to be aesthetically pleasing and easy to write by hand. Some thirty drafts were drawn up internally. Of these, ten were put to the test of approval by the BCDE, DH and IJ general public. Two designs emerged from the are parallel scale survey well ahead of the rest. It was from these two BCDE intersects that the President of the Commission at the time, at C Jacques Santer, and the European Commissioner with responsibility for the euro, Yves-ibault de Silguy, Euro symbol: geometric construction made their final choice. Jacques Santer and Yves-ibault de Silguy e final choice, the symbol €, was inspired by the letter epsilon, harking back to classical times and the cradle of European civilisation. e symbol also refers to the first letter of the word “Europe”. e two parallel lines indicate the stability of the euro, as they do in the symbol of the dollar and the yen. e official abbreviation for the euro is EUR. © European Communities, 2008 e eu ro c o i n s 2 unity an d d i v e r s i t The euro, our currency y Two sides of a coin – designing the European side e euro coins are produced by the euro area countries themselves, unlike the banknotes which are printed by the ECB.
    [Show full text]
  • 5068/07 ADD1 REV 1 TB/Pm 1 DG GI COUNCIL OF
    COUNCIL OF Brussels, 21 February 2007 THE EUROPEAN UNION 5068/07 ADD 1 REV 1 UEM 2 ECOFIN 4 COVER NOTE No Cion doc: SEC(2006) 1786/2 Subject: Commission staff working document Annex to the communication from the Commission to the Council, the European Parliament, the European Economic and Social Committee, the Committee of the Regions and the European Central Bank - Five years of euro banknotes and coins Delegations will find attached a new version of Commission document SEC(2006) 1786. ________________________ Encl. : SEC(2006) 1786/2 5068/07 ADD1 REV 1 TB/pm 1 DG G I EN COMMISSION OF THE EUROPEAN COMMUNITIES Brussels, 20.2.2007 SEC(2006) 1786/2 CORRIGENDUM: Ce document annule et remplace le SEC(2006)1786 du 22.12.2006. Concerne la page 28 de la version EN. COMMISSION STAFF WORKING DOCUMENT Annex to the COMMUNICATION FROM THE COMMISSION TO THE COUNCIL, THE EUROPEAN PARLIAMENT, THE EUROPEAN ECONOMIC AND SOCIAL COMMITTEE, THE COMMITTEE OF THE REGIONS AND THE EUROPEAN CENTRAL BANK Five years of euro banknotes and coins {COM(2006) 862 final} EN EN TABLE OF CONTENTS 1. Introduction.............................................................................................................................................4 2. General trends of the circulation of euro banknotes and coins................................................................4 2.1. Use of cash as a means of payment in the euro area ...............................................................................4 2.2. Evolution of the circulation level of euro cash........................................................................................5
    [Show full text]
  • Commission Guidelines on the Implementation of the Regulation 1210/2010
    Ref. Ares(2017)3114527 - 21/06/2017 EUROPEAN COMMISSION DIRECTORATE GENERAL ECONOMIC AND FINANCIAL AFFAIRS Fiscal policy and policy mix Euro Protection and euro cash ETSC - Guidelines On the implementation of Regulation (EU) No 1210/2010 of the European Parliament and of the Council of 15 December 2010 concerning authentication of euro coins and handling of euro coins unfit for circulation. (May 2017) Table of contents 1. INTRODUCTION .............................................................................................................. 3 2. AUTHENTICATION OF EURO COINS .......................................................................... 4 2.1. Detection test .............................................................................................................. 4 2.1.1. Purpose ................................................................................................................. 4 2.1.2. Test procedure ...................................................................................................... 4 2.1.3. Period of validity of test results ............................................................................ 4 2.1.4. Detection test report summary ............................................................................. 5 2.1.5. Declaration of conformity .................................................................................... 5 2.1.6. Consolidated list of coin processing machines .................................................... 6 2.2. Training practices for manual authentication
    [Show full text]
  • The Road to the Euro
    One currency for one Europe The road to the euro Ecomomic and Financial Aff airs One currency for one Europe The road to the euro One currency for one Europe The road to the euro CONTENTS: What is economic and monetary union? ....................................................................... 1 The path to economic and monetary union: 1957 to 1999 ............... 2 The euro is launched: 1999 to 2002 ........................................................................................ 8 Managing economic and monetary union .................................................................. 9 Looking forward to euro area enlargement ............................................................ 11 Achievements so far ................................................................................................................................... 13 The euro in numbers ................................................................................................................................ 17 The euro in pictures .................................................................................................................................... 18 Glossary ........................................................................................................................................................................ 20 2 Idreamstock © One currency for one Europe The road to the euro What is economic and monetary union? Generally, economic and monetary union (EMU) is part of the process of economic integration. Independent
    [Show full text]
  • Number 37 May 2000 Euro Coins from Design to Circulation
    EUROPEAN COMMISSION Number 37 May 2000 (XURFRLQV From design to circulation © European Communities, 2000. (XURFRLQV )URPGHVLJQWRFLUFXODWLRQ 'LUHFWRUDWH*HQHUDOIRU(FRQRPLFDQG)LQDQFLDO$IIDLUV EURO COINS 7+(/(*$/%$6(6 7KH7UHDW\ 7KHWZR5HJXODWLRQVRI0D\ &5($7,1*7+((852&2,16 &KRRVLQJWKHQDPH &KRRVLQJWKHGHQRPLQDWLRQVRIWKHFRLQV 'HWHUPLQLQJWKHWHFKQLFDOVSHFLILFDWLRQVRIWKHFRLQV &KRRVLQJWKHFRPPRQVLGHRIWKHFRLQV &KRRVLQJWKHQDWLRQDOVLGHRIWKHFRLQV &UHDWLQJFROOHFWRUFRLQV…………………………………………………………………………..16 352'8&,1*7+((852&2,16 'HWHUPLQLQJWKHTXDQWLWLHVWRSURGXFH &RQWUROOLQJTXDOLW\ 3527(&7,1*7+((852&2,16« )LOLQJDFRS\ULJKWRQWKHFRPPRQVLGHV 3UHYHQWLQJDQGVXSSUHVVLQJFRXQWHUIHLWLQJ ,1752'8&,1*7+((852&2,16 )LQDOLVLQJWKHVFKHGXOHIRUWKHLQWURGXFWLRQRIWKHFRLQV 'HILQLQJWKHOHQJWKRIWKHSHULRGRIGXDOFLUFXODWLRQ ,1)250$7,216+((76 1R7KHFKRLFHRIWKHHXURV\PERO««««««««««««««««««««««««« 1R6LWXDWLRQRI0RQDFR9DWLFDQ&LW\DQG6DQ0DULQR« 1R8VHIXO,QWHUQHWOLQNV« 1R$GGUHVVHVDQGFRQWDFWVRIWKHFRLQWHVWLQJFHQWUHV« $11(;(6 $UWLFOH H[D RIWKH7UHDW\HVWDEOLVKLQJWKH(XURSHDQ&RPPXQLW\« &RXQFLO5HJXODWLRQ (& 1RRI0D\RQWKHLQWURGXFWLRQRIWKHHXUR &RXQFLO 5HJXODWLRQ (& 1R RI 0D\ RQ GHQRPLQDWLRQV DQG WHFKQLFDO VSHFLILFDWLRQV RI HXUR FRLQV LQWHQGHGIRUFLUFXODWLRQ««« 2/45 &RXQFLO5HJXODWLRQ (& 1RRI)HEUXDU\DPHQGLQJ5HJXODWLRQ (& 1RRQGHQRPLQDWLRQV DQGWHFKQLFDOVSHFLILFDWLRQVRIHXURFRLQVLQWHQGHGIRUFLUFXODWLRQ««««««««« &RPPLVVLRQ5HFRPPHQGDWLRQRI-DQXDU\FRQFHUQLQJFROOHFWRUFRLQVPHGDOVDQGWRNHQV«« 5HSRUWIURPWKH&ROOHFWRU&RLQ6XEJURXSRIWKH0':*IRUWKH(XUR&RLQ6XEFRPPLWWHHRIWKH()&«« &RXQFLO 'HFLVLRQ RI $SULO H[WHQGLQJ (XURSRO V PDQGDWH
    [Show full text]
  • Information Guide Economic and Monetary Union
    Information Guide Economic and Monetary Union A guide to the European Union’s Economic and Monetary Union (EMU), with hyperlinks to sources of information within European Sources Online and on external websites Contents Introduction .......................................................................................................... 2 Background .......................................................................................................... 2 Legal basis ........................................................................................................... 2 Historical development of EMU ................................................................................ 4 EMU - Stage One ................................................................................................... 6 EMU - Stage Two ................................................................................................... 6 EMU - Stage Three: The euro .................................................................................. 6 Enlargement and future prospects ........................................................................... 9 Practical preparations ............................................................................................11 Global economic crisis ...........................................................................................12 Information sources in the ESO database ................................................................19 Further information sources on the internet .............................................................19
    [Show full text]
  • Euro Information in English
    European Union: Members: Germany, France, the Netherlands, Luxembourg, Belgium, Spain, Portugal, Greece, Italy, Austria, Finland, Ireland, United Kingdom, Sweden, Denmark, Poland, Hungary, Slovenia, Slovakia, Malta, Cyprus, Estonia, Lithuania, Latvia, the Czech Republic, Romania and Bulgaria. Flag of the European Union: Contrary to popular belief the twelve stars do not represent countries. The number of stars has not and will not change. Twelve represents perfection, with cultural reference to the twelve apostles and tribes. The European Anthem is “Ode to Joy” from Beethovens 9th symphony. There are two common holidays May the 5th commemorates Churchill’s speech about a united Europe and May the 9th commemorates the French statesman, an one of the EU-founders, Robert Schuman. On the map: Economic & Monetary Union: In the fifteen countries that make up the EMU (Economic & Monetary Union) the national currency has been replaced by the euro. Members: Germany, France, the Netherlands, Luxembourg, Belgium, Spain, Portugal, Greece, Italy, Austria, Finland, Ireland, Slovenia, Malta and Cyprus. Euro symbol: Demonstration of correct usage: 1 euro € 1,00 21 eurocents € 0,21 Important facts: - On the EU: The interior borders have seized to exist (in the Schengen countries). The inhabitants have the right of free travel, and may work an settle in any EU-country. - On the EMU: The functions of the National Banks in the euro-zone have been taken over by the European Central Bank in Frankfurt. - Stamps with euro face-value can only be used in the country in which they have been published. - The European mini-states San Marino, Monaco and the Vatican have their own euro-coins, but have no influence on the monetary policy of the ECB.
    [Show full text]
  • Annual Programme 2021
    Annual Programme 2021 Annual Programme 2021 Previously known as the Official Sales Agency for Collector Coins (VfS) Münze Deutschland has been a service provider and contact partner for coin collectors since 1967. Our online shop allows you to order all available products conveniently and securely 24/7. Alternatively, you can place your order via the service hotline +49 (0)961 3814-4400 – or use the order form included in this brochure. You will find further information and our contact details on our website: www.muenze-deutschland.de LEGAL NOTICE Published by: Federal Office of Administration (BVA) Barbarastraße 1, 50735 Köln, Germany Sales: Münze Deutschland VAT registration number: DE811884176 Photo credit: S. 3: Staatliche Münzen Baden-Württemberg; S. 9: sutadimages/Shutterstock.de; S. 11: JohnKruger/Shutterstock.de; S. 12: Eight Photo/Shutterstock.de; S. 15: Denise Currin/Shutterstock.de As of: January 2021 – subject to change – Dear readers, This year’s coin programme not only offers impressing interpretations of important people and events, but also technical innovations. For the first time in the history of German numismatics, an official collector coin will be finished with the rare metal niobium: the 10 euro polymer ring coin “On Water”. Moreover, the 25 euro collector coin in fine silver on the birth of Jesus will be produced as a dome-shaped coin. This type of dome-shaped minting creates a concave side, enabling a deeper relief and thus a more expressive impression. This is also a first in the history of collector coins in the Federal Republic of Germany. The 2021 programme thus offers a very diverse range of coins.
    [Show full text]
  • Euro Coin Exchange
    EURO COIN EXCHANGE www.webuyeuros.com EXCHANGE YOUR EURO COINS FOR DOLLAR BILLS ************************************************************************************************ PACKING LIST See our FAQ’s page (www.webuyeuros.com/faqs.htm) for packing and shipping sug- gestions. Fill out this convenient packing list and mail it with your coins to Euro Coin Ex- change. We've even provided a Shipping Label for you to use at the bottom of this form. Name ______________________________________________________ Address ________________________________________________________ ________________________________________________________ City ________________________________________________________ State ________________ Payment Method (Select One) ZIP Code ________________ □ Check □ Paypal (email address required for Paypal payment) PROMO CODE: ______________ If we have trouble reading your handwriting or encounter a problem with your ship- ment, what is the quickest way to contact you? E-mail: ____________________________ Phone: ________________________ Terms and Conditions: 1. For each type of currency being exchanged, Euro Coin Exchange will apply the applicable rate posted on our web site as of 9:00 a.m. (Eastern time) on the day your coins are received in our office. In the event Euro Coin Exchange posts an exchange rate which is valid through a specific date (for example, as an advertised Special Promotion), that rate will be honored provided the postmark (or other proof of shipping date) is on or before the expiration date of the offer. 2. Euro Coin Exchange will only be responsible for currency after it is received by us. Risk of loss, for any reason, shall remain with the customer prior to delivery to us. 3. Euro Coin Exchange reserves the right (at its sole discretion) to return any currency to the customer and to charge the customer a reasonable fee to cover return Euro Coin Exchange: The Leading Buyer of Euro Coins (and pounds, too) in the USA postage.
    [Show full text]
  • New National Side of Euro Coins Intended for Circulation
    22.3.2021 EN Official Journal of the European Union C 96/7 New national side of euro coins intended for circulation (2021/C 96/07) National side of the new commemorative 2-euro coin intended for circulation and issued by Greece Euro coins intended for circulation have legal tender status throughout the euro area. For the purpose of informing the public and all parties who handle the coins, the Commission publishes a description of the designs of all new coins (1). In accordance with the Council conclusions of 10 February 2009 (2), euro-area Member States and countries that have concluded a monetary agreement with the European Union providing for the issuing of euro coins are allowed to issue commemorative euro coins intended for circulation, provided that certain conditions are met, particularly that only the 2-euro denomination is used. These coins have the same technical characteristics as other 2-euro coins, but their national face features a commemorative design that is highly symbolic in national or European terms. Issuing country: Greece Subject of commemoration: 200 years since the Greek Revolution Description of the design: The design features the Greek flag at the centre, encircled by laurel branches. Inscribed along the inner edge are the wordings ‘1821 – 2021 200 YEARS SINCE THE GREEK REVOLUTION’ and ‘HELLENIC REPUBLIC’. Visible, at the bottom, between two laurel branches, are a palmette (the minmark of the Greek Mint) and the signature of the artist (George Stamatopoulos). The coin’s outer ring depicts the 12 stars of the European flag. Estimated number of coins to be issued: 1 500 000 Date of issue: April 2021 (1) See OJ C 373, 28.12.2001, p.
    [Show full text]