OR1A2 (Human) Recombinant Protein

Total Page：16

File Type：pdf, Size：1020Kb

OR1A2 (Human) Recombinant Gene Symbol: OR1A2 Protein Gene Alias: MGC119930, MGC119931, OR17-6 Catalog Number: H00026189-G01 Gene Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal Regulation Status: For research use only (RUO) response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family Product Description: Human OR1A2 full-length ORF of G-protein-coupled receptors (GPCR) arising from (NP_036484.1) recombinant protein without tag. single coding-exon genes. Olfactory receptors share a Sequence: 7-transmembrane domain structure with many MKKENQSFNLDFILLGVTSQQEQNNVFFVIFLCIYPITLT neurotransmitter and hormone receptors and are GNLLIILAICADIRLHNPMYFLLANLSLVDIIFSSVTIPKVL responsible for the recognition and G protein-mediated ANHLLGSKFISFGGCLMQMYFMIALAKADSYTLAAMAY transduction of odorant signals. The olfactory receptor DRAVAISCPLHYTTIMSPRSCILLIAGSWVIGNTSALPHT gene family is the largest in the genome. The LLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFNVKM nomenclature assigned to the olfactory receptor genes MYLGVGVFSLPLLCIIVSYVQVFSTVFQVPSTKSLFKAF and proteins for this organism is independent of other CTCGSHLTVVFLYYGTTMGMYFRPLTSYSPKDAVITV organisms. [provided by RefSeq] MYVAVTPALNPFIYSLRNWDMKAALQKLFSKRISS Host: Wheat Germ (in vitro) Theoretical MW (kDa): 34.4 Applications: AP (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Preparation Method: in vitro wheat germ expression system with proprietary liposome technology Purification: None Recommend Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 26189 Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Database Tool the Systematic Annotation of the Three Main GPCR
Database, Vol. 2010, Article ID baq018, doi:10.1093/database/baq018 ............................................................................................................................................................................................................................................................................................. Database tool The systematic annotation of the three main Downloaded from https://academic.oup.com/database/article-abstract/doi/10.1093/database/baq018/406672 by guest on 15 January 2019 GPCR families in Reactome Bijay Jassal1, Steven Jupe1, Michael Caudy2, Ewan Birney1, Lincoln Stein2, Henning Hermjakob1 and Peter D’Eustachio3,* 1European Bioinformatics Institute, Hinxton, Cambridge, CB10 1SD, UK, 2Ontario Institute for Cancer Research, Toronto, ON M5G 0A3, Canada and 3New York University School of Medicine, New York, NY 10016, USA *Corresponding author: Tel: +212 263 5779; Fax: +212 263 8166; Email: [email protected] Submitted 14 April 2010; Revised 14 June 2010; Accepted 13 July 2010 ............................................................................................................................................................................................................................................................................................. Reactome is an open-source, freely available database of human biological pathways and processes. A major goal of our work is to provide an integrated view of cellular signalling processes that spans from ligand–receptor
[Show full text]
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
The Odorant Receptor OR2W3 on Airway Smooth Muscle Evokes Bronchodilation Via a Cooperative Chemosensory Tradeoff Between TMEM16A and CFTR
The odorant receptor OR2W3 on airway smooth muscle evokes bronchodilation via a cooperative chemosensory tradeoff between TMEM16A and CFTR Jessie Huanga,1,2, Hong Lama,1, Cynthia Koziol-Whiteb,c, Nathachit Limjunyawongd, Donghwa Kime, Nicholas Kimb, Nikhil Karmacharyac, Premraj Rajkumarf, Danielle Firera, Nicholas M. Dalesiog, Joseph Judec, Richard C. Kurtenh, Jennifer L. Pluznickf, Deepak A. Deshpandei, Raymond B. Penni, Stephen B. Liggette,j, Reynold A. Panettieri Jrc, Xinzhong Dongd,k, and Steven S. Anb,c,2 aDepartment of Environmental Health and Engineering, The Johns Hopkins University Bloomberg School of Public Health, Baltimore, MD 21205; bDepartment of Pharmacology, Rutgers-Robert Wood Johnson Medical School, The State University of New Jersey, Piscataway, NJ 08854; cRutgers Institute for Translational Medicine and Science, New Brunswick, NJ 08901; dSolomon H. Snyder Department of Neuroscience, The Johns Hopkins University School of Medicine, Baltimore, MD 21205; eCenter for Personalized Medicine, Morsani College of Medicine, University of South Florida, Tampa, FL 33612; fDepartment of Physiology, The Johns Hopkins University School of Medicine, Baltimore, MD 21205; gDepartment of Anesthesiology and Critical Care Medicine, The Johns Hopkins University School of Medicine, Baltimore, MD 21205; hDepartment of Physiology and Biophysics, University of Arkansas for Medical Sciences, Little Rock, AR 72205; iDivision of Pulmonary and Critical Care Medicine, Department of Medicine, Center for Translational Medicine, Jane and Leonard Korman
[Show full text]
Predicting Human Olfactory Perception from Activities of Odorant Receptors
iScience ll OPEN ACCESS Article Predicting Human Olfactory Perception from Activities of Odorant Receptors Joel Kowalewski, Anandasankar Ray [email protected] odor perception HIGHLIGHTS Machine learning predicted activity of 34 human ORs for ~0.5 million chemicals chemical structure Activities of human ORs predicts OR activity could predict odor character using machine learning Few OR activities were needed to optimize r predictions of each odor e t c percept a AI r a odorant activates mul- h Behavior predictions in c Drosophila also need few r tiple ORs o olfactory receptor d o activities ts ic ed pr ity tiv ac OR Kowalewski & Ray, iScience 23, 101361 August 21, 2020 ª 2020 The Author(s). https://doi.org/10.1016/ j.isci.2020.101361 iScience ll OPEN ACCESS Article Predicting Human Olfactory Perception from Activities of Odorant Receptors Joel Kowalewski1 and Anandasankar Ray1,2,3,* SUMMARY Odor perception in humans is initiated by activation of odorant receptors (ORs) in the nose. However, the ORs linked to speciﬁc olfactory percepts are unknown, unlike in vision or taste where receptors are linked to perception of different colors and tastes. The large family of ORs (~400) and multiple receptors activated by an odorant present serious challenges. Here, we ﬁrst use machine learning to screen ~0.5 million compounds for new ligands and identify enriched structural motifs for ligands of 34 human ORs. We next demonstrate that the activity of ORs successfully predicts many of the 146 different perceptual qualities of chem- icals. Although chemical features have been used to model odor percepts, we show that biologically relevant OR activity is often superior.
[Show full text]
Functional and Structural Characterization of Olfactory Receptors in Human Heart and Eye
DISSERTATION to obtain the degree Doctor Rerum Naturalium (Dr.rer.nat.) at the Faculty of Biology and Biotechnology International Graduate School Biosciences Ruhr-University Bochum Functional and structural characterization of olfactory receptors in human heart and eye Department of Cellphysiology submitted by Nikolina Jovancevic from Zadar, Croatia Bochum February 2016 First Referee: Prof. Dr. Dr. Dr. Hanns Hatt Second Referee: Prof. Dr. Stefan Wiese DISSERTATION zur Erlangung des Grades eines Doktors der Naturwissenschaften der Fakultät für Biologie und Biotechnologie an der Internationalen Graduiertenschule Biowissenschaften der Ruhr-Universität Bochum Funktionale und strukturelle Charakterisierung olfaktorischer Rezeptoren im humanen Herzen und Auge Lehrstuhl für Zellphysiologie vorgelegt von Nikolina Jovancevic aus Zadar, Kroatien Bochum Februar 2016 Referent: Prof. Dr. Dr. Dr. Hanns Hatt Korreferent: Prof. Dr. Stefan Wiese To my family TABLE OF CONTENTS TABEL OF CONTENT 1 INTRODUCTION 1 1.1 G protein-coupled receptors 1 1.1.1 General 1 1.1.2 Structure and classification 2 1.1.3 Olfactory Receptors 4 1.2 Function of olfactory receptors 9 1.2.1 The olfactory system 9 1.2.2 Ectopic expression of olfactory receptors 11 1.3 Excursus: Anatomy and physiology of the heart 13 1.3.1 Anatomy of the heart and blood circuit 14 1.3.2 The cardiac conduction system 15 1.3.3 Excitation-contraction coupling 16 1.3.4 Cardiac GPCRs: Modulation of cardiac contraction 17 1.4 Excursus: Anatomy and physiology of the eye 18 1.4.1 Anatomy of the retina 19
[Show full text]
Functional Variability in the Human Odorant Receptor Repertoire
ART ic LE s The missense of smell: functional variability in the human odorant receptor repertoire Joel D Mainland1–3, Andreas Keller4, Yun R Li2,6, Ting Zhou2, Casey Trimmer1, Lindsey L Snyder1, Andrew H Moberly1,3, Kaylin A Adipietro2, Wen Ling L Liu2, Hanyi Zhuang2,6, Senmiao Zhan2, Somin S Lee2,6, Abigail Lin2 & Hiroaki Matsunami2,5 Humans have ~400 intact odorant receptors, but each individual has a unique set of genetic variations that lead to variation in olfactory perception. We used a heterologous assay to determine how often genetic polymorphisms in odorant receptors alter receptor function. We identified agonists for 18 odorant receptors and found that 63% of the odorant receptors we examined had polymorphisms that altered in vitro function. On average, two individuals have functional differences at over 30% of their odorant receptor alleles. To show that these in vitro results are relevant to olfactory perception, we verified that variations in OR10G4 genotype explain over 15% of the observed variation in perceived intensity and over 10% of the observed variation in perceived valence for the high-affinity in vitro agonist guaiacol but do not explain phenotype variation for the lower-affinity agonists vanillin and ethyl vanillin. The human genome contains ~800 odorant receptor genes that have RESULTS been shown to exhibit high genetic variability1–3. In addition, humans High-throughput screening of human odorant receptors exhibit considerable variation in the perception of odorants4,5, and To identify agonists for a variety of odorant receptors, we cloned a variation in an odorant receptor predicts perception in four cases: library of 511 human odorant receptor genes for a high-throughput loss of function in OR11H7P, OR2J3, OR5A1 and OR7D4 leads to heterologous screen.
[Show full text]
Relationships Between Molecular Structure and Perceived Odor Quality of Ligands for a Human Olfactory Receptor
Chem. Senses 33: 639–653, 2008 doi:10.1093/chemse/bjn032 Advance Access publication July 5, 2008 Relationships Between Molecular Structure and Perceived Odor Quality of Ligands for a Human Olfactory Receptor 1 2 3 1 Guenhae¨ l Sanz , Thierry Thomas-Danguin , El Hassan Hamdani , Claire Le Poupon , Downloaded from https://academic.oup.com/chemse/article-abstract/33/7/639/331227 by Occidental College Library user on 23 September 2018 Loı¨c Briand2, Jean-Claude Pernollet1, Elisabeth Guichard2 and Anne Tromelin2 1Institut National de la Recherche Agronomique, Unite´ Minte de Recherche 1197 Neurobiologie de l’Olfaction et de la Prise Alimentaire, F-78352 Jouy-en-Josas, France and 2Institut National de la Recherche Agronomique, Unite´ Minte de Recherche 1129 Flaveur Vision et Comportement du Consommateur, F-21000 Dijon, France 3Present address: Biotechnology Centre of Oslo, University of Oslo, Norway Correspondence to be sent to: Guenhae¨ l Sanz, INRA, UMR 1197 Neurobiologie de l’Olfaction et de la Prise Alimentaire, Biochimie de l’Olfaction et de la Gustation, F-78352 Jouy-en-Josas. e-mail: [email protected] Abstract Perception of thousands of odors by a few hundreds of olfactory receptors (ORs) results from a combinatorial coding, in which one OR recognizes multiple odorants and an odorant is recognized by a speciﬁc group of ORs. Moreover, odorants could act both as agonists or antagonists depending on the OR. This dual agonist–antagonist combinatorial coding is in good agreement with behavioral and psychophysical observations of mixture perception. We previously described the odorant repertoire of a human OR, OR1G1, identifying both agonists and antagonists.
[Show full text]
1 Copper-Mediated Thiol Potentiation and Mutagenesis-Guided Modeling Suggest a Highly Conserved Copper Binding Motif in Human OR
Copper-mediated thiol potentiation and mutagenesis-guided modeling suggest a highly conserved copper binding motif in human OR2M3 Franziska Haag1, Lucky Ahmed2, Krystle Reiss2, Eric Block3, Victor S. Batista2 and Dietmar Krautwurst1 1Leibniz-Institute for Food Systems Biology at the Technical University of Munich, Lise-Meitner-Str. 34, D-85354 Freising, Germany 2Department of Chemistry, Yale University, New Haven, CT 06520, United States 3Department of Chemistry, University at Albany, State University of New York, Albany, NY 12222, United States Contents: Table S1: Oligonucleotides for molecular cloning of odorant receptors investigated. ........................... 2 Table S2: Oligonucleotides for Homo sapiens OR2M3 site-directed mutagenesis. ................................ 2 Table S3: Oligonucleotides for Homo sapiens OR2W1 site-directed mutagenesis. ................................ 4 Table S4: Vector internal oligonucleotides for pi2-dk (39aa rho-tag). .................................................... 4 Table S5: NCBI reference sequences of olfactory receptor genes investigated. ..................................... 5 Table S6: EC50 values and relative amplitudes for 3-mercapto-2-methylpentan-1-ol on OR2M3 wild type in the absence and presence of different heavy metals. ................................................................ 7 Table S7: EC50 values and relative amplitudes for OR2M3 wild type in the absence and presence of different concentrations of Cu2+. ...........................................................................................................
[Show full text]
The Hypothalamus As a Hub for SARS-Cov-2 Brain Infection and Pathogenesis
bioRxiv preprint doi: https://doi.org/10.1101/2020.06.08.139329; this version posted June 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. The hypothalamus as a hub for SARS-CoV-2 brain infection and pathogenesis Sreekala Nampoothiri1,2#, Florent Sauve1,2#, Gaëtan Ternier1,2ƒ, Daniela Fernandois1,2 ƒ, Caio Coelho1,2, Monica ImBernon1,2, Eleonora Deligia1,2, Romain PerBet1, Vincent Florent1,2,3, Marc Baroncini1,2, Florence Pasquier1,4, François Trottein5, Claude-Alain Maurage1,2, Virginie Mattot1,2‡, Paolo GiacoBini1,2‡, S. Rasika1,2‡*, Vincent Prevot1,2‡* 1 Univ. Lille, Inserm, CHU Lille, Lille Neuroscience & Cognition, DistAlz, UMR-S 1172, Lille, France 2 LaBoratorY of Development and PlasticitY of the Neuroendocrine Brain, FHU 1000 daYs for health, EGID, School of Medicine, Lille, France 3 Nutrition, Arras General Hospital, Arras, France 4 Centre mémoire ressources et recherche, CHU Lille, LiCEND, Lille, France 5 Univ. Lille, CNRS, INSERM, CHU Lille, Institut Pasteur de Lille, U1019 - UMR 8204 - CIIL - Center for Infection and ImmunitY of Lille (CIIL), Lille, France. # and ƒ These authors contriButed equallY to this work. ‡ These authors directed this work *Correspondence to: [email protected] and [email protected] Short title: Covid-19: the hypothalamic hypothesis 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.06.08.139329; this version posted June 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
[Show full text]
Structural Feature Analysis of Human Olfactory Receptors Based on The
Structural Feature Analysis of Human Olfactory Receptors KP-28 Based on the Triplet Pattern Chisato MORISHITA*, Hiroaki KATO Department of Knowledge-based Information Engineering, Toyohashi University of Technology, 1-1 Hibarigaoka, Tempaku-cho, Toyohashi, Aichi 441-8580 Japan 1 Introduction The odorant receptors (ORs) belong to the family of seven transmembrane G-protein coupled receptors (GPCRs) and constitute the largest family (family A) in the genome [1]. Many ORs are orphan receptors, i.e. whose endogenous ligand has not yet been identified, and their structures have not been experimentally determined. It is well known that the particular peptide fragments in a protein are closely related to its function, but it is not necessarily to appear in consecutive region in an amino acid sequence. In the present work, the authors have proposed a novel representation of protein structural feature based on the combination of the local pattern of amino acid sequence, and applied to the structural feature analysis of human ORs. 2. Method 2.1 Dataset In the present work, the authors have referred the database of 907 GPCRs in human genome [2]. It contains 377 ORs with sixteen different OR families. The FASTA format files are used for protein sequence data. 2.2 Definition of the triplet pattern of a protein sequence To describe the characteristic pattern of an amino acid sequence, we have defined triplet as a group of three amino acid residues which hold the context in a sequence. There are 400 (= 20*20) triplets for a glycine (G) residue, such as G-G-G, A-G-G, G-G-A, A-G-A, etc.
[Show full text]
Identification of Agonists for a Group of Human Odorant Receptors
ORIGINAL RESEARCH ARTICLE published: 03 March 2015 doi: 10.3389/fphar.2015.00035 Identification of agonists for a group of human odorant receptors Daniela C. Gonzalez-Kristeller 1,JoãoB.P.doNascimento1, Pedro A. F. Galante 2 and Bettina Malnic 1* 1 Department of Biochemistry, Institute of Chemistry, University of São Paulo, São Paulo, Brazil 2 Centro de Oncologia Molecular, Hospital Sírio-Libanês, São Paulo, Brazil Edited by: Olfaction plays a critical role in several aspects of the human life. Odorants are detected by Claudio M. Costa-Neto, University hundreds of odorant receptors (ORs) which belong to the superfamily of G protein-coupled of Sao Paulo, Brazil receptors. These receptors are expressed in the olfactory sensory neurons of the nose. Reviewed by: The information provided by the activation of different combinations of ORs in the nose Federico Monczor, Universidad de Buenos Aires, Argentina is transmitted to the brain, leading to odorant perception and emotional and behavioral Dietmar Krautwurst, Deutsche responses. There are ∼400 intact human ORs, and to date only a small percentage of Forschungsanstalt fuer these receptors (∼10%) have known agonists. The determination of the specificity of the Lebensmittelchemie Leibniz Institut, human ORs will contribute to a better understanding of how odorants are discriminated Germany by the olfactory system. In this work, we aimed to identify human specific ORs, that is, *Correspondence: Bettina Malnic, Department of ORs that are present in humans but absent from other species, and their corresponding Biochemistry, University of São agonists. To do this, we first selected 22 OR gene sequences from the human genome Paulo, Av.
[Show full text]
An Evolutionary Medicine Perspective on Neandertal Extinction
Supplementary Information (Figures and Tables) for: An evolutionary medicine perspective on Neandertal extinction Alexis P. Sullivan1, Marc de Manuel3, Tomas Marques-Bonet3,4,5, & George H. Perry1,2 Departments of 1Biology and 2Anthropology, Pennsylvania State University, University Park, PA 16802, USA 3Institut de Biologia Evolutiva (CSIC/UPF), Parque de Investigación Biomédica de Barcelona (PRBB), Barcelona, Catalonia 08003, Spain 4CNAG-CRG, Centre for Genomic Regulation (CRG), Barcelona Institute of Science and Technology (BIST), Baldiri i Reixac 4, 08028 Barcelona, Spain 5Catalan Institution of Research and Advanced Studies (ICREA), Passeig de Lluís Companys, 23, 08010, Barcelona, Spain Corresponding Author: George H. Perry E-mail: [email protected] Supplemental Figure 1: Innate immune system gene permutation analyses – 10,000 sets of 73 randomly selected genes containing nonsynonymous SNPs Supplemental Figure 2: Virus-interacting protein gene permutation analyses – 10,000 sets of 164 randomly selected genes containing nonsynonymous SNPs Supplemental Figure 3: MHC gene permutation analyses – 10,000 sets of 13 randomly selected genes containing nonsynonymous SNPs Supplemental Figure 4: Patterns of Neandertal and modern human nonsynonymous SNP diversity in MHC genes (n = 13) excluding the Altai Neandertal and one random modern human per population Supplemental Figure 5: Significantly enriched gene ontology categories (red) among top 1% ape diversity genes Supplemental Table 1: A comparison of genome-wide nonsynonymous SNPs versus total (nonsynonymous
[Show full text]