DOCSLIB.ORG

Prevalence and Significance of Nonsense-‐Mediated Mrna Decay

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Prevalence and Significance of Nonsense-‐Mediated Mrna Decay Prevalence and Significance of Nonsense-Mediated mRNA Decay Coupled with Alternative Splicing in Diverse Eukaryotic Organisms By Courtney Elizabeth French A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Molecular and Cell Biology in the Graduate Division of the University of California, Berkeley Committee in charge: Professor Steven E. Brenner, Co-Chair Professor Donald C. Rio, Co-Chair Professor Britt A. Glaunsinger Professor Sandrine Dudoit Spring 2016 Prevalence and Significance of Nonsense-Mediated mRNA Decay Coupled with Alternative Splicing in Diverse Eukaryotic Organisms Copyright 2016 by Courtney Elizabeth French Abstract Prevalence and Significance of Nonsense-Mediated mRNA Decay Coupled with Alternative Splicing in Diverse Eukaryotic Organisms by Courtney Elizabeth French Doctor of Philosophy in Molecular and Cell Biology University of California, Berkeley Professor Steven E. Brenner, Co-Chair Professor Donald C. Rio, Co-Chair Alternative splicing plays a crucial role in increasing the amount of protein diversity and in regulating gene expression at the post-transcriptional level. In humans, almost all genes produce more than one mRNA isoform and, while the fraction varies, many other species also have a substantial number of alternatively spliced genes. Alternative splicing is regulated by splicing factors, often in a developmental time- or tissue-specific manner. Mis- regulation of alternative splicing, via mutations in splice sites, splicing regulatory elements, or splicing factors, can lead to disease states, including cancers. Thus, characterizing how alternative splicing shapes the transcriptome will lead to greater insights into the regulation of numerous cellular pathways and many aspects of human health. A critical tool for investigating alternative splicing is high-throughput mRNA sequencing (RNA-seq). This technology produces hundreds of millions of short (~100bp) sequencing reads from mRNA molecules and can be used to both discover novel transcripts and to quantify the expression of transcripts. While short read length is a limitation of the technology in its current form, RNA-seq has resulted in the discovery of hundreds of thousands of new transcripts and revealed an increased complexity of the transcriptome via alternative splicing, particularly in human. Here, I used RNA-seq analysis to investigate the global effect of post-transcriptional regulation via alternative splicing coupled to nonsense-mediated mRNA decay and to examine natural human variation in alternative splicing, particularly in genes associated with differential therapeutic drug response. The nonsense-mediated mRNA decay pathway (NMD), which degrades transcripts containing a premature termination codon, plays an important role in post-transcriptional gene regulation when coupled to alternative splicing. If a gene produces an alternative isoform that is targeted by NMD, the mRNA abundance of the protein-producing transcripts can be post-transcriptionally regulated at the alternative splicing level. This has been shown to be important in the regulation of a number of genes, including many of the splicing factors themselves. I have used RNA-seq analysis on cells where NMD has been 1 inhibited to discover alternative isoforms that are NMD targets on a genome-wide scale in human and a number of diverse other eukaryotic species. I found that around 20% of expressed human genes are potentially regulated by alternative splicing coupled to NMD and that they fall into many different functional categories. I also found that hundreds to thousands of genes produce NMD-targeted alternative isoforms in each of frog, zebrafish, fly, fission yeast, and plant, highlighting the prevalence of this relatively under-studied method of gene regulation across the three major branches of eukaryotic organisms. I also gained insight into the features that define NMD targets, which are thought to vary between species although the field is still unclear. I find that an exon-exon junction downstream of the termination codon is a much stronger predictor of NMD than 3’ UTR length in every species except yeast. I also used RNA-seq to investigate alternative splicing in genes of pharmacologic importance. Natural human variation in the expression level and activity of genes involved in drug disposition and action (“pharmacogenes”) can affect drug response and toxicity. Previous studies have relied primarily on microarrays to understand gene expression differences, or have focused on a single tissue or small number of samples. Here, we used RNA-seq to determine the expression levels and alternative splicing of 389 selected pharmacogenes across four pharmacologically relevant tissues (liver, kidney, heart and adipose) and lymphoblastoid cell lines (LCLs), which are used widely in pharmacogenomics studies. Analysis of data from 18 different individuals for each of the 5 tissues (90 samples in total) revealed substantial variation in both expression levels and splicing across samples and tissue types. Comparison with an independent RNA-seq dataset yielded a consistent picture. This in-depth exploration also revealed 183 splicing events in pharmacogenes that were previously not annotated. Overall, this study serves as a rich resource for the research community to inform biomarker and drug discovery and use.* In conclusion, the roles of alternative splicing and NMD in the regulation of cellular processes and in human health are wide-open but critical fields of study. Advancements in sequencing technologies have had and will continue to have a huge impact on the studies of these mechanisms. New long-read technologies will likely soon be readily available and promise to greatly increase our ability to accurately interpret RNA-seq results. As the cost of sequencing continues to decrease, more and more data will be generated, allowing for a better view of how the transcriptome varies between individuals and shapes differential disease risks and drug responses. * This paragraph was co-written with Aparna Chhibber and Sook Wah Yee and modified from a previously published work: Chhibber A*, French CE*, Yee SW*, Gamazon ER*, et al. 2016. Transcriptomic variation of pharmacogenes in multiple human tissues and lymphoblastoid cell lines. Pharmacogenomics Journal. *co-first authors 2 Table of Contents CHAPTER 1 USING RNA-SEQ ANALYSIS FOR ISOFORM EXPRESSION AND ALTERNATIVE SPLICING INVESTIGATIONS ................................................................................. 1 ABSTRACT ................................................................................................................................................................... 1 INTRODUCTION TO RNA-SEQ .................................................................................................................................. 1 READ ALIGNMENT ...................................................................................................................................................... 2 ASSEMBLY OF NOVEL TRANSCRIPTS ........................................................................................................................ 2 QUANTIFYING TRANSCRIPT EXPRESSION ................................................................................................................ 3 USING A REFERENCE GENE ANNOTATION ............................................................................................................... 6 IMPACT OF READ DEPTH ........................................................................................................................................... 7 READ DEPTH VERSUS NUMBER OF SAMPLES .......................................................................................................... 9 CONCLUSIONS .......................................................................................................................................................... 11 REFERENCES ........................................................................................................................................................... 12 CHAPTER 2 TRANSCRIPTOME ANALYSIS OF ALTERNATIVE SPLICING COUPLED WITH NONSENSE MEDIATED MRNA DECAY IN HUMAN CELLS ....................................................... 15 ABSTRACT ................................................................................................................................................................ 15 INTRODUCTION ....................................................................................................................................................... 15 RESULTS ................................................................................................................................................................... 17 Over two thousand genes produce transcripts identified as confident NMD targets .......... 17 Diverse categories of genes are affected by NMD, particularly splicing .................................... 21 NMD-targeted genes are enriched for ultraconserved elements .................................................. 25 The 50nt Rule is a strong predictor of NMD while a longer 3’ UTR has little effect ............. 25 Premature termination codons generated by alternative splicing events or uORFS ........... 27 DISCUSSION ............................................................................................................................................................. 28 MATERIALS AND METHODS .................................................................................................................................
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Die Inhibin/Aktivin Expression in Gynäkologischen Krebszellen Und Selektive Expression Der Inhibin Beta E Untereinheit Unter ER-Stressinduktion
    Aus der Klinik und Poliklinik für Frauenheilkunde und Geburtshilfe - Innenstadt der Ludwig-Maximilians-Universität München Direktor: Prof. Dr. med. Klaus Friese Die Inhibin/Aktivin Expression in gynäkologischen Krebszellen und selektive Expression der Inhibin beta E Untereinheit unter ER-Stressinduktion Dissertation zum Erwerb des Doktorgrades der Medizin an der Medizinischen Fakultät der Ludwig-Maximilians-Universität zu München vorgelegt von Christina Matsingou aus Thessaloniki 2013 Mit Genehmigung der Medizinischen Fakultät der Universität München Berichterstatter: Prof. Dr. med. Ioannis Mylonas Mitberichterstatter: Prof. Dr. Werner Meier Prof. Dr. Doris Mayr Mitbetreuung durch den promovierten Mitarbeiter: Dr. rer. nat. Ansgar Brüning Dekan: Prof. Dr. med. Dr. h.c. M. Reiser, FACR, FRCR Tag der mündlichen Prüfung: 12.12.2013 II Meinen Eltern in Dankbarkeit gewidmet. Ὁ μὲν βίος βραχύς, ἡ δὲ τέχνη μακρή, ὁ δὲ καιρὸς ὀξύς, ἡ δὲ πεῖρα σφαλερή, ἡ δὲ κρίσις χαλεπή. Ιπποκράτης ο Κώος (460–377 π. Χ.) Das Leben ist kurz, die Kunst ist lang, die Gelegenheit flüchtig, die Erfahrung trüge- risch, das Urteil schwierig. Hippokrates von Kos (um 460–377 v. Chr.) III Inhaltsverzeichnis Abkürzungsverzeichnis .................................................................................. 1 1 Zusammenfassung .................................................................................... 4 2 Einleitung ................................................................................................. 6 2.1 Nelfinavir und weitere Proteaseinhibitoren
    [Show full text]
  • Mygene.Info R Client
    MyGene.info R Client Adam Mark, Ryan Thompson, Chunlei Wu May 19, 2021 Contents 1 Overview ..............................2 2 Gene Annotation Service ...................2 2.1 getGene .............................2 2.2 getGenes ............................2 3 Gene Query Service ......................3 3.1 query ..............................3 3.2 queryMany ...........................4 4 makeTxDbFromMyGene....................5 5 Tutorial, ID mapping .......................6 5.1 Mapping gene symbols to Entrez gene ids ........6 5.2 Mapping gene symbols to Ensembl gene ids .......7 5.3 When an input has no matching gene ...........8 5.4 When input ids are not just symbols ............8 5.5 When an input id has multiple matching genes ......9 5.6 Can I convert a very large list of ids?............ 11 6 References ............................. 11 MyGene.info R Client 1 Overview MyGene.Info provides simple-to-use REST web services to query/retrieve gene annotation data. It’s designed with simplicity and performance emphasized. mygene is an easy-to-use R wrapper to access MyGene.Info services. 2 Gene Annotation Service 2.1 getGene • Use getGene, the wrapper for GET query of "/gene/<geneid>" service, to return the gene object for the given geneid. > gene <- getGene("1017", fields="all") > length(gene) [1] 1 > gene["name"] [[1]] NULL > gene["taxid"] [[1]] NULL > gene["uniprot"] [[1]] NULL > gene["refseq"] [[1]] NULL 2.2 getGenes • Use getGenes, the wrapper for POST query of "/gene" service, to return the list of gene objects for the given character vector of geneids. > getGenes(c("1017","1018","ENSG00000148795")) DataFrame with 3 rows and 7 columns 2 MyGene.info R Client query _id X_version entrezgene name <character> <character> <integer> <character> <character> 1 1017 1017 4 1017 cyclin dependent kin.
    [Show full text]
  • Arginine-Enriched Mixed-Charge Domains Provide Cohesion for Nuclear Speckle Condensation
    bioRxiv preprint doi: https://doi.org/10.1101/771592; this version posted September 16, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Arginine-enriched mixed-charge domains provide cohesion for nuclear 2 speckle condensation 3 4 Jamie A. Greig1, Tu Anh Nguyen1, Michelle Lee1, Alex S. Holehouse2, Ammon E. 5 Posey2, Rohit V. Pappu2, and Gregory JeDD1* 6 7 1Temasek Life Sciences Laboratory & Department of Biological Sciences, The 8 National University of Singapore, Singapore 117604 9 2Department of BiomeDical Engineering anD Center for Science & Engineering of 10 Living Systems (CSELS), Washington University in St. Louis, St. Louis, MO 63130, 11 USA 12 13 *CorresponDence: [email protected] 14 15 Abstract 16 Low-complexity protein Domains promote the formation of various biomolecular 17 conDensates. However, in many cases, the precise sequence features governing 18 conDensate formation anD iDentity remain unclear. Here, we investigate the role of 19 intrinsically DisordereD mixeD-charge Domains (MCDs) in nuclear speckle 20 conDensation. Proteins composeD exclusively of arginine/aspartic-aciD DipeptiDe 21 repeats unDergo length-DepenDent conDensation anD speckle incorporation. 22 Substituting arginine with lysine in synthetic anD natural speckle-associateD MCDs 23 abolishes these activities, iDentifying a key role for multivalent contacts through 24 arginine’s guaniDinium ion. MCDs can synergise with a speckle-associateD RNA 25 recognition motif to promote speckle specificity anD resiDence. MCD behaviour is 26 tuneable through net-charge: increasing negative charge abolishes conDensation anD 27 speckle incorporation.
    [Show full text]
  • RNA Splicing Regulated by RBFOX1 Is Essential for Cardiac Function in Zebrafish Karen S
    © 2015. Published by The Company of Biologists Ltd | Journal of Cell Science (2015) 128, 3030-3040 doi:10.1242/jcs.166850 RESEARCH ARTICLE RNA splicing regulated by RBFOX1 is essential for cardiac function in zebrafish Karen S. Frese1,2,*, Benjamin Meder1,2,*, Andreas Keller3,4, Steffen Just5, Jan Haas1,2, Britta Vogel1,2, Simon Fischer1,2, Christina Backes4, Mark Matzas6, Doreen Köhler1, Vladimir Benes7, Hugo A. Katus1,2 and Wolfgang Rottbauer5,‡ ABSTRACT U2, U4, U5 and U6) and several hundred associated regulator Alternative splicing is one of the major mechanisms through which proteins (Wahl et al., 2009). Some of the best-characterized the proteomic and functional diversity of eukaryotes is achieved. splicing regulators include the serine-arginine (SR)-rich family, However, the complex nature of the splicing machinery, its associated heterogeneous nuclear ribonucleoproteins (hnRNPs) proteins, and splicing regulators and the functional implications of alternatively the Nova1 and Nova2, and the PTB and nPTB (also known as spliced transcripts are only poorly understood. Here, we investigated PTBP1 and PTBP2) families (David and Manley, 2008; Gabut et al., the functional role of the splicing regulator rbfox1 in vivo using the 2008; Li et al., 2007; Matlin et al., 2005). The diversity in splicing is zebrafish as a model system. We found that loss of rbfox1 led to further increased by the location and nucleotide sequence of pre- progressive cardiac contractile dysfunction and heart failure. By using mRNA enhancer and silencer motifs that either promote or inhibit deep-transcriptome sequencing and quantitative real-time PCR, we splicing by the different regulators. Adding to this complexity, show that depletion of rbfox1 in zebrafish results in an altered isoform regulating motifs are very common throughout the genome, but are expression of several crucial target genes, such as actn3a and hug.
    [Show full text]
  • Identification of Genetic Factors Underpinning Phenotypic Heterogeneity in Huntington’S Disease and Other Neurodegenerative Disorders
    Identification of genetic factors underpinning phenotypic heterogeneity in Huntington’s disease and other neurodegenerative disorders. By Dr Davina J Hensman Moss A thesis submitted to University College London for the degree of Doctor of Philosophy Department of Neurodegenerative Disease Institute of Neurology University College London (UCL) 2020 1 I, Davina Hensman Moss confirm that the work presented in this thesis is my own. Where information has been derived from other sources, I confirm that this has been indicated in the thesis. Collaborative work is also indicated in this thesis. Signature: Date: 2 Abstract Neurodegenerative diseases including Huntington’s disease (HD), the spinocerebellar ataxias and C9orf72 associated Amyotrophic Lateral Sclerosis / Frontotemporal dementia (ALS/FTD) do not present and progress in the same way in all patients. Instead there is phenotypic variability in age at onset, progression and symptoms. Understanding this variability is not only clinically valuable, but identification of the genetic factors underpinning this variability has the potential to highlight genes and pathways which may be amenable to therapeutic manipulation, hence help find drugs for these devastating and currently incurable diseases. Identification of genetic modifiers of neurodegenerative diseases is the overarching aim of this thesis. To identify genetic variants which modify disease progression it is first necessary to have a detailed characterization of the disease and its trajectory over time. In this thesis clinical data from the TRACK-HD studies, for which I collected data as a clinical fellow, was used to study disease progression over time in HD, and give subjects a progression score for subsequent analysis. In this thesis I show blood transcriptomic signatures of HD status and stage which parallel HD brain and overlap with Alzheimer’s disease brain.
    [Show full text]
  • Mygene.Info R Client
    MyGene.info R Client Adam Mark, Ryan Thompson, Chunlei Wu May 19, 2021 Contents 1 Overview ..............................2 2 Gene Annotation Service ...................2 2.1 getGene .............................2 2.2 getGenes ............................2 3 Gene Query Service ......................3 3.1 query ..............................3 3.2 queryMany ...........................4 4 makeTxDbFromMyGene....................5 5 Tutorial, ID mapping .......................6 5.1 Mapping gene symbols to Entrez gene ids ........6 5.2 Mapping gene symbols to Ensembl gene ids .......7 5.3 When an input has no matching gene ...........8 5.4 When input ids are not just symbols ............8 5.5 When an input id has multiple matching genes ......9 5.6 Can I convert a very large list of ids?............ 11 6 References ............................. 11 MyGene.info R Client 1 Overview MyGene.Info provides simple-to-use REST web services to query/retrieve gene annotation data. It’s designed with simplicity and performance emphasized. mygene is an easy-to-use R wrapper to access MyGene.Info services. 2 Gene Annotation Service 2.1 getGene • Use getGene, the wrapper for GET query of "/gene/<geneid>" service, to return the gene object for the given geneid. > gene <- getGene("1017", fields="all") > length(gene) [1] 1 > gene["name"] [[1]] NULL > gene["taxid"] [[1]] NULL > gene["uniprot"] [[1]] NULL > gene["refseq"] [[1]] NULL 2.2 getGenes • Use getGenes, the wrapper for POST query of "/gene" service, to return the list of gene objects for the given character vector of geneids. > getGenes(c("1017","1018","ENSG00000148795")) DataFrame with 3 rows and 7 columns 2 MyGene.info R Client query _id X_version entrezgene name <character> <character> <integer> <character> <character> 1 1017 1017 4 1017 cyclin dependent kin.
    [Show full text]
  • Inhibition of the MID1 Protein Complex
    Matthes et al. Cell Death Discovery (2018) 4:4 DOI 10.1038/s41420-017-0003-8 Cell Death Discovery ARTICLE Open Access Inhibition of the MID1 protein complex: a novel approach targeting APP protein synthesis Frank Matthes1,MoritzM.Hettich1, Judith Schilling1, Diana Flores-Dominguez1, Nelli Blank1, Thomas Wiglenda2, Alexander Buntru2,HannaWolf1, Stephanie Weber1,InaVorberg 1, Alina Dagane2, Gunnar Dittmar2,3,ErichWanker2, Dan Ehninger1 and Sybille Krauss1 Abstract Alzheimer’s disease (AD) is characterized by two neuropathological hallmarks: senile plaques, which are composed of amyloid-β (Aβ) peptides, and neurofibrillary tangles, which are composed of hyperphosphorylated tau protein. Aβ peptides are derived from sequential proteolytic cleavage of the amyloid precursor protein (APP). In this study, we identified a so far unknown mode of regulation of APP protein synthesis involving the MID1 protein complex: MID1 binds to and regulates the translation of APP mRNA. The underlying mode of action of MID1 involves the mTOR pathway. Thus, inhibition of the MID1 complex reduces the APP protein level in cultures of primary neurons. Based on this, we used one compound that we discovered previously to interfere with the MID1 complex, metformin, for in vivo experiments. Indeed, long-term treatment with metformin decreased APP protein expression levels and consequently Aβ in an AD mouse model. Importantly, we have initiated the metformin treatment late in life, at a time-point where mice were in an already progressed state of the disease, and could observe an improved behavioral phenotype. These 1234567890 1234567890 findings together with our previous observation, showing that inhibition of the MID1 complex by metformin also decreases tau phosphorylation, make the MID1 complex a particularly interesting drug target for treating AD.
    [Show full text]
  • Bioinformatics Tools for the Analysis of Gene-Phenotype Relationships Coupled with a Next Generation Chip-Sequencing Data Processing Pipeline
    Bioinformatics Tools for the Analysis of Gene-Phenotype Relationships Coupled with a Next Generation ChIP-Sequencing Data Processing Pipeline Erinija Pranckeviciene Thesis submitted to the Faculty of Graduate and Postdoctoral Studies in partial fulfillment of the requirements for the Doctorate in Philosophy degree in Cellular and Molecular Medicine Department of Cellular and Molecular Medicine Faculty of Medicine University of Ottawa c Erinija Pranckeviciene, Ottawa, Canada, 2015 Abstract The rapidly advancing high-throughput and next generation sequencing technologies facilitate deeper insights into the molecular mechanisms underlying the expression of phenotypes in living organisms. Experimental data and scientific publications following this technological advance- ment have rapidly accumulated in public databases. Meaningful analysis of currently avail- able data in genomic databases requires sophisticated computational tools and algorithms, and presents considerable challenges to molecular biologists without specialized training in bioinfor- matics. To study their phenotype of interest molecular biologists must prioritize large lists of poorly characterized genes generated in high-throughput experiments. To date, prioritization tools have primarily been designed to work with phenotypes of human diseases as defined by the genes known to be associated with those diseases. There is therefore a need for more prioritiza- tion tools for phenotypes which are not related with diseases generally or diseases with which no genes have yet been associated in particular. Chromatin immunoprecipitation followed by next generation sequencing (ChIP-Seq) is a method of choice to study the gene regulation processes responsible for the expression of cellular phenotypes. Among publicly available computational pipelines for the processing of ChIP-Seq data, there is a lack of tools for the downstream analysis of composite motifs and preferred binding distances of the DNA binding proteins.
    [Show full text]
  • Transcriptome-Wide Association Study of Attention Deficit Hyperactivity Disorder Identifies Associated Genes and Phenotypes
    bioRxiv preprint doi: https://doi.org/10.1101/642231; this version posted May 24, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Transcriptome-wide association study of attention deficit hyperactivity disorder identifies associated genes and phenotypes Calwing Liao1,2, Alexandre D. Laporte2, Dan Spiegelman2, Fulya Akçimen1,2, Ridha Joober3, Patrick A. Dion2,4, Guy A. Rouleau1,2,4 1Department of Human Genetics, McGill University, Montréal, Quebec, Canada 2Montreal Neurological Institute, McGill University, Montréal, Quebec, Canada 3Department of Psychiatry, McGill University, Montréal, Quebec, Canada 4Department of Neurology and Neurosurgery, McGill University, Montréal, Quebec, Canada Word count: 2,619 excluding abstract and references Figures: 2 Tables: 3 Keywords: ADHD, transcriptome-wide association study, KAT2B, TMEM161B, amygdala, prefrontal cortex *Correspondence: Dr. Guy A. Rouleau Montreal Neurological Institute and Hospital Department of Neurology and Neurosurgery 3801 University Street, Montreal, QC Canada H3A 2B4. Tel: +1 514 398 2690 Fax: +1 514 398 8248 E-mail: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/642231; this version posted May 24, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract Attention deficit/hyperactivity disorder (ADHD) is one of the most common neurodevelopmental psychiatric disorders.
    [Show full text]
  • Anti-LUC7L3 (Aa 1-110) Polyclonal Antibody (DPAB-DC2207) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Anti-LUC7L3 (aa 1-110) polyclonal antibody (DPAB-DC2207) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description This gene encodes a protein with an N-terminal half that contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This protein localizes with a speckled pattern in the nucleus, and could be involved in the formation of splicesome via the RE and RS domains. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. Immunogen CROP (NP_006098, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. The sequence is MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHD ENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALS Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Cell lysate), WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name LUC7L3 LUC7-like 3 (S. cerevisiae) [ Homo sapiens (human) ] Official Symbol LUC7L3 Synonyms LUC7L3; LUC7-like 3 (S. cerevisiae); CRA; CROP; LUC7A; hLuc7A; CREAP-1; OA48-18; luc7- like protein 3; CRE-associated protein 1; cAMP regulatory element-associated protein 1; okadaic 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221
    [Show full text]
  • Multi-Cancer Molecular Signatures and Their Interrelationships
    Multi-cancer molecular signatures and their interrelationships Wei-Yi Cheng1, Tai-Hsien Ou Yang1, Hui Shen2, Peter W. Laird2, Dimitris Anastassiou1 and the Cancer Genome Atlas Research Network 1Columbia Initiative in Systems Biology and Department of Electrical Engineering, Columbia University, New York, NY, USA 2USC Epigenome Center, Norris Comprehensive Cancer Center, Keck School of Medicine, University of Southern California, Los Angeles, CA, USA. Corresponding Author Dimitris Anastassiou, Columbia Initiative in Systems Biology and Department of Electrical Engineering, Columbia University, 1312S.W.Mudd Building, – Mail Code 4712, 500 West 120th Street, USA. Phone:+1212854-3113; E-mail: [email protected] This is version 2. A previous version of the same article appears at http://arxiv.org/pdf/1306.2584v1.pdf dated June 11, 2013. Please note: The pan-cancer molecular signatures disclosed in this article are the results of applying our data mining algorithm to the rich TCGA “pancan12” data sets from twelve different cancer types. These signatures have been identified as patterns, without any indication about their arXiv:1306.2584v2 [q-bio.QM] 11 Jul 2013 role or potential usefulness. We believe that each of them represents an important biomolecular event in cancer. We invite the cancer research community to contact us and help us interpret each of these pan-cancer signatures, and to investigate them for potential applications in diagnostic, prognostic and therapeutic products applicable to multiple cancer types. There will be additional versions of this article and we expect that the final version will contain many co-authors. 1 Although cancer is known to be characterized by several unifying biological hallmarks, systems biology has had limited success in identifying molecular signatures present in in all types of cancer.
    [Show full text]