RAB13 Antibody (R32126)

Total Page：16

File Type：pdf, Size：1020Kb

RAB13 Antibody (R32126) Catalog No. Formulation Size R32126 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug Bulk quote request Availability 1-3 business days Species Reactivity Human, Mouse, Rat Format Antigen affinity purified Clonality Polyclonal (rabbit origin) Isotype Rabbit IgG Purity Antigen affinity Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide UniProt P51153 Localization Cytoplasmic, membrane Applications Western blot : 0.1-0.5ug/ml IHC (FFPE) : 0.5-1ug/ml Limitations This RAB13 antibody is available for research use only. Western blot testing of 1) rat kidney, 2) human HeLa and 3) HepG2 lysate with RAB13 antibody. Expected molecular weight: ~23 kDa; an uncharacterized ~45 kDa band may also be observed. IHC testing of FFPE mouse intestine with RAB13 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining. IHC testing of FFPE rat intestine with RAB13 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining. Description Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene. This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12. Application Notes Optimal dilution of the RAB13 antibody should be determined by the researcher. Immunogen Amino acids NKCDMEAKRKVQKEQADKLAREHGIRFFET of human RAB13 were used as the immunogen for the RAB13 antibody. Storage After reconstitution, the RAB13 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. Ordering: Phone:858.663.9055 | Fax:1.267.821.0800 | Email:[email protected] Copyright © NSJ Bioreagents. All rights reserved.

Copy Link

Recommended publications

Mai Muudatuntuu Ti on Man Mini
MAIMUUDATUNTUU US009809854B2 TI ON MAN MINI (12 ) United States Patent ( 10 ) Patent No. : US 9 ,809 ,854 B2 Crow et al. (45 ) Date of Patent : Nov . 7 , 2017 Whitehead et al. (2005 ) Variation in tissue - specific gene expression ( 54 ) BIOMARKERS FOR DISEASE ACTIVITY among natural populations. Genome Biology, 6 :R13 . * AND CLINICAL MANIFESTATIONS Villanueva et al. ( 2011 ) Netting Neutrophils Induce Endothelial SYSTEMIC LUPUS ERYTHEMATOSUS Damage , Infiltrate Tissues, and Expose Immunostimulatory Mol ecules in Systemic Lupus Erythematosus . The Journal of Immunol @(71 ) Applicant: NEW YORK SOCIETY FOR THE ogy , 187 : 538 - 552 . * RUPTURED AND CRIPPLED Bijl et al. (2001 ) Fas expression on peripheral blood lymphocytes in MAINTAINING THE HOSPITAL , systemic lupus erythematosus ( SLE ) : relation to lymphocyte acti vation and disease activity . Lupus, 10 :866 - 872 . * New York , NY (US ) Crow et al . (2003 ) Microarray analysis of gene expression in lupus. Arthritis Research and Therapy , 5 :279 - 287 . * @(72 ) Inventors : Mary K . Crow , New York , NY (US ) ; Baechler et al . ( 2003 ) Interferon - inducible gene expression signa Mikhail Olferiev , Mount Kisco , NY ture in peripheral blood cells of patients with severe lupus . PNAS , (US ) 100 ( 5 ) : 2610 - 2615. * GeneCards database entry for IFIT3 ( obtained from < http : / /www . ( 73 ) Assignee : NEW YORK SOCIETY FOR THE genecards. org /cgi - bin / carddisp .pl ? gene = IFIT3 > on May 26 , 2016 , RUPTURED AND CRIPPLED 15 pages ) . * Navarra et al. (2011 ) Efficacy and safety of belimumab in patients MAINTAINING THE HOSPITAL with active systemic lupus erythematosus : a randomised , placebo FOR SPECIAL SURGERY , New controlled , phase 3 trial . The Lancet , 377 :721 - 731. * York , NY (US ) Abramson et al . ( 1983 ) Arthritis Rheum .
[Show full text]
Mutational Mechanisms That Activate Wnt Signaling and Predict Outcomes in Colorectal Cancer Patients William Hankey1, Michael A
Published OnlineFirst December 6, 2017; DOI: 10.1158/0008-5472.CAN-17-1357 Cancer Genome and Epigenome Research Mutational Mechanisms That Activate Wnt Signaling and Predict Outcomes in Colorectal Cancer Patients William Hankey1, Michael A. McIlhatton1, Kenechi Ebede2, Brian Kennedy3, Baris Hancioglu3, Jie Zhang4, Guy N. Brock3, Kun Huang4, and Joanna Groden1 Abstract APC biallelic loss-of-function mutations are the most prevalent also exhibiting unique changes in pathways related to prolifera- genetic changes in colorectal tumors, but it is unknown whether tion, cytoskeletal organization, and apoptosis. Apc-mutant ade- these mutations phenocopy gain-of-function mutations in the nomas were characterized by increased expression of the glial CTNNB1 gene encoding b-catenin that also activate canonical nexin Serpine2, the human ortholog, which was increased in WNT signaling. Here we demonstrate that these two mutational advanced human colorectal tumors. Our results support the mechanisms are not equivalent. Furthermore, we show how hypothesis that APC-mutant colorectal tumors are transcription- differences in gene expression produced by these different ally distinct from APC-wild-type colorectal tumors with canonical mechanisms can stratify outcomes in more advanced human WNT signaling activated by other mechanisms, with possible colorectal cancers. Gene expression profiling in Apc-mutant and implications for stratification and prognosis. Ctnnb1-mutant mouse colon adenomas identified candidate Significance: These findings suggest that colon adenomas genes for subsequent evaluation of human TCGA (The Cancer driven by APC mutations are distinct from those driven by WNT Genome Atlas) data for colorectal cancer outcomes. Transcrip- gain-of-function mutations, with implications for identifying tional patterns exhibited evidence of activated canonical Wnt at-risk patients with advanced disease based on gene expression signaling in both types of adenomas, with Apc-mutant adenomas patterns.
[Show full text]
A Distinct Inflammatory Gene Expression Profile in Patients with Psoriatic Arthritis
Genes and Immunity (2006) 7, 583–591 & 2006 Nature Publishing Group All rights reserved 1466-4879/06 $30.00 www.nature.com/gene ORIGINAL ARTICLE A distinct inflammatory gene expression profile in patients with psoriatic arthritis AK Stoeckman1, EC Baechler1, WA Ortmann1, TW Behrens1, CJ Michet2 and EJ Peterson1 1Department of Medicine, University of Minnesota Medical School, Center for Immunology, University of Minnesota, Minneapolis, MN, USA and 2Division of Rheumatology, Mayo Clinic, Rochester, MN, USA Psoriatic arthritis (PsA) is a systemic inflammatory condition featuring polyarthritis associated with psoriasis. Apart from clinical indicators, few biomarkers exist to aid in the diagnosis and management of PsA. We hypothesized that whole blood gene expression profiling would provide new diagnostic markers and/or insights into pathogenesis of the disease. We compared whole blood gene expression profiles in PsA patients and in age-matched controls. We identified 310 differentially expressed genes, the majority of which are upregulated in PsA patients. The PsA expression profile does not significantly overlap with profiles derived from patients with rheumatoid arthritis or systemic lupus erythematosus. Logistic regression identified two lymphocyte-specific genes (zinc-finger protein 395 and phosphoinositide-3-kinase 2B) that discriminate PsA patients from normal controls. In addition, a highly coregulated cluster of overexpressed genes implicated in protein kinase A regulation strongly correlates with erythrocyte sedimentation rate. Other clusters of coregulated, yet suppressed genes in PsA patient blood include molecules involved in T-cell signaling. Finally, differentially expressed genes in PsA fall into diverse functional categories, but many downregulated genes belong to a CD40 signaling pathway. Together, the data suggest that gene expression profiles of PsA patient blood contain candidate novel disease markers and clues to pathogenesis.
[Show full text]
RABIF/MSS4 Is a Rab-Stabilizing Holdase Chaperone Required for GLUT4 Exocytosis
RABIF/MSS4 is a Rab-stabilizing holdase chaperone required for GLUT4 exocytosis Daniel R. Gulbransona, Eric M. Davisa, Brittany A. Demmitta,b, Yan Ouyanga, Yihong Yec, Haijia Yua,d,1, and Jingshi Shena,1 aDepartment of Molecular, Cellular and Developmental Biology, University of Colorado, Boulder, CO 80309; bInstitute for Behavioral Genetics, University of Colorado, Boulder, CO 80309; cLaboratory of Molecular Biology, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD 20892; and dJiangsu Key Laboratory for Molecular and Medical Biotechnology, College of Life Sciences, Nanjing Normal University, Nanjing 210023, China Edited by Jennifer Lippincott-Schwartz, Howard Hughes Medical Institute, Ashburn, VA, and approved August 21, 2017 (received for review July 7, 2017) Rab GTPases are switched from their GDP-bound inactive confor- anabolic hormone insulin facilitates glucose uptake by acutely mation to a GTP-bound active state by guanine nucleotide exchange relocating GLUT4 from intracellular compartments to the cell factors (GEFs). The first putative GEFs isolated for Rabs are RABIF surface (6, 20, 21, 23). Upon the termination of insulin signaling, (Rab-interacting factor)/MSS4 (mammalian suppressor of Sec4) and GLUT4 is retrieved from the plasma membrane through endocy- its yeast homolog DSS4 (dominant suppressor of Sec4). However, tosis and returns to intracellular storage vesicles (6). Importantly, the biological function and molecular mechanism of these molecules the components of GLUT4 exocytosis are also involved in the remained unclear. In a genome-wide CRISPR genetic screen, we regulation of other exocytic pathways such as insulin secretion and isolated RABIF as a positive regulator of exocytosis.
[Show full text]
Rab Gtpases: Switching to Human Diseases
cells Review Rab GTPases: Switching to Human Diseases Noemi Antonella Guadagno and Cinzia Progida * Department of Biosciences, University of Oslo, 0316 Oslo, Norway * Correspondence: [email protected]; Tel.: +47-22-85-44-41 Received: 30 June 2019; Accepted: 14 August 2019; Published: 16 August 2019 Abstract: Rab proteins compose the largest family of small GTPases and control the different steps of intracellular membrane traffic. More recently, they have been shown to also regulate cell signaling, division, survival, and migration. The regulation of these processes generally occurs through recruitment of effectors and regulatory proteins, which control the association of Rab proteins to membranes and their activation state. Alterations in Rab proteins and their effectors are associated with multiple human diseases, including neurodegeneration, cancer, and infections. This review provides an overview of how the dysregulation of Rab-mediated functions and membrane trafficking contributes to these disorders. Understanding the altered dynamics of Rabs and intracellular transport defects might thus shed new light on potential therapeutic strategies. Keywords: GTPases; Rab proteins; membrane trafficking; neurodegeneration; cancer; intracellular pathogens 1. Introduction Intracellular membrane trafficking is essential for the transport of membranes and cargoes between the different compartments in eukaryotic cells. It uses vesicular or tubular carriers that travel along the endocytic and exocytic pathways and it is regulated by complex protein machineries [1]. Rab GTPases are evolutionarily conserved regulators of vesicular transport, with more than 60 members described in humans [2,3]. They are localized to different membrane compartments in order to control both the specificity and the directionality of membrane trafficking.
[Show full text]
RABIF/MSS4 Is a Rab-Stabilizing Holdase Chaperone Required For
RABIF/MSS4 is a Rab-stabilizing holdase chaperone PNAS PLUS required for GLUT4 exocytosis Daniel R. Gulbransona, Eric M. Davisa, Brittany A. Demmitta,b, Yan Ouyanga, Yihong Yec, Haijia Yua,d,1, and Jingshi Shena,1 aDepartment of Molecular, Cellular and Developmental Biology, University of Colorado, Boulder, CO 80309; bInstitute for Behavioral Genetics, University of Colorado, Boulder, CO 80309; cLaboratory of Molecular Biology, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD 20892; and dJiangsu Key Laboratory for Molecular and Medical Biotechnology, College of Life Sciences, Nanjing Normal University, Nanjing 210023, China Edited by Jennifer Lippincott-Schwartz, Howard Hughes Medical Institute, Ashburn, VA, and approved August 21, 2017 (received for review July 7, 2017) Rab GTPases are switched from their GDP-bound inactive confor- anabolic hormone insulin facilitates glucose uptake by acutely mation to a GTP-bound active state by guanine nucleotide exchange relocating GLUT4 from intracellular compartments to the cell factors (GEFs). The first putative GEFs isolated for Rabs are RABIF surface (6, 20, 21, 23). Upon the termination of insulin signaling, (Rab-interacting factor)/MSS4 (mammalian suppressor of Sec4) and GLUT4 is retrieved from the plasmamembranethroughendocy- its yeast homolog DSS4 (dominant suppressor of Sec4). However, tosis and returns to intracellular storage vesicles (6). Importantly, the biological function and molecular mechanism of these molecules the components of GLUT4 exocytosis are also involved in the remained unclear. In a genome-wide CRISPR genetic screen, we regulation of other exocytic pathways such as insulin secretion and isolated RABIF as a positive regulator of exocytosis. Knockout of T cell degranulation (6, 22, 24–27).
[Show full text]
Genetic Investigation in Non-Obstructive Azoospermia: from the X Chromosome to The
DOTTORATO DI RICERCA IN SCIENZE BIOMEDICHE CICLO XXIX COORDINATORE Prof. Persio dello Sbarba Genetic investigation in non-obstructive azoospermia: from the X chromosome to the whole exome Settore Scientifico Disciplinare MED/13 Dottorando Tutore Dott. Antoni Riera-Escamilla Prof. Csilla Gabriella Krausz _______________________________ _____________________________ (firma) (firma) Coordinatore Prof. Carlo Maria Rotella _______________________________ (firma) Anni 2014/2016 A la meva família Agraïments El resultat d’aquesta tesis és fruit d’un esforç i treball continu però no hauria estat el mateix sense la col·laboració i l’ajuda de molta gent. Segurament em deixaré molta gent a qui donar les gràcies però aquest són els que em venen a la ment ara mateix. En primer lloc voldria agrair a la Dra. Csilla Krausz por haberme acogido con los brazos abiertos desde el primer día que llegué a Florencia, por enseñarme, por su incansable ayuda y por contagiarme de esta pasión por la investigación que nunca se le apaga. Voldria agrair també al Dr. Rafael Oliva per haver fet possible el REPROTRAIN, per haver-me ensenyat moltíssim durant l’època del màster i per acceptar revisar aquesta tesis. Alhora voldria agrair a la Dra. Willy Baarends, thank you for your priceless help and for reviewing this thesis. També voldria donar les gràcies a la Dra. Elisabet Ars per acollir-me al seu laboratori a Barcelona, per ajudar-me sempre que en tot el què li he demanat i fer-me tocar de peus a terra. Ringrazio a tutto il gruppo di Firenze, che dal primo giorno mi sono trovato come a casa.
[Show full text]
Inhibition of the Pim1 Oncogene Results in Diminished Visual Function
Inhibition of the Pim1 Oncogene Results in Diminished Visual Function Jun Yin1, Lisa Shine2, Francis Raycroft3, Sudhakar Deeti2, Alison Reynolds2, Kristin M. Ackerman3, Antonino Glaviano2, Sean O’Farrell2, Olivia O’Leary2, Claire Kilty2, Ciaran Kennedy2, Sarah McLoughlin2, Megan Rice2, Eileen Russell2, Desmond G. Higgins1, David R. Hyde3, Breandan N. Kennedy2* 1 UCD School of Medicine and Medical Science, UCD Conway Institute, University College Dublin, Dublin, Ireland, 2 UCD School of Biomolecular and Biomedical Science, UCD Conway Institute, University College Dublin, Dublin, Ireland, 3 Department of Biological Sciences and the Center for Zebrafish Research, University of Notre Dame, Notre Dame, Indiana, United States of America Abstract Our objective was to profile genetic pathways whose differential expression correlates with maturation of visual function in zebrafish. Bioinformatic analysis of transcriptomic data revealed Jak-Stat signalling as the pathway most enriched in the eye, as visual function develops. Real-time PCR, western blotting, immunohistochemistry and in situ hybridization data confirm that multiple Jak-Stat pathway genes are up-regulated in the zebrafish eye between 3–5 days post-fertilisation, times associated with significant maturation of vision. One of the most up-regulated Jak-Stat genes is the proto-oncogene Pim1 kinase, previously associated with haematological malignancies and cancer. Loss of function experiments using Pim1 morpholinos or Pim1 inhibitors result in significant diminishment of visual behaviour and function. In summary, we have identified that enhanced expression of Jak-Stat pathway genes correlates with maturation of visual function and that the Pim1 oncogene is required for normal visual function. Citation: Yin J, Shine L, Raycroft F, Deeti S, Reynolds A, et al.
[Show full text]
DENND2B Activates Rab13 at the Leading Edge of Migrating Cells and Promotes Metastatic Behavior
JCB: Article DENND2B activates Rab13 at the leading edge of migrating cells and promotes metastatic behavior Maria S. Ioannou,1 Emily S. Bell,2 Martine Girard,1 Mathilde Chaineau,1 Jason N.R. Hamlin,1 Mark Daubaras,1 Anie Monast,2 Morag Park,2 Louis Hodgson,3 and Peter S. McPherson1 1Department of Neurology and Neurosurgery, Montreal Neurological Institute; and 2Department of Biochemistry, Goodman Cancer Centre; McGill University, Montreal, Quebec H3A 0G4, Canada 3Department of Anatomy and Structural Biology, Gruss-Lipper Biophotonics Center, Albert Einstein College of Medicine, New York, NY 10461 he small guanosine triphosphatase Rab13 functions at the leading edge of migrating cells. DENND2B inter- in exocytic vesicle trafficking in epithelial cells. Al- acts with the Rab13 effector MICAL-L2 at the cell periph- T terations in Rab13 activity have been observed in ery, and this interaction is required for the dynamic human cancers, yet the mechanism of Rab13 activation remodeling of the cell’s leading edge. Disruption of and its role in cancer progression remain unclear. In this Rab13-mediated trafficking dramatically limits the inva- paper, we identify the DENN domain protein DENND2B sive behavior of epithelial cells in vitro and the growth as the guanine nucleotide exchange factor for Rab13 and and migration of highly invasive cancer cells in vivo. Thus, develop a novel Förster resonance energy transfer–based blocking Rab13 activation by DENND2B may provide Rab biosensor to reveal activation of Rab13 by DENND2B a novel target to limit the spread of epithelial cancers. Introduction The formation of carcinomas (epithelial cell cancers) involves cadherins from endosomes, and loss of Rab35 function leads to loss of cell–cell contact, dynamic changes in cell morphology, loss of cell–cell contact and enhanced cell migration (Allaire increased proliferation, and enhanced cell migration and inva- et al., 2013).
[Show full text]
FARE2015 WINNERS Sorted by Study Section
FARE2015 WINNERS Sorted By Study Section Biochemistry - Proteins Andrezza Campos-Chagas Visiting Fellow NIAID Sicpin, the first immunomodulatory salivary protein described in black flies significantly reduced T and B cell proliferation and directly binds to soluble CD4 receptor Hematophagy is key to blood feeding arthropods reproductive success and an important link in pathogen transmission cycles. Salivary gland homogenates from blackflies have been shown to contain immunomodulatory activity on murine splenocytes. However, the molecule(s) responsible for this salivary activity remains elusive thus far. Here, we report the first immunosuppressive protein from blackfly salivary glands. Sicpin (Simulium cell proliferation inhibitor) was produced in E. coli and purified using size exclusion and ion exchange chromatography. Purified Sicpin was LPS-decontaminated and its sequence verified by N-terminal sequencing and LC-MS/MS analysis. Sicpin inhibited cell proliferation in a dose-response manner independently of the mitogen utilized (ConA, LPS, CD3/CD28 and Pokeweed). LPS or ConA stimulated cells had a significant lower proliferation rates (P<0.001) in the presence of Sicpin (IC50=0.5uM) with 10uM completely abrogating cell proliferation. Flow cytometry analysis showed that Sicpin inhibited proliferation of CD19+ B-cells and CD4+/CD8+ T-cells. Sicpin did not induce apoptosis or necrosis in mitogen-induced proliferative responses by murine splenocytes as determined by flow cytometry. Sicpin also inhibits antigen-specific cell proliferation without inducing apoptosis in resting or mitogen-induced splenocytes. We demonstrate that the production IFN-alpha, IL4, IL5, IL6 and IL10 by splenocytes stimulated by ConA or LPS was dose-dependently reduced by Sicpin. Reduction of cytokines in presence of Sicpin could lead to a retardation of B and T cell activity.
[Show full text]
Genome-Wide Association Studies in the Japanese Population Identify Seven Novel Loci for Type 2 Diabetes
ARTICLE Received 26 Jun 2015 | Accepted 22 Dec 2015 | Published 28 Jan 2016 DOI: 10.1038/ncomms10531 OPEN Genome-wide association studies in the Japanese population identify seven novel loci for type 2 diabetes Minako Imamura et al.# Genome-wide association studies (GWAS) have identified more than 80 susceptibility loci for type 2 diabetes (T2D), but most of its heritability still remains to be elucidated. In this study, we conducted a meta-analysis of GWAS for T2D in the Japanese population. Combined data from discovery and subsequent validation analyses (23,399 T2D cases and 31,722 controls) identify 7 new loci with genome-wide significance (Po5 Â 10 À 8), rs1116357 near CCDC85A, rs147538848 in FAM60A, rs1575972 near DMRTA1, rs9309245 near ASB3, rs67156297 near ATP8B2, rs7107784 near MIR4686 and rs67839313 near INAFM2. Of these, the association of 4 loci with T2D is replicated in multi-ethnic populations other than Japanese (up to 65,936 T2Ds and 158,030 controls, Po0.007). These results indicate that expansion of single ethnic GWAS is still useful to identify novel susceptibility loci to complex traits not only for ethnicity-specific loci but also for common loci across different ethnicities. Correspondence and requests for materials should be addressed to S.M. (email: [email protected]) or to T.K. (email: [email protected]). #A full list of authors and their affiliations appears at the end of the paper. NATURE COMMUNICATIONS | 7:10531 | DOI: 10.1038/ncomms10531 | www.nature.com/naturecommunications 1 ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms10531 o date, more than 80 susceptibility loci for type 2 diabetes association with T2D (Po1 Â 10 À 6).
[Show full text]
Anti-RAB13 Antibody (ARG59040)
Product datasheet [email protected] ARG59040 Package: 50 μg anti-RAB13 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes RAB13 Tested Reactivity Hu, Ms, Rat Predict Reactivity Hm Tested Application IHC-P, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name RAB13 Antigen Species Human Immunogen Synthetic peptide corresponding to aa. 121-150 of Human RAB13 (NKCDMEAKRKVQKEQADKLAREHGIRFFET). Conjugation Un-conjugated Alternate Names Cell growth-inhibiting gene 4 protein; GIG4; Ras-related protein Rab-13 Application Instructions Application table Application Dilution IHC-P 0.5 - 1 µg/ml WB 0.1 - 0.5 µg/ml Application Note IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Calculated Mw 23 kDa Properties Form Liquid Purification Affinity purification with immunogen. Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. Preservative 0.05% Sodium azide Stabilizer 5% BSA Concentration 0.5 mg/ml Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed www.arigobio.com 1/3 before use. Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Gene Symbol RAB13 Gene Full Name RAB13, member RAS oncogene family Background This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE).
[Show full text]