USP16 (Human) Recombinant Protein (P01)

Total Page：16

File Type：pdf, Size：1020Kb

USP16 (Human) Recombinant system Protein (P01) Purification: Glutathione Sepharose 4 Fast Flow Catalog Number: H00010600-P01 Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Regulation Status: For research use only (RUO) Storage Instruction: Store at -80°C. Aliquot to avoid Product Description: Human USP16 full-length ORF ( repeated freezing and thawing. AAH30777.1, 1 a.a. - 822 a.a.) recombinant protein with GST-tag at N-terminal. Entrez GeneID: 10600 Sequence: Gene Symbol: USP16 MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLK KALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLC Gene Alias: UBP-M LKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLD NWSVWCYVCDNEVQYCSSNQLGQVVDYVRKHASITT Gene Summary: This gene encodes a deubiquitinating PKPEKDNGNIELENKKLEKESKNEQEREKKENMAKEN enzyme that is phosphorylated at the onset of mitosis PPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLR and then dephosphorylated at the metaphase/anaphase ELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAM transition. It can deubiquitinate H2A, one of two major SQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQ ubiquitinated proteins of chromatin, in vitro and a mutant QDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKL form of the protein was shown to block cell division. DEELKNKVKDYEKKKSMPSFVDRIFGGELTSMIMCDQ Alternate transcriptional splice variants, encoding CRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTV different isoforms, have been characterized. [provided by EDEDQDSEEEKDNDSYIKERSDIPSGTSKHLQKKAKK RefSeq] QAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSDNE AEMSLQGEVNIKSNHISQEGVMHKEYCVNQKDLNGQ References: AKMIESVTDNQKSTEEVDMKNINMDNDLEVLTSSPTR 1. The Aurora B Kinase and the Polycomb Protein NLNGAYLTEGSNGEVDISNGFKNLNLNAALHPDEINIEI Ring1B Combine to Regulate Active Promoters in LNDSHTPGTKVYEVVNEDPETAFCTLANREVFNTDEC Quiescent Lymphocytes. Frangini A, Sjoberg M, SIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPKANI Roman-Trufero M, Dharmalingam G, Haberle V, Bartke KGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNL T, Lenhard B, Malumbres M, Vidal M, Dillon N Mol Cell. RKVNKHIKFPEILDLAPFCTLKCKNVAEENTRVLYSLYG 2013 Sep 12;51(5):647-61. doi: VVEHSGTMRSGHYTAYAKARTANSHLSNLVLHGDIPQ 10.1016/j.molcel.2013.08.022. DFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYE RIL Host: Wheat Germ (in vitro) Theoretical MW (kDa): 119.8 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

By Submitted in Partial Satisfaction of the Requirements for Degree of in In
Developments of Two Imaging based Technologies for Cell Biology Researches by Xiaowei Yan DISSERTATION Submitted in partial satisfaction of the requirements for degree of DOCTOR OF PHILOSOPHY in Biochemistry and Molecular Biology in the GRADUATE DIVISION of the UNIVERSITY OF CALIFORNIA, SAN FRANCISCO Approved: ______________________________________________________________________________Ronald Vale Chair ______________________________________________________________________________Jonathan Weissman ______________________________________________________________________________Orion Weiner ______________________________________________________________________________ ______________________________________________________________________________ Committee Members Copyright 2021 By Xiaowei Yan ii DEDICATION Everything happens for the best. To my family, who supported me with all their love. iii ACKNOWLEDGEMENTS The greatest joy of my PhD has been joining UCSF, working and learning with such a fantastic group of scientists. I am extremely grateful for all the support and mentorship I received and would like to thank: My mentor, Ron Vale, who is such a great and generous person. Thank you for showing me that science is so much fun and thank you for always giving me the freedom in pursuing my interest. I am grateful for all the guidance from you and thank you for always supporting me whenever I needed. You are a person full of wisdom, and I have been learning so much from you and your attitude to science, science community and even life will continue inspire me. Thank you for being my mentor and thank you for being such a great mentor. Everyone else in Vale lab, past and present, for making our lab a sweet home. I would like to give my special thank to Marvin (Marvin Tanenbaum) and Nico (Nico Stuurman), two other mentors for me in the lab. I would like to thank them for helping me adapt to our lab, for all the valuable advice and for all the happiness during the time that we work together.
[Show full text]
USP16 Counteracts Mono-Ubiquitination of Rps27a And
RESEARCH ARTICLE USP16 counteracts mono-ubiquitination of RPS27a and promotes maturation of the 40S ribosomal subunit Christian Montellese1†, Jasmin van den Heuvel1,2, Caroline Ashiono1, Kerstin Do¨ rner1,2, Andre´ Melnik3‡, Stefanie Jonas1§, Ivo Zemp1, Paola Picotti3, Ludovic C Gillet1, Ulrike Kutay1* 1Institute of Biochemistry, ETH Zurich, Zurich, Switzerland; 2Molecular Life Sciences Ph.D. Program, Zurich, Switzerland; 3Institute of Molecular Systems Biology, ETH Zurich, Zurich, Switzerland Abstract Establishment of translational competence represents a decisive cytoplasmic step in the biogenesis of 40S ribosomal subunits. This involves final 18S rRNA processing and release of residual biogenesis factors, including the protein kinase RIOK1. To identify novel proteins promoting the final maturation of human 40S subunits, we characterized pre-ribosomal subunits trapped on RIOK1 by mass spectrometry, and identified the deubiquitinase USP16 among the captured factors. We demonstrate that USP16 constitutes a component of late cytoplasmic pre-40S subunits that promotes the removal of ubiquitin from an internal lysine of ribosomal protein *For correspondence: RPS27a/eS31. USP16 deletion leads to late 40S subunit maturation defects, manifesting in [email protected] incomplete processing of 18S rRNA and retarded recycling of late-acting ribosome biogenesis Present address: †CSL Behring, factors, revealing an unexpected contribution of USP16 to the ultimate step of 40S synthesis. CSL Biologics Research Center, Finally, ubiquitination of RPS27a appears to depend on active translation, pointing at a potential ‡ Bern, Switzerland; MSD Merck connection between 40S maturation and protein synthesis. Sharp & Dohme AG, Lucerne, Switzerland; §Institute of Molecular Biology and Biophysics, ETH Zurich, Zurich, Switzerland Introduction Ribosomes stand at the center of translation in all kingdoms of life, catalyzing the synthesis of pro- Competing interests: The teins by reading a messenger RNA (mRNA) template.
[Show full text]
Role of Senataxin in RNA: DNA Hybrids Resolution at DNA Double
Role of senataxin in RNA : DNA hybrids resolution at DNA double strand breaks Sarah Cohen To cite this version: Sarah Cohen. Role of senataxin in RNA : DNA hybrids resolution at DNA double strand breaks. Cellular Biology. Université Paul Sabatier - Toulouse III, 2019. English. NNT : 2019TOU30125. tel-02930730 HAL Id: tel-02930730 https://tel.archives-ouvertes.fr/tel-02930730 Submitted on 4 Sep 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. �� !��"�� "��#�$�% �� %��"��"� �� &�� '��"�� (�� "�� "�� "�&)��"��*�� (�+ "" ��"�� "��!�� ,�,�$�,��-��.�� .�,��+&��-��" ��,��/�� ,�0�%�$�� ,��-�� 0��+ � �� '�� '�� %��1�� /��/�,��
[Show full text]
Aberrant Gene Expression: Diagnostic Markers and Therapeutic Targets for Pancreatic Cancer
ABERRANT GENE EXPRESSION: DIAGNOSTIC MARKERS AND THERAPEUTIC TARGETS FOR PANCREATIC CANCER Jeran Kent Stratford A dissertation submitted to the faculty of the University of North Carolina at Chapel Hill in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Pharmacology. Chapel Hill 2014 Approved by: Jen Jen Yeh Channing J. Der Gary L. Johnson Adrienne D. Cox Timothy C. Elston © 2014 Jeran Kent Stratford ALL RIGHTS RESERVED ii ABSTRACT Jeran Kent Stratford: Aberrant gene expression: diagnostic markers and therapeutic targets for pancreatic cancer (Under the direction of Jen Jen Yeh and Channing J. Der) Pancreatic ductal adenocarcinoma (PDAC) is an aggressive cancer and the fourth leading cause of cancer-related death in the United States. The overall median survival for patients diagnosed with PDAC is five to eight months. The poor outcome is due, in part, to a lack of disease-specific symptoms that can be used for early detection, and as such, most patients present with locally advanced or metastatic disease at the time of diagnosis. Therefore, the need for diagnostic tools is both great and urgent. Furthermore, current chemotherapies have low response rates and high toxicity, limiting their use, and there are currently no effective targeted therapies for PDAC. Therefore, a greater understanding of the underlying biology of pancreatic cancer is needed to identify tumor-specific vulnerabilities that can be therapeutically exploited. Pancreatic cancer development is driven by genomic changes that alter gene expression. Aberrant gene expression produces changes in protein expression, which in turn may confer growth advantages to the tumor; often the tumor then develops a dependency on continued aberrant gene and protein expression.
[Show full text]
Ohnologs in the Human Genome Are Dosage Balanced and Frequently Associated with Disease
Ohnologs in the human genome are dosage balanced and frequently associated with disease Takashi Makino1 and Aoife McLysaght2 Smurfit Institute of Genetics, University of Dublin, Trinity College, Dublin 2, Ireland Edited by Michael Freeling, University of California, Berkeley, CA, and approved April 9, 2010 (received for review December 21, 2009) About 30% of protein-coding genes in the human genome are been duplicated by WGD, subsequent loss of individual genes related through two whole genome duplication (WGD) events. would result in a dosage imbalance due to insufficient gene Although WGD is often credited with great evolutionary impor- product, thus leading to biased retention of dosage-balanced tance, the processes governing the retention of these genes and ohnologs. In fact, evidence for preferential retention of dosage- their biological significance remain unclear. One increasingly pop- balanced genes after WGD is accumulating (4, 7, 11–20). Copy ular hypothesis is that dosage balance constraints are a major number variation [copy number polymorphism (CNV)] describes determinant of duplicate gene retention. We test this hypothesis population level polymorphism of small segmental duplications and show that WGD-duplicated genes (ohnologs) have rarely and is known to directly correlate with gene expression levels (21– experienced subsequent small-scale duplication (SSD) and are also 24). Thus, CNV of dosage-balanced genes is also expected to be refractory to copy number variation (CNV) in human populations deleterious. This model predicts that retained ohnologs should be and are thus likely to be sensitive to relative quantities (i.e., they are enriched for dosage-balanced genes that are resistant to sub- dosage-balanced).
[Show full text]
Inhibiting USP16 Rescues Stem Cell Aging and Memory in An
bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.383059; this version posted December 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Title: Inhibiting USP16 rescues stem cell aging and memory in an Alzheimer’s model Authors: Felicia Reinitz1†, Elizabeth Chen1†, Benedetta Nicolis di Robilant1†, Bayarsaikhan Chuluun2, Jane Antony1, Robert C. Jones3, Neha Gubbi1, Sai Saroja Kolluru3, Dalong Qian1, Katja Piltti4, Aileen Anderson4, Michelle Monje1, H. Craig Heller2, Stephen Quake3, Michael F. Clarke1* Affiliations: 1Institute of Stem Cell Biology and Regenerative Medicine, Stanford University School of Medicine, Stanford, California 94305, USA. 2Department of Biology, Stanford University School of Medicine, Stanford, California 94305, USA. 3Bioengineering, Stanford University School of Engineering and Medicine, Stanford, California, 94305, USA. 4Sue and Bill Gross Stem Cell Research Center, University of California, Irvine *Lead contact and all other correspondence to: [email protected] †These authors contributed equally. 1 Summary: Alzheimer’s disease (AD) is a progressive neurodegenerative disease observed with 2 aging that represents the most common form of dementia. To date, therapies targeting end-stage 3 disease plaques, tangles, or inflammation have limited efficacy. Therefore, we set out to identify 4 an earlier targetable phenotype. Utilizing a mouse model of AD and human fetal cells harboring 5 mutant amyloid precursor protein, we show cell intrinsic neural precursor cell (NPC) dysfunction 6 precedes widespread inflammation and amyloid plaque pathology, making it the earliest defect in 7 the evolution of disease.
[Show full text]
Morphology, Behavior, and the Sonic Hedgehog Pathway in Mouse Models of Down Syndrome
MORPHOLOGY, BEHAVIOR, AND THE SONIC HEDGEHOG PATHWAY IN MOUSE MODELS OF DOWN SYNDROME by Tara Dutka A dissertation submitted to Johns Hopkins University in conformity with the requirements for the degree of Doctor of Philosophy Baltimore, Maryland July, 2014 © 2014 Tara Dutka All Rights Reserved Abstract Down Syndrome (DS) is caused by a triplication of human chromosome 21 (Hsa21). Ts65Dn, a mouse model of DS, contains a freely segregating extra chromosome consisting of the distal portion of mouse chromosome 16 (Mmu16), a region orthologous to part of Hsa21, and a non-Hsa21 orthologous region of mouse chromosome 17. All individuals with DS display some level of craniofacial dysmorphology, brain structural and functional changes, and cognitive impairment. Ts65Dn recapitulates these features of DS and aspects of each of these traits have been linked in Ts65Dn to a reduced response to Sonic Hedgehog (SHH) in trisomic cells. Dp(16)1Yey is a new mouse model of DS which has a direct duplication of the entire Hsa21 orthologous region of Mmu16. Dp(16)1Yey’s creators found similar behavioral deficits to those seen in Ts65Dn. We performed a quantitative investigation of the skull and brain of Dp(16)1Yey as compared to Ts65Dn and found that DS-like changes to brain and craniofacial morphology were similar in both models. Our results validate examination of the genetic basis for these phenotypes in Dp(16)1Yey mice and the genetic links for these phenotypes previously found in Ts65Dn , i.e., reduced response to SHH. Further, we hypothesized that if all trisomic cells show a reduced response to SHH, then up-regulation of the SHH pathway might ameliorate multiple phenotypes.
[Show full text]
A Systematic Genome-Wide Association Analysis for Inflammatory Bowel Diseases (IBD)
A systematic genome-wide association analysis for inflammatory bowel diseases (IBD) Dissertation zur Erlangung des Doktorgrades der Mathematisch-Naturwissenschaftlichen Fakultät der Christian-Albrechts-Universität zu Kiel vorgelegt von Dipl.-Biol. ANDRE FRANKE Kiel, im September 2006 Referent: Prof. Dr. Dr. h.c. Thomas C.G. Bosch Koreferent: Prof. Dr. Stefan Schreiber Tag der mündlichen Prüfung: Zum Druck genehmigt: der Dekan “After great pain a formal feeling comes.” (Emily Dickinson) To my wife and family ii Table of contents Abbreviations, units, symbols, and acronyms . vi List of figures . xiii List of tables . .xv 1 Introduction . .1 1.1 Inflammatory bowel diseases, a complex disorder . 1 1.1.1 Pathogenesis and pathophysiology. .2 1.2 Genetics basis of inflammatory bowel diseases . 6 1.2.1 Genetic evidence from family and twin studies . .6 1.2.2 Single nucleotide polymorphisms (SNPs) . .7 1.2.3 Linkage studies . .8 1.2.4 Association studies . 10 1.2.5 Known susceptibility genes . 12 1.2.5.1 CARD15. .12 1.2.5.2 CARD4. .15 1.2.5.3 TNF-α . .15 1.2.5.4 5q31 haplotype . .16 1.2.5.5 DLG5 . .17 1.2.5.6 TNFSF15 . .18 1.2.5.7 HLA/MHC on chromosome 6 . .19 1.2.5.8 Other proposed IBD susceptibility genes . .20 1.2.6 Animal models. 21 1.3 Aims of this study . 23 2 Methods . .24 2.1 Laboratory information management system (LIMS) . 24 2.2 Recruitment. 25 2.3 Sample preparation. 27 2.3.1 DNA extraction from blood. 27 2.3.2 Plate design .
[Show full text]
The Histone H2A Deubiquitinase Usp16 Regulates Hematopoiesis
The histone H2A deubiquitinase Usp16 regulates PNAS PLUS hematopoiesis and hematopoietic stem cell function Yue Gua,1, Amanda E. Jonesa,1, Wei Yanga,1, Shanrun Liua, Qian Daib, Yudong Liuc, C. Scott Swindled, Dewang Zhoua, Zhuo Zhanga, Thomas M. Ryana, Tim M. Townesa, Christopher A. Klugd, Dongquan Chene, and Hengbin Wanga,2 aDepartment of Biochemistry and Molecular Genetics, Stem Cell Institute, University of Alabama at Birmingham, Birmingham, AL 35294; bDepartment of Pathology, University of Alabama at Birmingham, Birmingham, AL 35294; cDepartment of Cell, Developmental, and Integrative Biology, University of Alabama at Birmingham, Birmingham, AL 35294; dDepartment of Microbiology, University of Alabama at Birmingham, Birmingham, AL 35294; and eDivision of Preventive Medicine, Comprehensive Cancer Center, University of Alabama at Birmingham, Birmingham, AL 35294 Edited by Louise T. Chow, University of Alabama at Birmingham, Birmingham, AL, and approved November 23, 2015 (received for review August 26, 2015) Epigenetic mechanisms play important regulatory roles in hema- are also impaired in proliferative response to mitogens. The topoiesis and hematopoietic stem cell (HSC) function. Subunits of critical role of Bmi1 is largely attributed to dysregulation of polycomb repressive complex 1 (PRC1), the major histone H2A the Ink4A locus (19). Bmi1 also plays an indispensable role in the ubiquitin ligase, are critical for both normal and pathological maintenance of leukemic stem cells (19, 20). Furthermore, hematopoiesis; however, it is unclear which of the several counter- Ring1B knockout results in hypo-cellular BM but enlarged pools acting H2A deubiquitinases functions along with PRC1 to control of hyper-proliferating immature cells. Although HSCs and pro- H2A ubiquitination (ubH2A) level and regulates hematopoiesis in genitor cells maintain differentiation potential, they exhibit high vivo.
[Show full text]
A Molecular Quantitative Trait Locus Map for Osteoarthritis
ARTICLE https://doi.org/10.1038/s41467-021-21593-7 OPEN A molecular quantitative trait locus map for osteoarthritis Julia Steinberg 1,2,3,4, Lorraine Southam1,3, Theodoros I. Roumeliotis3,5, Matthew J. Clark 6, Raveen L. Jayasuriya6, Diane Swift6, Karan M. Shah 6, Natalie C. Butterfield 7, Roger A. Brooks8, Andrew W. McCaskie8, J. H. Duncan Bassett 7, Graham R. Williams 7, Jyoti S. Choudhary 3,5, ✉ ✉ J. Mark Wilkinson 6,9,11 & Eleftheria Zeggini 1,3,10,11 1234567890():,; Osteoarthritis causes pain and functional disability for over 500 million people worldwide. To develop disease-stratifying tools and modifying therapies, we need a better understanding of the molecular basis of the disease in relevant tissue and cell types. Here, we study primary cartilage and synovium from 115 patients with osteoarthritis to construct a deep molecular signature map of the disease. By integrating genetics with transcriptomics and proteomics, we discover molecular trait loci in each tissue type and omics level, identify likely effector genes for osteoarthritis-associated genetic signals and highlight high-value targets for drug development and repurposing. These findings provide insights into disease aetiopathology, and offer translational opportunities in response to the global clinical challenge of osteoarthritis. 1 Institute of Translational Genomics, Helmholtz Zentrum München – German Research Center for Environmental Health, Neuherberg, Germany. 2 Cancer Research Division, Cancer Council NSW, Sydney, NSW, Australia. 3 Wellcome Sanger Institute, Hinxton, United Kingdom. 4 School of Public Health, The University of Sydney, Sydney, NSW, Australia. 5 The Institute of Cancer Research, London, United Kingdom. 6 Department of Oncology and Metabolism, University of Sheffield, Sheffield, United Kingdom.
[Show full text]
Deciphering Histone 2A Deubiquitination Michael J Clague, Judy M Coulson and Sylvie Urbé
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by PubMed Central Minireview Deciphering histone 2A deubiquitination Michael J Clague, Judy M Coulson and Sylvie Urbé Address: Physiological Laboratory, School of Biomedical Sciences, University of Liverpool, Crown St, Liverpool L69 3BX, UK. Correspondence: Michael J Clague. Email: [email protected]. Sylvie Urbé. Email: [email protected] Published: 23 January 2008 Genome Biology 2008, 9:202 (doi:10.1186/gb-2008-9-1-202) The electronic version of this article is the complete one and can be found online at http://genomebiology.com/2008/9/1/202 © 2008 BioMed Central Ltd Abstract Three recent papers have identified distinct enzymes that can remove ubiquitin from mammalian histone 2A (H2A). Functions in transcriptional activation, DNA repair and control of the cell cycle have been proposed for these enzymes. Ubiquitination is a reversible posttranslational modification Identification of H2A-deubiquitinating enzymes of proteins that could rival phosphorylation in its scope Three recent papers identify distinct DUBs with activity and complexity. Removal of ubiquitin is accomplished towards H2A and begin to unravel their cellular functions through the action of deubiquitinating enzymes (DUBs), (Figure 1). Zhu et al. [12] identified MYSM1/KIAA1915 which fall into five distinct families in the human genome, (belonging to the JAMM/MPN+ family of metalloprotease containing about 84 active members [1,2]. Post- DUBs [13]) in a screen for factors regulating androgen- translational modifications of histones include methy- controlled gene expression. The authors argue that MYSM1 lation, acetylation, sumoylation and ubiquitination, is an H2A-specific DUB on the basis of decreased ubiquitina- enabling a combinatorial code to regulate chromatin tion following overexpression of MYSM1 in HEK293T structure [3] and recruit protein complexes [4].
[Show full text]
Usp16 Modulates Wnt Signaling in Primary Tissues Through Cdkn2a Regulation
bioRxiv preprint doi: https://doi.org/10.1101/326272; this version posted June 8, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Title: Usp16 modulates Wnt signaling in primary tissues through Cdkn2a regulation Authors: Maddalena Adorno1, Benedetta Nicolis di Robilant1, Shaheen Sikandar1, Veronica Haro Acosta1,2, Jane Antony1, Craig Heller3, Michael F. Clarke1* Affiliations: 1 Institute for Stem Cell Biology and Regenerative Medicine, Stanford University School of Medicine, Stanford, California 94305, USA. 2 Molecular and Computational Biology Department, University of Southern California, Los Angeles, California 90087 USA. 3Department of Biology, Stanford University School of Medicine, Stanford, California 94305, USA *Correspondence to: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/326272; this version posted June 8, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. ABSTRACT Regulation of the Wnt pathway in stem cells and primary tissues is still poorly understood. Here we report that Usp16, a negative regulator of Bmi1/PRC1 function, modulates the Wnt pathway in mammary epithelia, primary human fibroblasts and MEFs, affecting their expansion and self- renewal potential. In mammary glands, reduced levels of Usp16 increase tissue responsiveness to Wnt, resulting in upregulation of the downstream Wnt target Axin2, expansion of the basal compartment and increased in vitro and in vivo epithelial regeneration. Usp16 regulation of the Wnt pathway in mouse and human tissues is at least in part mediated by activation of Cdkn2a, a regulator of senescence.
[Show full text]