USP16 (Human) Recombinant system Protein (P01) Purification: Glutathione Sepharose 4 Fast Flow Catalog Number: H00010600-P01 Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Regulation Status: For research use only (RUO) Storage Instruction: Store at -80°C. Aliquot to avoid Product Description: Human USP16 full-length ORF ( repeated freezing and thawing. AAH30777.1, 1 a.a. - 822 a.a.) recombinant protein with GST-tag at N-terminal. Entrez GeneID: 10600 Sequence: Gene Symbol: USP16 MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLK KALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLC Gene Alias: UBP-M LKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLD NWSVWCYVCDNEVQYCSSNQLGQVVDYVRKHASITT Gene Summary: This gene encodes a deubiquitinating PKPEKDNGNIELENKKLEKESKNEQEREKKENMAKEN enzyme that is phosphorylated at the onset of mitosis PPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLR and then dephosphorylated at the metaphase/anaphase ELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAM transition. It can deubiquitinate H2A, one of two major SQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQ ubiquitinated proteins of chromatin, in vitro and a mutant QDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKL form of the protein was shown to block cell division. DEELKNKVKDYEKKKSMPSFVDRIFGGELTSMIMCDQ Alternate transcriptional splice variants, encoding CRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTV different isoforms, have been characterized. [provided by EDEDQDSEEEKDNDSYIKERSDIPSGTSKHLQKKAKK RefSeq] QAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSDNE AEMSLQGEVNIKSNHISQEGVMHKEYCVNQKDLNGQ References: AKMIESVTDNQKSTEEVDMKNINMDNDLEVLTSSPTR 1. The Aurora B Kinase and the Polycomb Protein NLNGAYLTEGSNGEVDISNGFKNLNLNAALHPDEINIEI Ring1B Combine to Regulate Active Promoters in LNDSHTPGTKVYEVVNEDPETAFCTLANREVFNTDEC Quiescent Lymphocytes. Frangini A, Sjoberg M, SIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPKANI Roman-Trufero M, Dharmalingam G, Haberle V, Bartke KGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNL T, Lenhard B, Malumbres M, Vidal M, Dillon N Mol Cell. RKVNKHIKFPEILDLAPFCTLKCKNVAEENTRVLYSLYG 2013 Sep 12;51(5):647-61. doi: VVEHSGTMRSGHYTAYAKARTANSHLSNLVLHGDIPQ 10.1016/j.molcel.2013.08.022. DFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYE RIL Host: Wheat Germ (in vitro) Theoretical MW (kDa): 119.8 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression Page 1/1 Powered by TCPDF (www.tcpdf.org).