DOCSLIB.ORG

Produktinformation

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Produktinformation Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic COPS3 polyclonal antibody (A01) Catalog # : H00008533-A01 規格 : [ 50 uL ] List All Specification Application Image Product Mouse polyclonal antibody raised against a partial recombinant COPS3. Western Blot (Cell lysate) Description: Immunogen: COPS3 (NP_003644, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. Sequence: SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAML HNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSY enlarge Western Blot (Cell lysate) Host: Mouse Reactivity: Human, Mouse, Rat Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge Western Blot (Cell lysate) enlarge Western Blot (Cell lysate) Western Blot detection against Immunogen (37 KDa) . Storage Buffer: 50 % glycerol Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: enlarge MSDS: Download Western Blot (Recombinant protein) Datasheet: Download ELISA Applications Western Blot (Cell lysate) Page 1 of 3 2016/5/22 COPS3 polyclonal antibody (A01), Lot # 060113JC01. Western Blot analysis of COPS3 expression in PC-12. Protocol Download Western Blot (Cell lysate) COPS3 polyclonal antibody (A01), Lot # 060113JC01 Western Blot analysis of COPS3 expression in Hela S3 NE ( Cat # L013V3 ). Protocol Download Western Blot (Cell lysate) COPS3 polyclonal antibody (A01), Lot # 060113JC01. Western Blot analysis of COPS3 expression in Raw 264.7. Protocol Download Western Blot (Cell lysate) COPS3 polyclonal antibody (A01), Lot # 060113JC01. Western Blot analysis of COPS3 expression in NIH/3T3. Page 2 of 3 2016/5/22 Protocol Download Western Blot (Recombinant protein) Protocol Download ELISA Gene Information Entrez GeneID: 8533 GeneBank NM_003653 Accession#: Protein NP_003644 Accession#: Gene Name: COPS3 Gene Alias: CSN3,SGN3 Gene COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis) Description: Omim ID: 604665 Gene Ontology: Hyperlink Gene Summary: The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq Other COP9 complex subunit 3,COP9 constitutive photomorphogenic homolog Designations: subunit 3,JAB1-containing signalosome subunit 3 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 3 of 3 2016/5/22.
Load more

Recommended publications
  • Database of Cattle Candidate Genes and Genetic Markers for Milk Production and Mastitis
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by PubMed Central doi:10.1111/j.1365-2052.2009.01921.x Database of cattle candidate genes and genetic markers for milk production and mastitis J. Ogorevc*, T. Kunej*, A. Razpet and P. Dovc Department of Animal Science, Biotechnical Faculty, University of Ljubljana, Domzale, Slovenia Summary A cattle database of candidate genes and genetic markers for milk production and mastitis has been developed to provide an integrated research tool incorporating different types of information supporting a genomic approach to study lactation, udder development and health. The database contains 943 genes and genetic markers involved in mammary gland development and function, representing candidates for further functional studies. The candidate loci were drawn on a genetic map to reveal positional overlaps. For identification of candidate loci, data from seven different research approaches were exploited: (i) gene knockouts or transgenes in mice that result in specific phenotypes associated with mam- mary gland (143 loci); (ii) cattle QTL for milk production (344) and mastitis related traits (71); (iii) loci with sequence variations that show specific allele-phenotype interactions associated with milk production (24) or mastitis (10) in cattle; (iv) genes with expression profiles associated with milk production (207) or mastitis (107) in cattle or mouse; (v) cattle milk protein genes that exist in different genetic variants (9); (vi) miRNAs expressed in bovine mammary gland (32) and (vii) epigenetically regulated cattle genes associated with mammary gland function (1). Fourty-four genes found by multiple independent analyses were suggested as the most promising candidates and were further in silico analysed for expression levels in lactating mammary gland, genetic variability and top biological func- tions in functional networks.
    [Show full text]
  • Effects of B-K-Casein (CSN2-CSN3) Haplotypes and B-Lactoglobulin
    J. Dairy Sci. 93 :3797–3808 doi: 10.3168/jds.2009-2778 © American Dairy Science Association®, 2010 . Effects of β-κ-casein (CSN2-CSN3) haplotypes and β-lactoglobulin (BLG) genotypes on milk production traits and detailed protein composition of individual milk of Simmental cows 1 V. Bonfatti ,* G. Di Martino ,* A. Cecchinato ,* D. Vicario ,† and P. Carnier * * Department of Animal Science, University of Padova, viale dell’Università 16, 35020, Legnaro, Padova, Italy † Italian Simmental Cattle Breeders Association, via Nievo 19, 33100, Udine, Italy ABSTRACT and αS1-CN. Estimated additive genetic variance for investigated traits ranged from 14 to 39% of total vari- The aim of this study was to investigate the effects ance. Increasing the frequency of specific genotypes or of CSN2-CSN3 (β-κ-casein) haplotypes and BLG haplotypes by selective breeding might be an effective (β-lactoglobulin) genotypes on milk production traits, way to change milk protein composition. content of protein fractions, and detailed protein compo- Key words: casein haplotypes , BLG genotype , milk sition of individual milk of Simmental cows. Content of protein composition , Simmental the major protein fractions was measured by reversed- phase HPLC in individual milk samples of 2,167 cows. INTRODUCTION Protein composition was measured as percentage of each casein (CN) fraction to total CN and as percent- Most research concerning milk protein polymor- age of β-lactoglobulin (β-LG) to total whey protein. phisms has focused on the associations of CSN3 (κ-CN) Genotypes at CSN2, CSN3, and BLG were ascertained and BLG (β-LG) polymorphisms with milk production by reversed-phase HPLC, and CSN2-CSN3 haplotype traits, coagulation time, curd firmness, and cheese yield.
    [Show full text]
  • Genome Variants Associated with RNA Splicing Variation in Bovine Are
    bioRxiv preprint doi: https://doi.org/10.1101/220251; this version posted April 5, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Genome variants associated with RNA splicing variation in bovine are 2 extensively shared between tissues 3 Ruidong Xiang1,2,*, Ben J. Hayes2,3, Christy J. Vander Jagt2, Iona M. MacLeod2, Majid 4 Khansefid2, Phil J. Bowman2,6, Zehu Yuan2, Claire P. Prowse-Wilkins2, Coralie M. Reich2, 5 Brett A. Mason2, Josie B. Garner4, Leah C. Marett4, Yizhou Chen5, Sunduimijid Bolormaa2, 6 Hans D. Daetwyler2,6, Amanda J. Chamberlain2 and Michael E. Goddard1,2 7 1Faculty of Veterinary & Agricultural Science, University of Melbourne, Parkville, VIC 3010, 8 Australia. 2Agriculture Victoria, AgriBio, Centre for AgriBioscience, Bundoora, VIC 3083, 9 Australia. 3Queensland Alliance for Agriculture and Food Innovation, Centre for Animal 10 Science, University of Queensland, St. Lucia, QLD 4067, Australia. 4Agriculture Victoria, 11 Dairy Production Science, Ellinbank, VIC, 3821, Australia. 5Elizabeth Macarthur 12 Agricultural Institute, New South Wales Department of Primary Industries, Camden, NSW 13 2570, Australia. 6School of Applied Systems Biology, La Trobe University, Bundoora, VIC 14 3083, Australia. 15 *Corresponding author: Dr. Ruidong Xiang; 16 Ruidong Xiang: [email protected]; 17 Ben J. Hayes: [email protected]; 18 Christy J. Vander Jagt: [email protected]; 19 Iona M. MacLeod: [email protected]; 20 Majid Khansefid: [email protected]; 21 Phil J.
    [Show full text]
  • Cellular Senescence Bypass Screen Identifies New Putative Tumor
    Oncogene (2008) 27, 1961–1970 & 2008 Nature Publishing Group All rights reserved 0950-9232/08 $30.00 www.nature.com/onc ORIGINAL ARTICLE Cellular senescence bypass screen identifies new putative tumor suppressor genes JFM Leal1, J Fominaya1, A Casco´ n2, MV Guijarro1, C Blanco-Aparicio1, M Lleonart3, ME Castro1, SRamon y Cajal 3, M Robledo2, DH Beach4 and A Carnero1 1Experimental Therapeutics Programme, Centro Nacional de Investigaciones Oncolo´gicas (CNIO), Madrid, Spain; 2Molecular Pathology Programme, Centro Nacional de Investigaciones Oncolo´gicas (CNIO), Madrid, Spain; 3Departamento de Patologı´a, Hospital Vall d’Hebron, Barcelona, Spain and 4Institute for Cell and Molecular Sciences, Center for Cutaneous Biology, London, UK Senescence is a mechanism that limits cellular lifespan and Introduction constitutes a barrier against cellular immortalization. To identify new senescence regulatory genes that might play a Replicative senescence is characterized by a progressive role in tumorigenesis, we have designed and performed a loss of proliferative potential with the increase of popu- large-scale antisense-based genetic screen in primary lation doublings, resulting in a permanent and irrever- mouse embryo fibroblasts (MEFs). Out of this screen, sible cell-cycle arrest. Although the process of senescence we have identified five different genes through which loss occurs both in vitro and in vivo (Dimri et al., 1995; of function partially bypasses senescence. These genes Schmitt et al., 2002; Shay and Roninson, 2004; Braig belong to very different biochemical families: csn2 et al., 2005; Collado et al., 2005; Michaloglou et al., (component of the Cop9 signalosome), aldose reductase 2005), the transition to the senescent phenotype is (a metabolic enzyme) and brf1 (subunit of the RNA commonly studied in culture where a cell population polymerase II complex), S-adenosyl homocysteine hydro- can be grown and monitored.
    [Show full text]
  • Rabbit Anti-COPS3/FITC Conjugated Antibody-SL23085R-FITC
    SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-COPS3/FITC Conjugated antibody SL23085R-FITC Product Name: Anti-COPS3/FITC Chinese Name: FITC标记的COP9信号复合体亚基3抗体 COP9 Signalosome Complex Subunit 3; CSN10; JAB1 Containing Signalosome Alias: Subunit 3; SGN3; Signalosome Subunit 3; CSN3_HUMAN. Organism Species: Rabbit Clonality: Polyclonal React Species: ICC=1:50-200IF=1:50-200 Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 48kDa Form: Lyophilized or Liquid Concentration: 2mg/1ml immunogen: KLH conjugated synthetic peptide derived from human COPS3 Lsotype: IgG Purification: affinity purified by Protein A Storage Buffer: 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Storewww.sunlongbiotech.com at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. background: The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is Product Detail: located within the Smith-Magenis syndrome region on chromosome 17. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010].
    [Show full text]
  • Extensive Intragenic Recombination and Patterns of Linkage Disequilibrium at the CSN3 Locus in European Rabbit
    Genet. Sel. Evol. 39 (2007) 341–352 341 c INRA, EDP Sciences, 2007 DOI: 10.1051/gse:2007007 Original article Extensive intragenic recombination and patterns of linkage disequilibrium at the CSN3 locus in European rabbit Miguel C∗, Nuno F CIBIO, Centro de Investigação em Biodiversidade e Recursos Genéticos, Campus Agrário de Vairão, 4485-661 Vairão, and Departamento de Zoologia e Antropologia, Faculdade de Ciências da Universidade do Porto, 4099-002 Porto, Portugal (Received 30 August 2006; accepted 20 November 2006) Abstract – Kappa-casein (CSN3) plays an important role in stabilising the Ca-sensitive caseins in the micelle. The European rabbit (Oryctolagus cuniculus) CSN3 has previously been shown to possess two alleles (A and B), which differ deeply in their intronic regions (indels of 100 and 1550 nucleotides in introns 1 and 4, respectively). Furthermore, a correlation between several reproductive performance traits and the different alleles was described. However, all these data were exclusively collected in rabbit domestic breeds, preventing a deeper understanding of the extensive polymorphism observed in the CSN3 gene. Additionally, the techniques available for the typing of both indel polymorphisms were until now not suitable for large-scale studies. In this report, we describe a simple, PCR-based typing method to distinguish rabbit CSN3 alleles. We analyse both ancient wild rabbit populations from the Iberian Peninsula and France, and the more recently derived English wild rabbits and domestic stocks. A new allele (C) showing another major indel (250 bp) in intron 1 was found, but exclusively detected in Iberian wild rabbits. In addition, our survey revealed the occurrence of new haplotypes in wild populations, suggesting that intragenic recombination is important in creating genetic diversity at this locus.
    [Show full text]
  • 393LN V 393P 344SQ V 393P Probe Set Entrez Gene
    393LN v 393P 344SQ v 393P Entrez fold fold probe set Gene Gene Symbol Gene cluster Gene Title p-value change p-value change chemokine (C-C motif) ligand 21b /// chemokine (C-C motif) ligand 21a /// chemokine (C-C motif) ligand 21c 1419426_s_at 18829 /// Ccl21b /// Ccl2 1 - up 393 LN only (leucine) 0.0047 9.199837 0.45212 6.847887 nuclear factor of activated T-cells, cytoplasmic, calcineurin- 1447085_s_at 18018 Nfatc1 1 - up 393 LN only dependent 1 0.009048 12.065 0.13718 4.81 RIKEN cDNA 1453647_at 78668 9530059J11Rik1 - up 393 LN only 9530059J11 gene 0.002208 5.482897 0.27642 3.45171 transient receptor potential cation channel, subfamily 1457164_at 277328 Trpa1 1 - up 393 LN only A, member 1 0.000111 9.180344 0.01771 3.048114 regulating synaptic membrane 1422809_at 116838 Rims2 1 - up 393 LN only exocytosis 2 0.001891 8.560424 0.13159 2.980501 glial cell line derived neurotrophic factor family receptor alpha 1433716_x_at 14586 Gfra2 1 - up 393 LN only 2 0.006868 30.88736 0.01066 2.811211 1446936_at --- --- 1 - up 393 LN only --- 0.007695 6.373955 0.11733 2.480287 zinc finger protein 1438742_at 320683 Zfp629 1 - up 393 LN only 629 0.002644 5.231855 0.38124 2.377016 phospholipase A2, 1426019_at 18786 Plaa 1 - up 393 LN only activating protein 0.008657 6.2364 0.12336 2.262117 1445314_at 14009 Etv1 1 - up 393 LN only ets variant gene 1 0.007224 3.643646 0.36434 2.01989 ciliary rootlet coiled- 1427338_at 230872 Crocc 1 - up 393 LN only coil, rootletin 0.002482 7.783242 0.49977 1.794171 expressed sequence 1436585_at 99463 BB182297 1 - up 393
    [Show full text]
  • Variant Discovery in the Sheep Milk Transcriptome Using RNA Sequencing
    Suárez-Vega et al. BMC Genomics (2017) 18:170 DOI 10.1186/s12864-017-3581-1 RESEARCH ARTICLE Open Access Variant discovery in the sheep milk transcriptome using RNA sequencing Aroa Suárez-Vega1, Beatriz Gutiérrez-Gil1, Christophe Klopp2, Gwenola Tosser-Klopp3 and Juan José Arranz1* Abstract Background: The identification of genetic variation underlying desired phenotypes is one of the main challenges of current livestock genetic research. High-throughput transcriptome sequencing (RNA-Seq) offers new opportunities for the detection of transcriptome variants (SNPs and short indels) in different tissues and species. In this study, we used RNA-Seq on Milk Sheep Somatic Cells (MSCs) with the goal of characterizing the genetic variation within the coding regions of the milk transcriptome in Churra and Assaf sheep, two common dairy sheep breeds farmed in Spain. Results: A total of 216,637 variants were detected in the MSCs transcriptome of the eight ewes analyzed. Among them, a total of 57,795 variants were detected in the regions harboring Quantitative Trait Loci (QTL) for milk yield, protein percentage and fat percentage, of which 21.44% were novel variants. Among the total variants detected, 561 (2.52%) and 1,649 (7.42%) were predicted to produce high or moderate impact changes in the corresponding transcriptional unit, respectively. In the functional enrichment analysis of the genes positioned within selected QTL regions harboring novel relevant functional variants (high and moderate impact), the KEGG pathway with the highest enrichment was “protein processing in endoplasmic reticulum”. Additionally, a total of 504 and 1,063 variants were identified in the genes encoding principal milk proteins and molecules involved in the lipid metabolism, respectively.
    [Show full text]
  • CSN1S1, CSN2, CSN1S2, CSN3) and Regulatory Regions
    RESEARCH ARTICLE Molecular Characterization of the Llamas (Lama glama) Casein Cluster Genes Transcripts (CSN1S1, CSN2, CSN1S2, CSN3) and Regulatory Regions Alfredo Pauciullo1,2*, Georg Erhardt2 1 Department of Agricultural, Forest and Food Sciences, University of Torino, Grugliasco, Italy, 2 Institute for Animal Breeding and Genetics, Justus Liebig University, Gießen, Germany * [email protected] Abstract In the present paper, we report for the first time the characterization of llama (Lama glama) OPEN ACCESS caseins at transcriptomic and genetic level. A total of 288 casein clones transcripts were Citation: Pauciullo A, Erhardt G (2015) Molecular analysed from two lactating llamas. The most represented mRNA populations were those Characterization of the Llamas (Lama glama) Casein correctly assembled (85.07%) and they encoded for mature proteins of 215, 217, 187 and Cluster Genes Transcripts (CSN1S1, CSN2, CSN1S2, CSN3) and Regulatory Regions. PLoS 162 amino acids respectively for the CSN1S1, CSN2, CSN1S2 and CSN3 genes. The exon- ONE 10(4): e0124963. doi:10.1371/journal. ic subdivision evidenced a structure made of 21, 9, 17 and 6 exons for the αs1-, β-, αs2- and pone.0124963 κ-casein genes respectively. Exon skipping and duplication events were evidenced. Two Academic Editor: Vladimir N. Uversky, University of variants A and B were identified in the αs1-casein gene as result of the alternative out-splic- South Florida College of Medicine, UNITED STATES ing of the exon 18. An additional exon coding for a novel esapeptide was found to be cryptic Received: March 6, 2015 in the κ-casein gene, whereas one extra exon was found in the αs2-casein gene by the com- Accepted: March 19, 2015 parison with the Camelus dromedaries sequence.
    [Show full text]
  • Exploring the Genotype at CSN3 Gene, Milk Composition
    animals Communication Exploring the Genotype at CSN3 Gene, Milk Composition, Coagulation and Cheese-Yield Traits of the Sardo-Modicana, an Autochthonous Cattle Breed from the Sardinia Region, Italy Michele Pazzola 1,* , Giuseppe Massimo Vacca 1 , Antonia Noce 1,2 , Marta Porcedda 1, Maria Onnis 1, Nicola Manca 1 and Maria Luisa Dettori 1 1 Department of Veterinary Medicine, University of Sassari, via Vienna 2, 07100 Sassari, Italy; [email protected] (G.M.V.); [email protected] (A.N.); [email protected] (M.P.); [email protected] (M.O.); [email protected] (N.M.); [email protected] (M.L.D.) 2 Leibniz-Institute for Farm Animal Biology (FBN), Wilhelm-Stahl-Allee 2, 18196 Dummerstorf, Germany * Correspondence: [email protected]; Tel.: +39-079229509 Received: 22 September 2020; Accepted: 27 October 2020; Published: 30 October 2020 Simple Summary: The Sardo-Modicana is a local cattle breed from Sardinia, Italy. It originated from the crossing of Sardinian local cows with Modicana bulls from Sicily, imported in the late 19th century. In the 1950s, approximately 60,000 heads were present, but nowadays the total population has decreased to about 1800 animals. It is a multipurpose breed, and animals are farmed using extensive methods. Traditionally, cows are hand-milked and milk is destined to produce a traditional pasta filata cheese. In the literature, the information about the dairy potential of this breed is scarce. The present study evidenced the favorable genetic patterns, milk composition and coagulation traits of the Sardo-Modicana cattle breed; such information will be useful for the preservation and enhancement of the breed.
    [Show full text]
  • Analyzing the Mirna-Gene Networks to Mine the Important Mirnas Under Skin of Human and Mouse
    Hindawi Publishing Corporation BioMed Research International Volume 2016, Article ID 5469371, 9 pages http://dx.doi.org/10.1155/2016/5469371 Research Article Analyzing the miRNA-Gene Networks to Mine the Important miRNAs under Skin of Human and Mouse Jianghong Wu,1,2,3,4,5 Husile Gong,1,2 Yongsheng Bai,5,6 and Wenguang Zhang1 1 College of Animal Science, Inner Mongolia Agricultural University, Hohhot 010018, China 2Inner Mongolia Academy of Agricultural & Animal Husbandry Sciences, Hohhot 010031, China 3Inner Mongolia Prataculture Research Center, Chinese Academy of Science, Hohhot 010031, China 4State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming 650223, China 5Department of Biology, Indiana State University, Terre Haute, IN 47809, USA 6The Center for Genomic Advocacy, Indiana State University, Terre Haute, IN 47809, USA Correspondence should be addressed to Yongsheng Bai; [email protected] and Wenguang Zhang; [email protected] Received 11 April 2016; Revised 15 July 2016; Accepted 27 July 2016 Academic Editor: Nicola Cirillo Copyright © 2016 Jianghong Wu et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Genetic networks provide new mechanistic insights into the diversity of species morphology. In this study, we have integrated the MGI, GEO, and miRNA database to analyze the genetic regulatory networks under morphology difference of integument of humans and mice. We found that the gene expression network in the skin is highly divergent between human and mouse.
    [Show full text]
  • Identification of Novel Regulatory Genes in Acetaminophen
    IDENTIFICATION OF NOVEL REGULATORY GENES IN ACETAMINOPHEN INDUCED HEPATOCYTE TOXICITY BY A GENOME-WIDE CRISPR/CAS9 SCREEN A THESIS IN Cell Biology and Biophysics and Bioinformatics Presented to the Faculty of the University of Missouri-Kansas City in partial fulfillment of the requirements for the degree DOCTOR OF PHILOSOPHY By KATHERINE ANNE SHORTT B.S, Indiana University, Bloomington, 2011 M.S, University of Missouri, Kansas City, 2014 Kansas City, Missouri 2018 © 2018 Katherine Shortt All Rights Reserved IDENTIFICATION OF NOVEL REGULATORY GENES IN ACETAMINOPHEN INDUCED HEPATOCYTE TOXICITY BY A GENOME-WIDE CRISPR/CAS9 SCREEN Katherine Anne Shortt, Candidate for the Doctor of Philosophy degree, University of Missouri-Kansas City, 2018 ABSTRACT Acetaminophen (APAP) is a commonly used analgesic responsible for over 56,000 overdose-related emergency room visits annually. A long asymptomatic period and limited treatment options result in a high rate of liver failure, generally resulting in either organ transplant or mortality. The underlying molecular mechanisms of injury are not well understood and effective therapy is limited. Identification of previously unknown genetic risk factors would provide new mechanistic insights and new therapeutic targets for APAP induced hepatocyte toxicity or liver injury. This study used a genome-wide CRISPR/Cas9 screen to evaluate genes that are protective against or cause susceptibility to APAP-induced liver injury. HuH7 human hepatocellular carcinoma cells containing CRISPR/Cas9 gene knockouts were treated with 15mM APAP for 30 minutes to 4 days. A gene expression profile was developed based on the 1) top screening hits, 2) overlap with gene expression data of APAP overdosed human patients, and 3) biological interpretation including assessment of known and suspected iii APAP-associated genes and their therapeutic potential, predicted affected biological pathways, and functionally validated candidate genes.
    [Show full text]