Tullow Draft Local Area Plan
2016-2022
July 2016
TABLE OF CONTENTS PAGE NO.
Chapter 1 Review Context 1
1.1 Introduction 1.2 Form and Content of the Local Area Plan 1.3 Strategic Environmental Assessment 1.4 Appropriate Assessment 1.5 Strategic Flood Risk Assessment (SFRA) 1.6 Public Consultation
Chapter 2 Tullow in Context 5
2.1 Introduction 2.2 History and Evolution 2.3 Town Function and Role 2.3.1 Population 2.3.2 Household Size and Profile 2.3.3 Age Profile 2.3.4 Residential Profile and Unit Target 2.3.5 Economy 2.3.6 Town Centre 2.3.7 Movement and Access 2.3.8 Environment, Social and Community 2.3.9 Education 2.3.10 Water and Wastewater 2.4 Conclusion
Chapter 3 Vision and Development Strategy Tullow 15
3.1 The Vision for Tullow 3.2 Strategic Objectives and Priorities 3.2.1 Strategic Objective No. 1 3.2.2 Strategic Objective No. 2 3.2.3 Strategic Objective No. 3 3.3 Conclusion
Chapter 4 Economic Development 21
4.1 Introduction 4.1.1 Employment Profile 4.1.2 Strengths of Location in Tullow 4.2 Challenges 4.3 Strategic Approach 4.4 Policies and Objectives 4.4.1 Enterprise and Industry 4.4.2 Location of Employment lands in Tullow 4.4.3 Economic Policies for Tullow 4.4.4 Retail 4.5 Brownfield / Derelict / Vacant / Underutilised Sites 4.5.1 Town Centre Opportunity Sites 4.6 Rural and Agricultural Development
i
Chapter 5 Housing and Sustainable Neighbourhoods 33
5.1 Introduction 5.2 Challenges 5.3 Strategic Approach 5.4 Policies and Objectives 5.4.1 Compliance with Core Strategy 5.4.2 Sustainable Residential Areas 5.4.3 Sustainable Building Design 5.4.4 Quality Housing for All 5.4.5 Good Property Management 5.4.6 Unfinished Estates 5.4.7 Apartment Living 5.4.8 Demolition and Reuse 5.4.9 Social and Affordable Housing 5.4.10 Social Inclusion and Regeneration
Chapter 6 Town Centre, Landscape and Public Realm 43
6.1 Introduction 6.2 Challenges 6.3 Strategic Approach 6.4 Character Areas 6.5 Land Use and Function 6.6 Landscape 6.7 Streets and Movement 6.8 Public Spaces and Public Realm 6.9 Projects 6.10 Guidelines for Future Development
Chapter 7 Transportation and Movement 61
7.1 Introduction 7.2 Challenges 7.3 Strategic Approach 7.4 Smarter Travel 7.5 Transport Infrastructure 7.6 Public Transport 7.7 Traffic Management and Parking
Chapter 8 Community, Social and Recreational Development 65
8.1 Introduction 8.2 Challenges 8.3 Strategic Approach 8.4 Community Facilities 8.5 Educational Facilities 8.6 Sports, Recreation and Play 8.7 Recreational Potential of the River Slaney
ii
Chapter 9 Utilities Infrastructure, Climate Change and Environmental Management 71
9.1 Introduction 9.2 Challenges 9.3 Strategic Approach 9.4 Policies and Objectives 9.4.1 Water Supply and Quality 9.4.2 Wastewater 9.4.3 Flooding 9.4.4 Climate Change 9.4.5 Waste Management 9.4.6 Energy and Communications 9.4.7 Noise / Air / Light Pollution
Chapter 10 Built and Natural Heritage 81
10.1 Introduction 10.2 Challenges 10.3 Strategic Approach 10.4 Architectural Heritage 10.4.1 Record of Protected Structures 10.4.2 Archaeological Heritage 10.4.3 Cultural Heritage 10.5 Natural Heritage 10.5.1 European Directives, Natura 2000 Network and Biodiversity 10.5.2 European and National Designated Protected Species 10.5.3 Green Infrastructure 10.5.4 Trees, Hedgerows, Woodlands and Non-Designated Habitats and Species 10.5.5 Invasive and Non-Native Species 10.6 Built and Natural Heritage Objectives
Chapter 11 Tourism 99
11.1 Introduction 11.2 Challenges 11.3 Strategic Approach 11.4 Sustainable Tourism 11.5 Natural Amenities 11.6 Cultural Tourism 11.6.1 Indigenous Food, Drink and Crafts 11.7 Recreational Amenities 11.8 Tourism Policies and Objectives
Chapter 12 Landuse Zoning Objectives 105
12.1 Land Use Zoning Objectives 12.2 Zoning Matrix 12.2.1 Application of Zoning Policy 12.2.2 Definition of Terms
iii
Appendices
Appendix 1 Strategic Environmental Assessment Appendix 2 Appropriate Assessment Appendix 3 Strategic Flood Risk Assessment Appendix 4 List of Civic and Community Facilities in Tullow
Figures
Figure 1 Graphic Recording of Public Consultation Event Figure 2 Aerial Photograph Tullow Figure 3 Tullow Urban and Rural Environs Population 1981 – 2011 Figure 4 Household Size Figure 5 Tullow and National Age Profile (%) Figure 6 Tullow Social Class Figure 7 View to south of bridge in Tullow Figure 8 Indicative Transformation of view to south of bridge in Tullow Figure 9 View of Market Square Figure 10 Indicative Transformation of Market Square Figure 11 View of southern bank of River Slaney (opposite Supervalu Carpark) Figure 12 Indicative Transformation of southern bank of River Slaney (opposite Supervalu Carpark) Figure 13 Tullow Castle
Tables
Table 1 Tullow Population 1981 – 2011 Table 2 Tullow Household Size and Profile Table 3 Tullow Age Profile Table 4 Tullow Housing Unit Targets 2016 – 2022 Table 5 Tullow Social Class Table 6 Profile of existing schools in Tullow Table 7 Population aged 15 and over by Principle Economic Status and Sex Table 8 Daytime working population Tullow Table 9 Unit Potential Undeveloped Residential Zoned Land Phase 1 Table 10 Profile of existing schools in Tullow Table 11 Record of Protected Structures in Tullow Table 12 Specific Land Use Zoning Objectives Table 13 Land Use Zoning Matrix
Maps
Map 1 1839 OSI Ordnance Survey Map Map 2 1910 OSI Ordnance Survey Map Map 3 Tullow Core Retail Area Map 4 Tullow Town Centre Opportunity Sites Map 5 Residential Sites Map 6 Tullow Character Areas Map 7 Tullow Core Retail Area – Building Uses
iv
Map 8 Tullow Public Spaces Map 9 Protected Structures in Tullow LAP area Map 10 Protected Structures in Tullow LAP area Map 11 Recorded Monuments in Tullow LAP area Map 12 St. Patrick’s Trail Map 13 Area covered by Gorden Bennett Rally Map 14 Tullow Land Use Zoning Map Map 15 Land Use Zoning Map showing SAC boundary
v
vi
CHAPTER 1 REVIEW CONTEXT 1.1 Introduction 1.2 Form and Content of the Local Area Plan 7KH7XOORZ/RFDO$UHD3ODQ /$3 H[SLUHGLQ-XQH8QGHU6HFWLRQ 7KLVORFDODUHDSODQIRU7XOORZFRQVLVWVRI RIWKH3ODQQLQJDQG'HYHORSPHQW$FW D:ULWWHQ6WDWHPHQWDQGDODQGXVH]RQLQJ DVDPHQGHGDORFDODUHDSODQPD\ PDS,WFRPSULVHVRI&KDSWHUV EHSUHSDUHGLQUHVSHFWRIDQ\DUHDD *DHOWDFKWRUDQH[LVWLQJVXEXUERIDQ x &KDSWHUVRXWOLQHVWKHFRQWH[W XUEDQDUHDDVZHOODVDUHDVLQQHHGRI RIWKH/$3UHYLHZWKHKLVWRULFDO UHQHZDORUDUHDVOLNHO\WREHVXEMHFWWR GHYHORSPHQWRI7XOORZWKH ODUJHVFDOHGHYHORSPHQW H[LVWLQJSURILOHRIWKHWRZQ WRJHWKHUZLWKWKHYLVLRQDQG $PDQGDWRU\/$3LVUHTXLUHGLQUHVSHFWRI VWUDWHJLFREMHFWLYHVIRUWKHIXWXUH DQDUHDZKLFK GHYHORSPHQWRIWKHDUHD x LVGHVLJQDWHGDVDWRZQLQWKHPRVW x &KDSWHUVDGGUHVVNH\ UHFHQWFHQVXVRISRSXODWLRQRWKHUWKDQ GHYHORSPHQWREMHFWLYHVLQFOXGLQJ DWRZQGHVLJQDWHGDVDVXEXUERU HFRQRPLFGHYHORSPHQWKRXVLQJ HQYLURQVLQWKDWFHQVXV LQIUDVWUXFWXUHFRPPXQLW\IDFLOLWLHV QDWXUDODQGEXLOWKHULWDJHWRXULVP x KDVDSRSXODWLRQLQH[FHVVRI WRZQFHQWUHDQGSXEOLFUHDOP DQG SULQFLSOHV x LVVLWXDWHGZLWKLQWKHIXQFWLRQDODUHDRI x &KDSWHUDGGUHVVHVODQGXVH DSODQQLQJDXWKRULW\ZKLFKLVDFRXQW\ ]RQLQJREMHFWLYHV FRXQFLO 7KH:ULWWHQ6WDWHPHQWVKDOOWDNH 7XOORZLVEHORZWKHSRSXODWLRQWKUHVKROG SUHFHGHQFHRYHUWKHPDSVKRXOGDQ\ IRUDPDQGDWRU\/$3 UHFRUGHGDV LQ GLVFUHSDQF\DULVHEHWZHHQWKHP,QWKHIXOO &62 ,WLVKRZHYHURQHRIWKHNH\ LQWHUSUHWDWLRQRIDOOREMHFWLYHVIRU7XOORZLW XUEDQVHWWOHPHQWVLQWKHFRXQW\ LVHVVHQWLDOWKDWERWKWKH&RXQW\ GHVLJQDWHGDVDGLVWULFWWRZQLQWKH6RXWK 'HYHORSPHQW3ODQDQGWKH/RFDO$UHD (DVWHUQ5HJLRQDO3ODQQLQJ*XLGHOLQHV 3ODQDUHUHDGLQWDQGHP:KHUHFRQIOLFWLQJ DQGWKH&DUORZ&RXQW\ REMHFWLYHVDULVHEHWZHHQWKH&DUORZ 'HYHORSPHQW3ODQZLWKDQ &RXQW\'HYHORSPHQW3ODQDQGWKH/RFDO RYHUDOOREMHFWLYHWRIDFLOLWDWHGHYHORSPHQW $UHD3ODQWKHREMHFWLYHVRIWKH&RXQW\ LQDVHOIVXIILFLHQWPDQQHU'HYHORSPHQW 'HYHORSPHQW3ODQVKDOOWDNHSUHFHGHQFH VKRXOGLQFRUSRUDWHHPSOR\PHQWDFWLYLWLHV 7KHJHQHUDOGHYHORSPHQWPDQDJHPHQW VXIILFLHQWVHUYLFHVDQGVRFLDODQG VWDQGDUGVDSSOLFDEOHWRWKHORFDODUHDSODQ FRPPXQLW\IDFLOLWLHVLQWDQGHPZLWK DUHDDUHLQFOXGHGLQWKH&RXQW\ QHFHVVDU\LPSURYHPHQWVLQSK\VLFDO 'HYHORSPHQW3ODQ2QO\VSHFLILF LQIUDVWUXFWXUHDQGSXEOLFWUDQVSRUW REMHFWLYHVDSSOLFDEOHWR7XOORZDUH LQFOXGHGLQWKH/RFDO$UHD3ODQ 7KHSHULRGRIWKLVSODQVKDOOEHWDNHQDV EHLQJVL[\HDUVIURPWKHGDWHRILWV DGRSWLRQRUXQWLOLWLVUHYLHZHGRUDQRWKHU 1.3 Strategic Environmental SODQPDGHXQOHVVLWLVH[WHQGHGXQGHU Assessment 6HFWLRQ G RIWKH3ODQQLQJDQG 'HYHORSPHQW$FWDVDPHQGHG 6WUDWHJLF(QYLURQPHQWDO$VVHVVPHQW 6($ LVWKHIRUPDOV\VWHPDWLFHYDOXDWLRQ RIWKHOLNHO\VLJQLILFDQWHQYLURQPHQWDO HIIHFWVRILPSOHPHQWLQJDSODQRU SURJUDPPHEHIRUHDGHFLVLRQLVPDGHWR DGRSWWKHSODQRUSURJUDPPH7KH6($ 'LUHFWLYH (& ZDVWUDQVSRVHG LQWR,ULVK/DZWKURXJKWKH(XURSHDQ &RPPXQLWLHV (QYLURQPHQWDO$VVHVVPHQW
Tullow Draft LAP 2016-2022 - 1 -
RI&HUWDLQ3ODQVDQG3URJUDPPHV 1.4 Appropriate Assessment 5HJXODWLRQV 6,1RRI DV DPHQGHGE\WKH(XURSHDQ&RPPXQLWLHV 7KHSXUSRVHRIFDUU\LQJRXWDQ (QYLURQPHQWDO$VVHVVPHQWRI&HUWDLQ $SSURSULDWH$VVHVVPHQW $$ RIODQGXVH 3ODQVDQG3URJUDPPHV $PHQGPHQW SODQVLVWRHQVXUHWKDWSURWHFWLRQRIWKH 5HJXODWLRQV 6,1RRI LQWHJULW\RI(XURSHDQVLWHVLVDSDUWRIWKH DQGWKH3ODQQLQJDQG'HYHORSPHQW SODQQLQJSURFHVVDWDUHJLRQDODQGORFDO 6WUDWHJLF(QYLURQPHQWDO$VVHVVPHQW OHYHO7KHUHTXLUHPHQWIRU$$RISODQVRU 5HJXODWLRQV 6,1RRI DV SURMHFWVLVRXWOLQHGLQ$UWLFOH DQG DPHQGHGE\WKH3ODQQLQJDQG RIWKH(XURSHDQ&RPPXQLWLHV 'HYHORSPHQW 6WUDWHJLF(QYLURQPHQWDO &RXQFLO'LUHFWLYH ((&RQWKH $VVHVVPHQW $PHQGPHQW 5HJXODWLRQV FRQVHUYDWLRQRIQDWXUDOKDELWDWVDQGRIZLOG 6,1RRI IDXQDDQGIORUD ³+DELWDWV'LUHFWLYH´ /RFDO$UHD3ODQVDUHVFUHHQHGIRUDQ\ &DUORZ&RXQW\&RXQFLOGHWHUPLQHGWKDW SRWHQWLDOLPSDFWRQDUHDVGHVLJQDWHGDV WKH/$3ZRXOG±LIXQPLWLJDWHGEHOLNHO\WR 1DWXUDVLWHV,QDQ\FDVHZKHUH UHVXOWLQVLJQLILFDQWHQYLURQPHQWDOHIIHFWV± IROORZLQJVFUHHQLQJLWLVIRXQGWKDWWKH WKXVQHFHVVLWDWHVWKHXQGHUWDNLQJRI6($ SODQPD\KDYHDQLPSDFWDIXOO 7KH6($LVEHLQJSUHSDUHGLQSDUDOOHOWR µDSSURSULDWHDVVHVVPHQW¶PXVWEHFDUULHG WKLV/$3LQIRUPLQJWKHSODQPDNLQJ RXW SURFHVVRIWKHOLNHO\HQYLURQPHQWDO LPSDFWVRIDOWHUQDWLYHDFWLRQVDQG +DYLQJUHJDUGWRWKHSUHVHQFHRIWKH5LYHU FRQWULEXWHVWRWKHLQWHJUDWLRQRI 6ODQH\F6$&ZLWKLQWKH/$3ERXQGDU\WKH HQYLURQPHQWDOFRQVLGHUDWLRQVLQWRWKH/$3 SRWHQWLDOLPSDFWVFDQQRWEHVFUHHQHGRXW PDNLQJSURFHVV DQGDFFRUGLQJO\WKLVGUDIW/$3KDVEHHQ LQIRUPHGE\D6WDJH$SSURSULDWH ,QDFFRUGDQFHZLWK$UWLFOH'RIWKH $VVHVVPHQWZKLFKDFFRPSDQLHVWKLVGUDIW 3ODQQLQJDQG'HYHORSPHQW 6WUDWHJLF /$3 (QYLURQPHQWDO$VVHVVPHQW 5HJXODWLRQV D6FRSLQJ$VVHVVPHQWZDV 1.5 Strategic Flood Risk SUHSDUHGIRUWKH7XOORZ/RFDO$UHD3ODQ Assessment (SFRA) DQGVHQWWRWKH(QYLURQPHQWDO$XWKRULWLHV 7KHILQGLQJVRIWKH6($DUHVHWRXWLQWKH 8QGHU6HFWLRQRIWKH3ODQQLQJDQG (QYLURQPHQWDO5HSRUWZKLFKZKLOH 'HYHORSPHQW$FWDVDPHQGHG FRQVWLWXWLQJSDUWRIWKH/$3 VWDWXWRU\JXLGHOLQHVHQWLWOHG³7KH3ODQQLQJ GRFXPHQWDWLRQLVSUHVHQWHGDVDVHSDUDWH 6\VWHPDQG)ORRG5LVN0DQDJHPHQW GRFXPHQW7KH(QYLURQPHQWDO5HSRUWZDV *XLGHOLQHVIRU3ODQQLQJ$XWKRULWLHV´ZHUH SUHSDUHGLQFRQMXQFWLRQZLWKWKH SXEOLVKHGE\WKH'R(+/* 1RYHPEHU SUHSDUDWLRQRIWKH/$3DQGWKH/$3KDV 7KHVHJXLGHOLQHVUHTXLUHSODQQLQJ EHHQLQIRUPHGE\WKHHQYLURQPHQWDO DXWKRULWLHVWRLQWURGXFHIORRGULVN FRQVLGHUDWLRQVRIWKH(QYLURQPHQWDO DVVHVVPHQWDVDQLQWHJUDODQGOHDGLQJ 5HSRUW7KHOLNHO\HQYLURQPHQWDOHIIHFWVRI HOHPHQWRIWKHSODQPDNLQJSURFHVV WKH/$3 DQGWKHDOWHUQDWLYHGHYHORSPHQW VFHQDULRVFRQVLGHUHG DUHSUHGLFWHGLQWKH 7KH7XOORZDUHDZDVDVVHVVHGIRUULVNRI (QYLURQPHQWDO5HSRUWDQGWKHLU IORRGLQJLQOLQHZLWKWKHVWDQGDUGVDQG VLJQLILFDQFHLVHYDOXDWHGZLWKUHIHUHQFHWR UHFRPPHQGDWLRQVRIWKH)ORRG5LVN WKHDUHD¶VHQYLURQPHQWDOEDVHOLQH7KH *XLGHOLQHV&HUWDLQODQGVZLWKLQWKH/$3 (QYLURQPHQWDO5HSRUWWKHUHIRUHSURYLGHVD ERXQGDU\ZHUHUH]RQHGWRZDWHU FOHDUXQGHUVWDQGLQJRIWKHOLNHO\ FRPSDWLEOHXVHVZKLOHRWKHUVKDYHEHHQ HQYLURQPHQWDOFRQVHTXHQFHVRIGHFLVLRQV LGHQWLILHGZKLFKZLOOUHTXLUHWKHVXEPLVVLRQ UHJDUGLQJWKHORFDWLRQRIGHYHORSPHQWLQ RIVLWHVSHFLILFIORRGULVNDVVHVVPHQWV WKH/$3DUHD7KHPLWLJDWLRQPHDVXUHV DSSURSULDWHWRWKHW\SHDQGVFDOHRI QHHGHGWRRIIVHWWKHSRWHQWLDODGYHUVH GHYHORSPHQWVEHLQJSURSRVHG,QWKHFDVH HIIHFWVRIWKH/$3DQGIXWXUHPRQLWRULQJ RIGHYHORSPHQWDWDSSURSULDWHODQGV SURSRVDOVKDYHEHHQWUDQVSRVHGIURPWKH ZKLFKPD\EHOLDEOHWRIORRGLQJDVLWH (QYLURQPHQWDO5HSRUWLQWRWKH/$3 VSHFLILFDVVHVVPHQWZLOOEHFDUULHGRXWDW HDFKORFDWLRQ7KLVDVVHVVPHQWZLOO LQFOXGH D PHDVXUHVWRHOLPLQDWHULVNRI IORRGLQJDWWKHSDUWLFXODUGHYHORSPHQWDQG E ZKLFKZLOOQRWLQFUHDVHWKHULVNRI
Tullow Draft LAP 2016-2022 - 2 -
IORRGLQJDWRWKHUORFDWLRQV(DFK $WDUJHWHGSXEOLFFRQVXOWDWLRQHYHQWZDV DSSOLFDWLRQZLOOEHFRQVLGHUHGRQLWV DOVRIDFLOLWDWHGLQ7XOORZRQ7KXUVGD\ WK SDUWLFXODUPHULWV7KLV/$3DOVRVHWVRXW 0D\$WRWDORIDWWHQGHHV JHQHUDOSROLF\UHTXLUHPHQWVFRQWDLQHGLQ FRQWULEXWHGLQDPHDQLQJIXOZD\WRWKH WKHJXLGHOLQHVWRLQIRUPVWUDWHJLFODQGXVH SUHSDUDWLRQRIWKLVGUDIW/$3 GHFLVLRQVZLWKWKHSXUSRVHRIHQVXULQJWKDW IORRGULVNPDQDJHPHQWLVIXOO\LQWHJUDWHG 7KLV'UDIW/RFDO$UHD3ODQ /$3 ZLOOEH LQWRWKH/$3 SODFHGRQSXEOLFGLVSOD\IRUDSHULRGRIVL[ ZHHNV6XEPLVVLRQVDUHLQYLWHGIURP 1.6 Public Consultation VWDWXWRU\ERGLHVFRPPXQLW\JURXSV UHVLGHQW¶VJURXSVODQGRZQHUVHWFDQG WKHVHZLOOEHFRQVLGHUHGDVSDUWRIWKH 7KHSUHSDUDWLRQRIWKLVGUDIW/$3LQFOXGHG IXUWKHUFRQVLGHUDWLRQRIWKHILQDOLVDWLRQRI SUHGUDIWFRQVXOWDWLRQZLWKWKHORFDO WKH7XOORZ/RFDO$UHD3ODQ FRPPXQLW\JURXSVLQIUDVWUXFWXUH SURYLGHUVVHFWRUDOJURXSVVWDWXWRU\ 6XEPLVVLRQDQGREVHUYDWLRQVDUHLQYLWHG DJHQFLHVDQGDGMRLQLQJORFDODXWKRULWLHV EHWZHHQ:HGQHVGD\WK-XO\DQG 7KHSUHGUDIWSXEOLFFRQVXOWDWLRQH[WHQGHG SPRQ:HGQHVGD\WK6HSWHPEHU RYHUDIRXUZHHNSHULRGZLWKWKHODXQFKRI DEDFNJURXQG,VVXHVSDSHU7KH EDFNJURXQG,VVXHV3DSHULGHQWLILHGWKH 6XEPLVVLRQVREVHUYDWLRQVVKRXOGVWDWH NH\SODQQLQJLVVXHVWKDWWKH/$3FRXOG WKHQDPHRIWKHSHUVRQRUJDQLVDWLRQDQG DGGUHVVDQGLWZDVPDGHDYDLODEOHDWD EHPDGHLQZULWLQJWR7KH)RUZDUG QXPEHURIORFDWLRQVLQWKH&RXQW\ 3ODQQLQJ6HFWLRQ3ODQQLQJ'HSDUWPHQW LQFOXGLQJ7XOORZ&LYLF2IILFHV&DUORZ &DUORZ&RXQW\&RXQFLO$WK\5RDG &RXQW\&RXQFLORIILFHVDQGRQOLQHDW &DUORZRUE\HPDLOWR/$3#FDUORZFRFRLH ZZZFDUORZLH $WRWDORIVXEPLVVLRQVZHUHUHFHLYHG IURPVWDWXWRU\ERGLHVDQGIURPDSULYDWH ODQGRZQHU7KHFRQWHQWVRIWKHVH VXEPLVVLRQVZHUHWDNHQLQWRDFFRXQW ZKHQIRUPXODWLQJWKLVGUDIWORFDODUHDSODQ
)LJ *UDSKLF5HFRUGLQJRI3XEOLF&RQVXOWDWLRQ(YHQW
Tullow Draft LAP 2016-2022 - 3 -
Tullow Draft LAP 2016-2022 - 4 -
CHAPTER 2 TULLOW TOWN IN CONTEXT
2.1 Introduction VRXWKRI%DOWLQJODVVYLDWKH1DQGLV DSSUR[LPDWHO\NPWRWKHVRXWKZHVWRI 7XOORZLVDQLPSRUWDQWXUEDQFHQWUH 'XEOLQDORQJWKH57KH0 LVORFDWHG ORFDWHGRQWKH5LYHU6ODQH\LQWKHQRUWK DSSUR[LPDWHO\NPWRWKHZHVWRI7XOORZ HDVWRIWKHFRXQW\DPLGVWDULFKIHUWLOH DQGLVDFFHVVHGYLDWKH1DQG1 DJULFXOWXUDOKLQWHUODQG7KHWRZQSURYLGHV 7XOORZLVDOVRVHUYHGE\WKH5UHJLRQDO DUDQJHRIUHVLGHQWLDOFRPPXQLW\ URDGOLQNLQJ*RUH\WR&DUORZ FRPPHUFLDODQGHPSOR\PHQWIXQFWLRQV 7KHWRZQLVVLWHGWRWKHHDVWDQGZHVWRI 7XOORZLVORFDWHGDSSUR[LPDWHO\NPWR WKH5LYHU6ODQH\'HYHORSPHQWLQUHFHQW WKHVRXWKHDVWRI&DUORZWRZQYLDWKH \HDUVKDVWDNHQSODFHODUJHO\RQWKH 57XOORZLVDSSUR[LPDWHO\NPWRWKH SHULSKHU\RIWKHWRZQ
)LJ $HULDO3KRWRJUDSK7XOORZ
Tullow Draft LAP 2016-2022 - 5 -
2.2 History and Evolution 7XOORZ 7XODFK2¶%KIHLGKOLPWKHKLOORIWKH WKHUHPRYDORILQGXVWU\WRWKHHGJHRIWKH 2¶%KIHLGKOLPWHUULWRU\ LVVLWXDWHGRQWKH WRZQ7KHHVWDEOLVKPHQWRI0RXQW 5LYHU6ODQH\,WLVDPDUNHWWRZQZLWKD :ROVHOH\ZKLFKLQFOXGHVH[WHQVLYHJROILQJ JRRGDJULFXOWXUDOKLQWHUODQG DQGOHLVXUHIDFLOLWLHVDORQJZLWKYDU\LQJ 7XOORZLVRQHRIILYHVHWWOHPHQWVLQ&DUORZ DFFRPPRGDWLRQQHHGVKDVERRVWHGWKH RULJLQDWLQJIURP$QJOR1RUPDQ7LPHV ORFDOHFRQRP\ 7KHWRZQGHFOLQHGLQVL]HGXULQJWKHODWHU 7KHFRPSOHWLRQRIWKH0 SURYLGLQJHDVH 0LGGOH$JHVEXWZLWKWKHUHYLYDORI RIDFFHVVWR'XEOLQJDYHULVHWRVLJQLILFDQW (QJOLVKLQIOXHQFHLQ,UHODQGGXULQJWKH GHPDQGIRUKRXVLQJLQWKHWRZQZKLFKOHG VL[WHHQWKDQGVHYHQWHHQWKFHQWXULHVWKH WRVXEVWDQWLDOSRSXODWLRQJURZWKZLWKD WRZQWRRNRQDQHZSURVSHULW\DQGPXFK LQFUHDVHLQSRSXODWLRQEHWZHHQ RILWVSUHVHQWOD\RXWSDUWLFXODUO\DURXQG 2YHURQHWKLUGRIWKHUHVLGHQWLDO 0DUNHW6TXDUHRULJLQDWHGIURPWKDWWLPH XQLWVEXLOWLQ7XOORZWRRNSODFHEHWZHHQ 7KHHFRQRPLFGRZQWXUQZKLFK 7KHILUVWVWRQHEULGJHDFURVVWKH6ODQH\LQ IROORZHGVLJQLILFDQWO\LPSDFWHGRQWKH 7XOORZZDVEXLOWDVODWHDV7KDWILUVW GHPDQGIRUKRXVLQJLQ7XOORZUHVXOWLQJLQ ILYHVSDQVWUXFWXUHZLGHHQRXJKWRWDNHD DQXPEHURIXQILQLVKHGHVWDWHVLQWKH KRUVHDQGFDUWZDVVXEVHTXHQWO\GRXEOHG WRZQ 7XOORZWRZQKDVDOWHUHGLQPRUHUHFHQW WLPHVZLWKWKHLQWURGXFWLRQRI7XOORZ,QQHU 5HOLHI5RDGSURPRWLQJULYHUVLGH GHYHORSPHQWWKHFRQVWUXFWLRQRILQILOO KRXVLQJVFKHPHVRII%DUUDFN6WUHHWDQG
Tullow Draft LAP 2016-2022 - 6 -
0DS 26,2UGQDQFH6XUYH\0DS
0DS 26,2UGQDQFH6XUYH\0DS
Tullow Draft LAP 2016-2022 - 7 -
2.3 Town Function and Role VXIILFLHQWLQIUDVWUXFWXUHDQGORFDOVHUYLFHV WRFDWHUIRUWKLVJURZWK 7XOORZ LQDGGLWLRQWRQLQHRWKHUWRZQVLQ WKH6RXWK(DVW5HJLRQ LVLGHQWLILHGDVD 2.3.1 Population GLVWULFWWRZQEHLQJWDUJHWHGIRUJURZWK,W KDVZHOOGHYHORSHGVHUYLFHVDQG 7XOORZUHFRUGHGDSRSXODWLRQRI LQ FRPPXQLW\IDFLOLWLHVDQGKDVWKHFDSDFLW\ WKHFHQVXVUHSUHVHQWLQJD WRDFFRPPRGDWHDGGLWLRQDOJURZWK LQFUHDVHRQWKHSRSXODWLRQILJXUH,Q VXEMHFWWRFHUWDLQSK\VLFDOLQIUDVWUXFWXUDO 7XOORZKDGDSRSXODWLRQRI LQYHVWPHQWV ,WLVUHFRJQLVHGDVKDYLQJ SHUVRQVUHSUHVHQWLQJDLQFUHDVH WKHSRWHQWLDOWRSHUIRUPDQLPSRUWDQWUROH IURPLWVFHQVXVSRSXODWLRQ7DEOH LQGULYLQJWKHGHYHORSPHQWRIDSDUWLFXODU DQG)LJXUHVKRZVKRZWKHWRZQ¶V VSDWLDOFRPSRQHQWRIWKHRYHUDOOUHJLRQ SRSXODWLRQKDVIOXFWXDWHGRYHUWKH LQWHUFHQVDOSHULRGVZLWKDVLJQLILFDQW 7KHIROORZLQJVHFWLRQSURYLGHVD GHFUHDVHH[SHULHQFHGEHWZHHQ DQG GHPRJUDSKLFDQGHFRQRPLFRYHUYLHZRI 7KHSHULRGUHSUHVHQWHG 7XOORZ7KLVLQIRUPDWLRQLVUHTXLUHGLQ WKHPRVWVLJQLILFDQWLQFUHDVHLQSRSXODWLRQ RUGHUIRUWKLVSODQWRFDWHUIRUWKHIXWXUH JURZWKRYHUWKHSHULRG /HYHOV VXVWDLQDEOHJURZWKRIWKHWRZQ/HYHOVRI RIJURZWKRYHUWKHSHULRGZHUH JURZWKLQ7XOORZZLOOEHPDQDJHGLQOLQH VLJQLILFDQWO\DERYHWKHFRXQW\DQGQDWLRQDO ZLWKWKH&RUH6WUDWHJ\FRQWDLQHGLQWKH DYHUDJH &DUORZ&RXQW\'HYHORSPHQW3ODQ± WRJHWKHUZLWKWKHDELOLW\WRSURYLGH
3RSXODWLRQ&KDQJH 3RSXODWLRQ&KDQJH &HQVXV 3RSXODWLRQ 3RSXODWLRQ 7XOORZ &DUORZ &KDQJH1DWLRQDOO\
7DEOH )LJ±7XOORZ3RSXODWLRQ &HQVXV
Tullow Draft LAP 2016-2022 - 8 -
2.3.2 Household Size and Profile
7KHWRWDOKRXVLQJVWRFNLQ7XOORZLQ FHQVXVZDVZLWKUHFRUGHGDV XQRFFXSLHG7KHWRZQ¶VDYHUDJH KRXVHKROGVL]HRISHUVRQVLVORZHU WKDQERWKWKHFRXQW\DYHUDJHRI SHUVRQVDQGWKHQDWLRQDODYHUDJHRI SHUVRQV$EUHDNGRZQRIWKHKRXVHKROG XQLWVL]HVKRZV7XOORZLVSUHGRPLQDQWO\ PDGHXSRIVPDOOHUKRXVHKROGVZLWKRYHU PDGHXSRIVPDOOHUKRXVHKROGVL]HV RIEHWZHHQRQHDQGWKUHHSHUVRQ KRXVHKROGV +RXVHKROGVL]H SHUVRQ SHUVRQV SHUVRQV SHUVRQV SHUVRQV 7RWDO SHUVRQV
7RWDO1RRI +RXVHKROGV RI7RWDO +RXVHKROGV 1DWLRQDO$YHUDJH 7DEOH 7XOORZ+RXVHKROG6L]HDQG3URILOH &HQVXV
)LJ +RXVHKROG6L]H &HQVXV
Tullow Draft LAP 2016-2022 - 9 -
2.3.3 Age Profile
7KH&HQVXVUHYHDOVWKDW7XOORZKDV DSRSXODWLRQSURILOHZKLFKLVFRPSDUDEOH ZLWKWKHQDWLRQDODYHUDJHRIWKH WRZQ¶VSRSXODWLRQLVDJHGOHVVWKDQ \HDUVZLWKDJHGEHWZHHQDQG \HDUV7KH&HQVXVDOVRUHYHDOHG WKDWWKHSHUFHQWDJHRISRSXODWLRQRYHU \HDUVRIDJHZDVVOLJKWO\EHORZWKH QDWLRQDODYHUDJH
$JHEUDFNHW 3RSXODWLRQ RI7RWDO3RSXODWLRQ 1DWLRQDO$YHUDJH
7DEOH 7XOORZ$JH3URILOH &HQVXV
)LJ 7XOORZDQG1DWLRQDO$JH3URILOH &HQVXV
Tullow Draft LAP 2016-2022 - 10 -
2.3.4 Residential Profile and Unit Target 7LPHIUDPH 8QLW %DVLVRI&DOFXODWLRQ 7DUJHW 5HVLGHQWLDOVFKHPHVLQ7XOORZDUH FRQFHQWUDWHGDORQJWKHDSSURDFKURDGV RIWKHRYHUDOOFRXQW\ LQWRWKHWRZQEHLQJPRVWKHDYLO\ XQLWWDUJHWIRU FRQFHQWUDWHGDORQJWKH6KLOOHODJK5RDG EHLQJ 17XOORZ+LOOWKH&DUORZ5RDGDQG &DVWOHGHUPRW5RDG5HVLGHQWLDOW\SRORJLHV &RXQW\&DUORZ3RS7DUJHW ZLWKLQWKHWRZQFRQVLVWRIWUDGLWLRQDOWRZQ SRS KRXVHVPRUHUHFHQWDSDUWPHQW LQFUHDVHRIDQQXP EHWZHHQ GHYHORSPHQWVDQGORZGHQVLW\GHWDFKHG $SSOLHGWR DQGVHPLGHWDFKHGKRXVLQJDORQJWKH DQQXPGLYLGHGE\ DSSURDFKURDGV7KHUHLVDKLJKSURSRUWLRQ DYHUDJHKRXVHKROGVL]HRI RIVRFLDOKRXVLQJXQLWVLQWKHWRZQDQG ZLWKRYHU ]RQLQJRIDSSOLHG ZKLOHWKHUHFRQWLQXHVWREHDGHPDQGIRU DGGLWLRQDO IXUWKHUVRFLDOKRXVLQJWKHSURYLVLRQRI XQLWV SULYDWHKRXVLQJWRFRPSOLPHQWDQG IDFLOLWDWHVRFLDODQGFRPPXQLW\LQWHJUDWLRQ 2YHUDOO SURYLGLQJIRUVXVWDLQDEOHFRPPXQLWLHVLVD 8QLW7DUJHW NH\REMHFWLYH 7DEOH 7XOORZ+RXVLQJ8QLW7DUJHWV ,QOLQHZLWKWKH53*VGHVLJQDWLRQRI 7XOORZDVDDistrict Town, WKHFRUH VWUDWHJ\KDVVHWRXWDKRXVLQJWDUJHWIRU &XUUHQWO\YDOLGSODQQLQJSHUPLVVLRQVIRU WKHWRZQRYHUWKHSHULRG±7KH VFKHPHVJUHDWHUWKDQXQLWVH[LVWIRU WDUJHWKDVEHHQSURMHFWHGIRUZDUGWR UHVLGHQWLDOXQLWVDWYDULRXVORFDWLRQV LQRUGHUWRFRYHUWKH/$3SODQSHULRGRI WKURXJKRXWWKHWRZQEXWJHQHUDOO\ORFDWHG 7KH/$3WDUJHWILJXUHDOVR RQWKHRXWHUHGJHRIWKHWRZQRIWKH DFFRXQWVIRUXQEXLOWUHVLGHQWLDOXQLWVZLWK SHUPLWWHGXQLWVDUHORFDWHGZLWKLQWKH YDOLGSODQQLQJSHUPLVVLRQV7DEOH 0RXQW:ROVHOH\5HVRUWFRPSOH[ VXPPDULVHVDOOWKHFDOFXODWLRQVGLVFXVVHG LQWKHUHPDLQGHURIWKLVVHFWLRQ ,WLVIXUWKHUQRWHGWKDWWKHUHDUHILYHQR XQILQLVKHGKRXVLQJVFKHPHVZLWKLQWKH 7KH&RUH6WUDWHJ\ZLWKLQWKHFXUUHQW WRZQZKLFKFRQWDLQXQLWVZKLFKDUH &RXQW\'HYHORSPHQW3ODQKDVVHWDWDUJHW EXLOWDQGXQRFFXSLHGDVRI$SULO RIQHZKRXVLQJXQLWVWREHSURYLGHG ZLWKLQ7XOORZRYHUWKHSHULRG $PRQLWRULQJPHFKDQLVPZLOOEHUHTXLUHG 7KLVHTXDWHVWRRIWKHWRWDO WRPRQLWRUWKHXSWDNHDQGFRPSOHWLRQRI UHVLGHQWLDOXQLWJURZWKWDUJHWIRUWKHHQWLUH H[LVWLQJSHUPLVVLRQVWRHQVXUHWKDWWKH FRXQW\IRUWKLVSHULRG7KH53*VKDYH IXWXUHGHYHORSPHQWRIWKHWRZQDFFRUGV IXUWKHUDOORFDWHGDSRSXODWLRQWDUJHWRI ZLWKWKHSURYLVLRQVRIWKHFRUHVWUDWHJ\ IRU&RXQW\&DUORZE\7KLV UHSUHVHQWVDSRSXODWLRQLQFUHDVHRI IURPWKHSRSXODWLRQWDUJHWRI $SSO\LQJDQDYHUDJHDOORFDWLRQSHUDQQXP WKLVDPRXQWVWRDSRSXODWLRQRISHU DQQXPEHWZHHQ7KHDOORFDWLRQ IRU7XOORZWRLVWKHUHIRUHFDOFXODWHG DVRIWKHSRSXODWLRQWDUJHW SRS DYHUDJHKRXVHKROGVL]H XQLWV ZLWKRYHU]RQLQJ DGGLWLRQDO XQLWV $GGLQJWKLVWRWKHKRXVLQJ WDUJHW JLYHVDUHYLVHGWDUJHWRI KRXVLQJXQLWVIRU7XOORZIRUWKHSHULRG 1 1RWH 1RXQLWVGHOLYHUHGLQ7KHILJXUHIRU KDVEHHQLQFRUSRUDWHGLQWRILJXUHVIRU WRHQVXUHVXIILFLHQWKRXVLQJSURYLGHGLQ DFFRUGDQFHZLWKFRUHVWUDWHJ\
Tullow Draft LAP 2016-2022 - 11 -
2.3.5 Economy 2IWKHZRUNHUVHQXPHUDWHGLQ 7XOORZZRUNHGRXWVLGHWKHDUHD7KH 7KHUHZHUH SHUVRQVDJHG\HDUV GD\WLPHZRUNLQJSRSXODWLRQLQ7XOORZZDV DQGRYHULQWKHODERXUIRUFHDQGRIWKHVH UHFRUGHGDV 2YHURIWKRVH SHUVRQVZHUHDWZRUN7KH ZRUNLQJLQ7XOORZZHUHHPSOR\HGLQ XQHPSOR\PHQWUDWHIRUWKLVDUHDZDV &RPPHUFHDQG7UDGHDQGWKH FRPSDUHGZLWKDQDWLRQDODYHUDJH 3URIHVVLRQDO6HUYLFHVVHFWRU UDWHRI SHUFHQW2IWKH SHUVRQV DJHG\HDUVDQGRYHUZKRZHUHRXWVLGH $OORWKHUJDLQIXOO\HPSOR\HGDQGVNLOOHG WKHODERXUIRUFHSHUFHQWZHUH PDQXDODUHWKHODUJHVWVRFLR±HFRQRPLF VWXGHQWVZHUHORRNLQJDIWHUWKH JURXSVZLWKLQWKHWRZQ KRPHIDPLO\DQGSHUFHQWZHUH UHWLUHG
RI7RWDO 6RFLDO&ODVV 3RSXODWLRQ 1DWLRQDO$YHUDJH 7XOORZ
3URIHVVLRQDO:RUNHUV
0DQDJHULDODQGWHFKQLFDO
1RQPDQXDO
6NLOOHG0DQXDO
6HPL6NLOOHG 8QVNLOOHG $OORWKHUVJDLQIXOO\RFFXSLHG DQGXQNQRZQ
7DEOHDQG)LJ 7XOORZ6RFLDO&ODVV &HQVXV
Tullow Draft LAP 2016-2022 - 12 -
2.3.6 Town Centre 7XOORZEHQHILWVIURPDUDQJHRIVRFLDODQG FRPPXQLW\VHUYLFHVDQGDPHQLWLHVZLWKLQ 7KHWRZQFHQWUHFRPSULVHVDWUDGLWLRQDO ZDONLQJGLVWDQFHRIWKHWRZQFHQWUH7KHVH WRZQVFDSHZLWKDQDUURZVWUHHWSDWWHUQ LQFOXGHSULPDU\DQGSRVWSULPDU\ ZKLFKOHDGVWRWKHZLGHU0DUNHW6TXDUH HGXFDWLRQDOIDFLOLWLHVOLEUDU\DKHDOWK &KXUFK6WUHHWDQG%ULGJH6WUHHW7KLV FHQWUHJDUGDVWDWLRQILUHVHUYLFHDQG FRPSULVHVWKHPDLQUHWDLOFRUHDQG FRPPXQLW\KDOO DFFRPPRGDWHVWKHPDMRULW\RIVKRSV SURIHVVLRQDOVHUYLFHVUHWDLOVHUYLFHVEDUV 7KHWRZQDOVRFRQWDLQVVRPHVLJQLILFDQW DQGUHVWDXUDQWV7KHWRZQKDVDQ DPHQLW\IDFLOLWLHVLQFOXGLQJWKHULYHUZDON DWWUDFWLYHVWUHHWVFDSHDQGDFFRPPRGDWHV DQGWKH0RXQW:ROVHOH\UHVRUW7KLV DQXPEHURIKLVWRULFDWWUDFWLRQVDQG FRPSOH[FRPSULVHVDKRWHOJROIDQGVSD EXLOGLQJVRIKLVWRULFDOPHULW2SSRUWXQLWLHV IDFLOLWLHVORFDWHGWRWKHVRXWKHDVWRI WRLPSURYHWKHYLWDOLW\DQGYLEUDQF\RIWKH 7XOORZWRZQFHQWUHDQGLVDQLPSRUWDQW WRZQFHQWUHVKRXOGEHSURPRWHG7KHUH IDFLOLW\DQGDPHQLW\IRUWKHWRZQDQG DUHFOHDURSSRUWXQLWLHVWRXSJUDGHWKH UHVLGHQWVDOLNH $PHQLWLHVDUHH[SDQGHG SXEOLFUHDOPGHYHORSIXUWKHUQLFKHUHWDLO XSRQLQ&KDSWHU DQGVHUYLFHIDFLOLWLHVZLWKLQWKHWRZQ 7KHVHLVVXHVDUHFRQVLGHUHGLQIXUWKHU 2.3.9 Education GHWDLOLQ&KDSWHU 7XOORZKDVWKUHHSULPDU\VFKRROVDQGRQH 2.3.7 Movement and Access SRVWSULPDU\VFKRROVZKLFKSURYLGH HGXFDWLRQDOIDFLOLWLHVIRUWKHWRZQDQGWKH 7XOORZLVVWUDWHJLFDOO\ORFDWHGRQWKH1 VXUURXQGLQJKLQWHUODQG :H[IRUGWR'XEOLQURXWH7KH0 LVDOVR ORFDWHGNPWRWKHZHVWRI7XOORZDQGLV 7DEOHGHWDLOVWKHQDPHVFXUUHQWDQG DFFHVVHGYLDWKH1DQGWKH17XOORZ HQUROPHQWQXPEHUVIRUWKHVHIDFLOLWLHV LVDOVRVHUYHGE\WKH5UHJLRQDOURDG (GXFDWLRQDODQGFRPPXQLW\IDFLOLWLHVDUH OLQNLQJ*RUH\WR&DUORZ FRQVLGHUHGIXUWKHULQ&KDSWHU
3ULYDWHFDULVWKHPDLQPHDQVRI 1DPH (QUROPHQW DFFHVVLELOLW\LQ7XOORZ$FRQVLGHUDEOH DPRXQWRIWKURXJKWUDIILFSDVVHVWKHWRZQ FHQWUHGDLO\7KHWUDGLWLRQDOOD\RXWRIWKH WRZQZLWKQDUURZVWUHHWVDQGWKHEULGJH 3ULPDU\ 6W&ROXPEDV RYHUWKH5LYHU6ODQH\FRQWULEXWHWRWKHVH 6FRLO3KDGUDLJ WUDIILFLVVXHV 1DRID
%XV(LUHDQQURXWHSURYLGHVDOLPLWHG 6FRLO1DLVXQWD VHUYLFHEHWZHHQ'XEOLQDQG7XOORZ 0KXLUH/RXUGHV RSHUDWLQJDSSUR[LPDWHO\WKUHHWLPHVDGD\ HDFKZD\0RQGD\WR6DWXUGD\DQGWZLFH 3RVW3ULPDU\ 7XOORZ&RPPXQLW\ 6FKRRO RQ6XQGD\3ULYDWHEXVRSHUDWRUVDOVR SURYLGHDVHUYLFHEHWZHHQ+DFNHWVWRZQ DQG&DUORZ7RZQVHUYLQJ7XOORZ DSSUR[LPDWHO\WZLFHDGD\LQHDFK 7DEOH 3URILOHRIH[LVWLQJVFKRROVLQ7XOORZ GLUHFWLRQ7KHUHLVQRWUDLQVHUYLFHWR 6RXUFH 'R(6 7XOORZWKHQHDUHVWVHUYLFHEHLQJSURYLGHG E\&DUORZWRZQ 2.3.10 Water and Wastewater
2.3.8 Environment, Social and 6LQFH-DQXDU\,ULVK:DWHULVWKH Community 6WDWH%RG\UHVSRQVLEOHIRUWKHGHOLYHU\ LQWHJUDWLRQDQGLPSOHPHQWDWLRQRIVWUDWHJLF 7KHQDWXUDODQGEXLOWHQYLURQPHQWRIWKH ZDWHUDQGZDVWHZDWHUSURMHFWVDQG WRZQDUHXQLTXHDWWULEXWHVZKLFKPXVWEH LQIUDVWUXFWXUDOLPSURYHPHQWV&DUORZ SURWHFWHG7KHSURWHFWLRQRIWKH5LYHU &RXQW\&RXQFLOQRORQJHUKDVDGLUHFWUROH 6ODQH\KDVEHHQFRQVLGHUHGLQGHWDLOLQ LQWKLVDUHD KRZHYHUWKH/RFDO$XWKRULW\ WKH6($DQG$$ZKLFKDFFRPSDQLHVWKLV ZLOOZRUNZLWK,ULVK:DWHUWRHQVXUHWKDW GUDIW3ODQ7KHQHZ/$3ZLOOFRQWULEXWH WKH/RFDO$UHD3ODQDQG:DWHU6HUYLFHV WRZDUGVWKHSURWHFWLRQRIWKHHQYLURQPHQW ,QYHVWPHQW3ODQDOLJQ
Tullow Draft LAP 2016-2022 - 13 -
&DUORZ&RXQW\&RXQFLOFRPPHQFHGSKDVH UROHLQDFFRPPRGDWLQJIXWXUHSRSXODWLRQ RIWKH7XOORZXSJUDGHLQDQG JURZWKDQGHFRQRPLFGHYHORSPHQWRIWKH FRPSOHWHGWKHVHZRUNVLQ3KDVH DUHD7KHSROLFLHVDQGREMHFWLYHVDV RIWKHSURMHFWUHFHLYHG,ULVK:DWHU FRQWDLQHGLQWKLV3ODQZLOOIDFLOLWDWHWKH DSSURYDOLQDQGLVGXHWRSURFHHGLQ SODQQHGLQWHJUDWHGHFRQRPLFDQG VXVWDLQDEOHGHYHORSPHQWRIWKHWRZQE\ EDODQFLQJWKHQHHGVRIWKHFRPPXQLW\DQG 2.4 Conclusion SUHVHUYLQJRUHQKDQFLQJWKHQDWXUDODQG EXLOWHQYLURQPHQW 7XOORZLVDQLPSRUWDQWVHUYLFHFHQWUHLQ QRUWKHDVW&DUORZDQGKDVDVLJQLILFDQW
Tullow Draft LAP 2016-2022 - 14 -
CHAPTER 3 VISION AND DEVELOPMENT STRATEGY TULLOW
3.1 The Vision for Tullow QHHGWRDWWUDFWKLJKHUOHYHOVRI HPSOR\PHQWZLWKLQWKHWRZQWKHUHE\ 7KHRYHUDOOYLVLRQIRU7XOORZLVWRHQVXUH FUHDWLQJPRUHRSSRUWXQLW\IRUUHVLGHQWVWR WKDWIXWXUHGHYHORSPHQWLVVXVWDLQDEOH UHVLGHSUR[LPDWHWRWKHLUSODFHRI 7KHGHYHORSPHQWVWUDWHJ\IRUWKHWRZQ HPSOR\PHQW7KHLPSRUWDQFHRIWKH VHHNVWRLPSURYHWKHTXDOLW\RIOLIHIRUWKH QDWXUDODPHQLWLHVRIWKHDUHDLQFOXGLQJWKH ORFDOFRPPXQLW\DQGSURYLGHIRUWKHIXWXUH 5LYHU6ODQH\DQGWKHELRGLYHUVLW\RIWKH VXVWDLQDEOHJURZWKRIWKHWRZQRYHUWKH WRZQLVRILPSRUWDQFHZKLFKLQWXUQKDV SHULRGRI\HDUVDQGEH\RQG SRWHQWLDOWRJLYHULVHWRVLJQLILFDQWEHQHILWV ZLWKLQWKHWRZQ 7KHNH\REMHFWLYHRIWKH&RXQFLOLVWR SURYLGHIRUVXVWDLQDEOHGHYHORSPHQWWKDW 7KLV/$3SURYLGHVDQRSSRUWXQLW\WRFUHDWH ZLOOHQKDQFHWKHYLWDOLW\DQGSURVSHULW\RI DYLVLRQIRUFRKHUHQWDQGVXVWDLQDEOH WKHWRZQZKLOHQRWRYHUEXUGHQLQJH[LVWLQJ GHYHORSPHQWZKLFKEHQHILWV7XOORZWRZQ VHUYLFHV DQGLWVFLWL]HQV7KLVYLVLRQLVDVWDWHPHQW RIZKDW7XOORZDVSLUHVWREHQRWLQWKHVL[ 7KH&RXQFLOUHFRJQLVHVWKDW7XOORZPXVW \HDUOLIHWLPHRIDORFDODUHDSODQEXWRYHU RIIHUOLYLQJZRUNLQJHGXFDWLRQDO WKHQH[WWR\HDUV,WLVRQO\E\ UHFUHDWLRQDODQGFXOWXUDORSSRUWXQLWLHVRI GHYHORSLQJDVKDUHGORQJWHUPYLVLRQWKDW WKHKLJKHVWVWDQGDUGLQDQDWWUDFWLYHXUEDQ ZHFDQGHOLYHUDQGVXSSRUWWKHVKRUWWHUP HQYLURQPHQW6LJQLILFDQWSRSXODWLRQJURZWK JRDOVRIVXEVHTXHQWSODQVDQGFRUH KDVRFFXUUHGLQWKHLQWHUFHQVDOSHULRGV VWUDWHJLHV EHWZHHQ±JLYLQJULVHWRWKH UHTXLUHPHQWIRUFRPPXQLW\DQGVRFLDO 7KLVORQJWHUPYLVLRQLVEDVHGRQWKH LQIUDVWUXFWXUHWRVXSSRUWDQLQFUHDVLQJ SULQFLSOHVRIVXVWDLQDEOHGHYHORSPHQWDQG SRSXODWLRQ ZLOOEHLPSOHPHQWHGE\SURYLGLQJD SODQQLQJIUDPHZRUNWRVHFXUH $NH\IRFXVIRUWKHIXWXUHGHYHORSPHQW GHYHORSPHQWWKDWEDODQFHVVRFLDO 7XOORZLVWRDGGUHVVWKHKLJKOHYHORI HFRQRPLFDQGHQYLURQPHQWDO UHVLGHQWLDOYDFDQFLHVLQWKHWRZQDQGWR FRQVLGHUDWLRQVZKLOHPLQLPLVLQJWKH HQFRXUDJHPRUHVXVWDLQDEOHFRPPXQLWLHV SRWHQWLDODGYHUVHHIIHFWVRQWKH LQWKHWRZQ7KH/$3ZLOODOVRIRFXVRQWKH HQYLURQPHQW
9LVLRQIRU7XOORZ
7RSURYLGHDIRFXVHGDSSURDFKWRSODQQLQJIRUWKHIXWXUHJURZWKRI 7XOORZLQDFRKHUHQWDQGVSDWLDOIDVKLRQZKLFKVHHNVWRGHOLYHUKLJK OHYHOVRIHPSOR\PHQWDQGEDODQFHVIXWXUHVXVWDLQDEOHGHYHORSPHQW ZLWKWKHFRQVHUYDWLRQDQGHQKDQFHPHQWRIWKHWRZQ¶VQDWXUDODQG EXLOWHQYLURQPHQW
Tullow Draft LAP 2016-2022 - 15 -
7KLV3ODQVHHNVWRHQFRXUDJHRFFXSDQF\ RIVXFKXQLWVDQGWKHFRQFHQWUDWLRQRI GHYHORSPHQWLQPRUHFHQWUDOORFDWLRQV SUR[LPDWHWRWKHWRZQFHQWUHSURYLGLQJIRU PRUHFRPSDFWVXVWDLQDEOHXUEDQ GHYHORSPHQW
SO 1.2 Creating Sustainable Neighbourhoods
7KHFUHDWLRQRIJRRGVXVWDLQDEOH QHLJKERXUKRRGVZKLFKVXSSRUWWKULYLQJ FRPPXQLWLHVDQGSURYLGHIRUDZLGHUDQJH RIKRXVHKROGW\SHVDJHJURXSVDQG WHQXUHVZLWKFRPPXQLW\IDFLOLWLHVFORVHE\ LVDSULRULW\,QRUGHUWRDFKLHYHWKLV FULWHULDDQGVWDQGDUGVIRUJRRG 3.2 Strategic Objectives and QHLJKERXUKRRGVDUHDFHQWUDOSDUWRIWKLV Priorities VWUDWHJ\7KHVHSULQFLSOHVDUHLQWHQGHGWR HQVXUHIRUH[DPSOHWKDWLQIUDVWUXFWXUH 7KHVWUDWHJLFYLVLRQRXWOLQHGDERYHDORQJ VXFKDVVFKRROVVKRSVDQGFKLOGFDUH ZLWKFRPSOLDQFHZLWKWKH&RUH6WUDWHJ\ZLOO IDFLOLWLHVDUHSURYLGHGLQDSKDVHGDQGFR SURYLGHWKHRYHUDOOVWUDWHJ\IRUWKHSURSHU RUGLQDWHGPDQQHU7KHLPSRUWDQFHRI SODQQLQJDQGVXVWDLQDEOHGHYHORSPHQWRI VKRSVZLWKLQZDONLQJGLVWDQFHRI 7XOORZ UHVLGHQWLDOGHYHORSPHQWVLVUHDIILUPHGLQ WKLVNH\VWUDWHJ\ )RUWKHSXUSRVHVRIJXLGLQJWKLVSODQWKH VWUDWHJLFYLVLRQWKHFRUHVWUDWHJ\NH\ 7KHFRXQFLOZLOOZRUNZLWKYDULRXV ILQGLQJVIURPDQDO\VLVDQGVXEPLVVLRQV VWDNHKROGHUVZKRIXQGDQGSURYLGH IURPSXEOLFFRQVXOWDWLRQFDQEHWUDQVODWHG FRPPXQLW\VHUYLFHVDQGIDFLOLWLHV LQWRWKUHHNH\RYHUDOOVWUDWHJLFREMHFWLYHV LQFOXGLQJEXWQRWOLPLWHGWRWKH'HSDUWPHQW WRHQVXUHDSSURSULDWHJURZWKUDWHVRYHU RI+HDOWKDQG&KLOGUHQWKH'HSDUWPHQWRI WKHVKRUWWRPHGLXPWHUPDFKLHYLQJD (GXFDWLRQDQG6NLOOVWKH+6(UHJLVWHUHG OHYHOZKLFKZLOOVXSSRUWFRPSHWLWLYHQHVV FKDULWLHVQRWIRUSURILWFRPSDQLHVDQG VXVWDLQDELOLW\DQGFUHDWHRSSRUWXQLWLHVIRU IRXQGDWLRQVUHOLJLRXVRUGHUVVSRUWVDQG ORFDOHFRQRPLFGHYHORSPHQW FRPPXQLW\JURXSVDQGRUJDQLVDWLRQVWR HQVXUHVRFLDODQGFRPPXQLW\ 3.2.1 Strategic Objective No. 1 LQIUDVWUXFWXUHLVSURYLGHGLQDWLPHO\ PDQQHU7KLVREMHFWLYHZLOOEHVXSSRUWHG It is an objective of Carlow County WKURXJKWKHLPSOHPHQWDWLRQRIWKHDFWLRQV Council: DULVLQJIURPWKH/RFDO(FRQRPLFDQG &RPPXQLW\3ODQ SO 1: To create vibrant integrated communities in a more consolidated urban form. SO 1.3 Providing Quality Homes SO 1.1 Achieving a more 7KHVXVWDLQDEOHPDQDJHPHQWRIODQG Consolidated Urban Form ]RQHGIRUKRXVLQJLVDFHQWUDOHOHPHQWRI WKLVSULRULW\1HZUHVLGHQWLDOGHYHORSPHQW 7XOORZH[SHULHQFHGVLJQLILFDQWGHPDQGIRU FORVHWRWKHWRZQFHQWUHZLOOEHSURPRWHG KRXVLQJGXULQJWKHERRPSHULRGODUJHO\DV ZKLFKSURYLGHVIRUDTXDOLW\FRPSDFWWRZQ DUHVXOWRIWKHH[WHQVLRQRIWKH'XEOLQ RIPL[HGWHQXUHQHLJKERXUKRRGVFDWHULQJ FRPPXWHUEHOW7KLVSUHVVXUHIRU IRUDZLGHUDQJHRIIDPLO\W\SHVDQG GHYHORSPHQWIRFXVHGRQWKHPDLQ LQGLYLGXDOV DSSURDFKURXWHVRIWKHWRZQUHVXOWLQJLQ GHYHORSPHQWH[WHQGLQJWRPRUHSHULSKHUDO 7KHSURYLVLRQRITXDOLW\KRXVLQJWKDWLV ORFDWLRQVLQWKHWRZQ7KLVSRRUO\ VWUXFWXUHGVXEXUEDQH[SDQVLRQKDV VXLWDEOHIRUDOOFLWL]HQVWKURXJKRXWWKHLU UHVXOWHGLQDVLJQLILFDQWQXPEHURIEXLOW OLYHVDQGDGDSWDEOHWRSHRSOHVFKDQJLQJ FLUFXPVWDQFHVLVIXQGDPHQWDOWRFUHDWLQJD DQGXQRFFXSLHGXQLWVWKURXJKRXWWKHWRZQ FRPSDFWWRZQZLWKVXVWDLQDEOH
Tullow Draft LAP 2016-2022 - 16 -
QHLJKERXUKRRGV5HTXLULQJUHVLGHQWLDO SULRULW\7KLVLQFRQMXQFWLRQZLWK VFKHPHVWRKDYHJRRGORFDOIDFLOLWLHVDQG RSSRUWXQLWLHVWRXSJUDGHWKHSXEOLFUHDOP HQVXULQJVFKHPHVDUHRIDQDSSURSULDWH SURYLGHVDQRSSRUWXQLW\WRGHYHORSIXUWKHU VFDOHDQGSKDVHGVRWKDWVXSSRUW QLFKHUHWDLODQGVHUYLFHIDFLOLWLHVZLWKLQWKH LQIUDVWUXFWXUHLVSURYLGHGLQWDQGHPZLWK WRZQ UHVLGHQWLDOGHYHORSPHQWZLOODVVLVWLQ DFKLHYLQJWKLVNH\VWUDWHJ\ SO 2.2 Connecting Infrastructure
3URYLGLQJTXDOLW\KRPHVIRUDOOLQFOXGHVWKH &RQQHFWLQJWKHWRZQWKURXJKVHUYLFHV SURYLVLRQRIVRFLDODQGDIIRUGDEOHKRXVLQJ LQIUDVWUXFWXUHDQGDQHWZRUNRIWUDQVSRUW 7KHGHOLYHU\RIWKHKRXVLQJVWUDWHJ\DV LQIUDVWUXFWXUHZLOOPDNHLWDFFHVVLEOHZLWK FRQWDLQHGLQWKHFXUUHQW&RXQW\ JUHDWHUOHYHOVRISHUPHDELOLW\DOORZLQJWKH 'HYHORSPHQW3ODQWRJHWKHUZLWK WRZQWRLQWHQVLI\DQGJURZ OHJLVODWLYHDPHQGPHQWVZLOOKHOSPHHWWKH QHHGVRIWKRVHRQORZHULQFRPHVDQG 0RYHPHQWDQG7UDQVSRUW WKRVHLQVSHFLDOFLUFXPVWDQFHV 2QHRIWKHNH\REMHFWLYHVRIWKLV/$3LVWR LQYHVWLJDWHWKHIHDVLELOLW\RISURYLGLQJWKH 7XOORZ5HOLHI5RDG RUSDUWVWKHUHRI WR 3.2.2 Strategic Objective No. 2 IDFLOLWDWHE\SDVVDEOHWUDIILFXVLQJWKH1 55RU57KLVLVQHFHVVDU\WR It is an objective of Carlow County UHOLHYH+*9FRQJHVWLRQRQWKHPDLQ Council: WKRURXJKIDUHSURYLGLQJIRUDVLJQLILFDQWO\ LPSURYHGTXDOLW\HQYLURQPHQW3URPRWLQJ SO 2: To create a thriving town which PRUHVXVWDLQDEOHPRGHVRIWUDQVSRUWVXFK contributes to the natural and built DVSXEOLFWUDQVSRUWZDONLQJDQGF\FOLQJ heritage amenities of the town and DUHDOVRNH\REMHFWLYHV7KH/$3VHHNVWR provides a vibrant and vital mixed-use IDFLOLWDWHVXVWDLQDEOHDFFHVVLELOLW\DQG environment. OHJLELOLW\ZLWKLQWKHWRZQFRUHDUHDLQ IDYRXURIWKHQHHGVRISHGHVWULDQVWKH SO 2.1 Facilitating a Diverse PRELOLW\LPSDLUHGDQGF\FOLVWV7KH Range of Activities FUHDWLRQRIDQHWZRUNRIVWUDWHJLFJUHHQ URXWHVZLWKLQWKHWRZQH[WHQGLQJLQWRWKH 7XOORZLVWKHPDLQUHWDLOFHQWUHIRUWKHHDVW ZLGHUKLQWHUODQGZLOOFDWHUIRUWKH RI&RXQW\&DUORZDQGVHUYHVDQH[WHQVLYH UHFUHDWLRQDOQHHGVRIWKHSRSXODWLRQDQG UHWDLOFDWFKPHQWDUHDWKDWLQFOXGHV FRQWULEXWHWRDQLPSURYHGTXDOLW\RIOLIHDV DGMRLQLQJDUHDVLQ&RXQW\:LFNORZ,WDOVR SDUWRIDFRPSDFWWRZQ SURYLGHVDUDQJHRIFRPSOHPHQWDU\XVHV VXFKDVILQDQFLDOLQVWLWXWLRQVUHVWDXUDQWV 6HUYLFHV,QIUDVWUXFWXUH DQGSXEOLFKRXVHV,WVFRUHUHWDLODUHDKDV 7KHNH\SULRULW\LQWHUPVRIVHUYLFHV EHHQGHILQHGDVSDUWRIWKH&DUORZ&RXQW\ LQIUDVWUXFWXUHLVRQDFKLHYLQJDFOHDQ 5HWDLO6WUDWHJ\ -XO\ ZKLFK KHDOWK\WRZQZLWKLPSURYHPHQWVWRDLUDQG UHFRJQLVHVWKDW7XOORZLVSHUIRUPLQJ ZDWHUTXDOLW\ELRGLYHUVLW\YDOXHDQGWKH UHODWLYHO\ZHOORIIHULQJDJRRGUDQJHRI XVHRIUHQHZDEOHHQHUJ\VRXUFHV7KHUH FRQYHQLHQFHUHWDLOPXOWLSOHV+RZHYHULWLV LVDOVRDUHTXLUHPHQWWRDGGUHVVIORRGULVN FRQVLGHUHGWKDWWKHUHLVVFRSHIRUWKH PDQDJHPHQWVWUDWHJLHVDQGVXVWDLQDEOH LPSURYHPHQWDQGH[SDQVLRQRIUHWDLO XUEDQGUDLQDJHV\VWHPVWRHQDEOHWKH IDFLOLWLHVSDUWLFXODUO\FRPSDULVRQUHWDLOLQ WRZQWRDGDSWWRFOLPDWHFKDQJH WKHWRZQFHQWUHFRUHZKLFKZRXOG UHLQIRUFHWKHUROHDQGIXQFWLRQRI7XOORZDV 7KLVHPSKDVLVRQDVXVWDLQDEOHSDWWHUQRI DVHUYLFHFHQWUH GHYHORSPHQWDQGVXVWDLQDEOH LQIUDVWUXFWXUHZLOOKHOSPLWLJDWHFOLPDWH 7KHWRZQDOVRDFFRPPRGDWHVNH\ FKDQJHSURWHFWDQGLPSURYHZDWHU FRPPXQLW\LQIUDVWUXFWXUHDQGVHUYLFHV FRXUVHVDQGHFRV\VWHPVDQGVXSSRUWWKH 7KHLPSRUWDQFHRIUHVLGHQWLDORFFXSDQF\ FUHDWLRQRIDJUHHQQHWZRUN ZLWKLQWKHWRZQFHQWUHDVRSSRVHGWR GHYHORSPHQWRQWKHSHULSKHU\LVDQ *UHHQ,QIUDVWUXFWXUH LPSRUWDQWHOHPHQWWRHQVXUHWKHYLEUDQF\ RIWKHWRZQLQWRWKHIXWXUH2SSRUWXQLWLHVWR *UHHQLQIUDVWUXFWXUHUHFUHDWLRQDQG GHYHORSWKHWRXULVPUROHRIWKHWRZQDQG ELRGLYHUVLW\DUHYLWDOFRPSRQHQWVRID VXUURXQGLQJDWWUDFWLRQVLVDOVRDNH\ FRPSDFWWRZQ7KHLUUHLQIRUFHPHQWLVD
Tullow Draft LAP 2016-2022 - 17 -
NH\SULRULW\RIWKLV/$3$JUHHQ SURPRWLQJHPSOR\PHQWDQGHQWHUSULVH LQIUDVWUXFWXUHVWUDWHJ\UHIOHFWVDQ ODQGXVHVWRSURYLGHRSSRUWXQLWLHVIRU LQWHJUDWHGDSSURDFKWRWKHWRZQ¶V 7XOORZWREHFRPHDVHOIVXVWDLQLQJWRZQ SURYLVLRQRIRSHQVSDFHUHFUHDWLRQDO ODQGVFDSHDQGELRGLYHUVLW\DVVHWV7KH 7KLVSULRULW\VHHNVWRSURPRWHVXVWDLQDEOH UHFHQWO\SXEOLVKHG+DELWDW6XUYH\DQG JURZWKRIWKHORFDOHFRQRP\E\VXSSRUWLQJ %LRGLYHUVLW\5HSRUW $XJXVW DJULFXOWXUDOUHODWHGLQGXVWULHV FRPPLVVLRQHGE\'HYHORS7XOORZ PDQXIDFWXULQJDQGRIILFHEDVHGLQGXVWULHV $VVRFLDWLRQ/LPLWHGDQG7XOORZ7LG\ HQWHUSULVHGHYHORSPHQWDQGWRXULVP 7RZQV&RPPLWWHHKDVLQIRUPHGWKH WKURXJK SUHSDUDWLRQRI&KDSWHU x 7KHGHYHORSPHQWRIPDQXIDFWXULQJ SO 2.3 Promoting Character and LQGXVWULHVDQGZDUHKRXVLQJDW Heritage DSSURSULDWHORFDWLRQV
7KHWRZQVEXLOWDQGQDWXUDOKHULWDJHPDNH x 7KHGHYHORSPHQWRIVPDOOVFDOH DVLJQLILFDQWFRQWULEXWLRQWRWKHWRZQ¶V HQWHUSULVHVDQGRIILFHEDVHG FKDUDFWHUDQGLVDXQLTXHUHVRXUFHWKDW HPSOR\PHQWDGMDFHQWWRWKHWRZQ DWWUDFWVWRXULVP7KHWRZQFHQWUHFRUH FHQWUHDQGRQDSSURSULDWHO\]RQHG DUHDLVFRQFHQWUDWHGDURXQG0DUNHW ODQG 6TXDUH&KXUFK6WUHHWDQG%ULGJH6WUHHW DQGLVJHQHUDOO\DWWUDFWLYHLQFKDUDFWHUGXH x 7KHSURPRWLRQDQGIDFLOLWDWLRQRI WRLWVWUDGLWLRQDOVWUHHWVFDSH7KH5LYHU WRXULVPEDVHGLQGXVWULHVDQGVSLQRIIV 6ODQH\DOVRSURYLGHVDQLPSRUWDQWQDWXUDO DULVLQJIURPVDPH UHVRXUFHDVZHOODVELRGLYHUVLW\IRUWKH WRZQDQGLWVUHVLGHQWV 7KHODQGXVHSURYLVLRQVLQWKLVORFDODUHD SODQSURYLGHDUDQJHRI]RQHVWRFDWHUIRU 7KLV/$3VHHNVWRUHQHZWKH0DUNHW WKHHFRQRPLFQHHGVRIWKHWRZQ 6TXDUHDQGVXUURXQGLQJVWUHHWVFDSHVLQ RUGHUWRHQKDQFHLPSURYHDQGEXLOGRQ 5HYLWDOLVLQJVWUHQJWKHQLQJDQG WKHLQKHUHQWFKDUDFWHURIWKHWRZQ7KH FRQVROLGDWLQJWKHWRZQFHQWUHDUHDLVDQ NH\DSSURDFKLVWREDODQFHWKHQHHGVRID LPSRUWDQWFRQVLGHUDWLRQ7KHFUHDWLRQRID JURZLQJWRZQZLWKWKHQHHGWRSURWHFWDQG VXFFHVVIXOPL[HGXVHYLDEOHWRZQFHQWUHLV FRQVHUYHWKHHOHPHQWVZKLFKJLYHWKH DNH\SULRULW\IRUWKLV/$3,WLVUHFRJQLVHG WRZQLWVLGHQWLW\ WKDWWKHUHLVDQHHGWRUHFDSWXUHWKH PDUNHWVKDUHWKURXJKDYDULHW\RISROLFLHV 8UEDQGHVLJQSULQFLSOHVLGHQWLILHGIRFXVRQ DQGLQLWLDWLYHVWRVXSSRUWWKHWRZQFHQWUH WKHQHHGIRUUHJHQHUDWLRQRINH\VLWHV 7KLVFDQEHDFKLHYHGE\IDFLOLWDWLQJ ZLWKLQWKHWRZQFHQWUHDUHD7KLVNH\ KHDOWK\FRPSHWLWLRQE\SURYLGLQJIRUD SULRULW\ZLOOHQWDLOVWUHQJWKHQLQJDQG YDULHW\RIUHWDLOIORRUVSDFHZLWKRXW LPSURYLQJWKHLPDJHRIWKHWRZQWKURXJK FRPSURPLVLQJWKHLQWHJULW\RIWKHWRZQ SURSRVDOVIRUWKHSXEOLFUHDOP FHQWUH
3.2.3 Strategic Objective No. 3 ,WLVSURSRVHGWRSURYLGHHDVLHUDFFHVVWR WKHWRZQFHQWUHE\SURPRWLQJOLQNDJHV It is an objective of Carlow County IURPWKHVXUURXQGLQJUHVLGHQWLDOO\]RQHG Council: ODQGV3URYLGLQJHDVLHUDFFHVVWRWKHWRZQ FHQWUHZLOODLGLWVIXWXUHGHYHORSPHQWDQG SO 3: To facilitate the creation of a HQVXUHWKDWWKHWRZQFRUHZLOOEHDQ sustainable vibrant economy which DWWUDFWLYHDQGYLEUDQWDUHD maximises the unique attributes of the town. 3.3 Conclusion SO 3.1 Facilitating Sustainable 7KHSXUSRVHRIWKHYLVLRQDQGVWUDWHJLF Development of the Local REMHFWLYHVLVWRHQVXUHWKHHIIHFWLYH Economy GHOLYHU\RIWKHFRUHVWUDWHJ\RIWKH&RXQW\ 'HYHORSPHQW3ODQIRU7XOORZ ,WZLOOEHQHFHVVDU\WRVWLPXODWHWKHORQJ 7KHVHSULRULWLHVDUHHODERUDWHGXSRQ WHUPHFRQRPLFJURZWKRIWKHWRZQE\
Tullow Draft LAP 2016-2022 - 18 -
IXUWKHULQWKHIROORZLQJFKDSWHUVRIWKLV SODQZLWKDUDQJHRIVXSSRUWLQJSROLFLHV DQGREMHFWLYHV
Tullow Draft LAP 2016-2022 - 19 -
Tullow Draft LAP 2016-2022 - 20 - CHAPTER 4 ECONOMIC DEVELOPMENT
4.1 Introduction
7XOORZLVDQH[SDQGLQJPDUNHWWRZQ VLWXDWHGNP PLOHV IURP&DUORZ WRZQNP PLOHV IURP'XEOLQFLW\DQG NP PLOHV IURP5RVVODUHSRUW 7XOORZJUHZVLJQLILFDQWO\LQWKHODVW \HDUVGXHWRWKHHYHUH[SDQGLQJ'XEOLQ FRPPXWHUEHOWZLWKWKH1UXQQLQJ WKURXJK7XOORZDQGRQZDUGVWR7DOODJKWLQ 'XEOLQ7KH0 PRWRUZD\LVORFDWHGNP PLOHV IURPWKHWRZQPDNLQJLW DFFHVVLEOHWRWKHPDMRUXUEDQFHQWUHVRI Population aged 15 years and over by Principal &DUORZ.LONHQQ\1DDV1HZEULGJHDQG Economic Status and Sex Principal Economic :H[IRUG Male Female Total Status 7XOORZ¶VPDLQHFRQRPLFGULYHULV At work 720 685 1405 Looking for first regular DJULFXOWXUDOUHODWHGLQGXVWU\ZLWK 22 19 41 job DJULFXOWXUDOPDFKLQHU\DQLPDOVDOHVDQG Unemployed having DJULFXOWXUDOSURGXFHVXFKDVJUDLQDQLPDO lost or given up 313 181 494 IHHGVDQGIHUWLOLVHUVEHLQJVLJQLILFDQW previous job EXVLQHVVHVLQWKHWRZQ7RXULVPLVDOVR Student 107 131 238 DQLPSRUWDQWLQGXVWU\ORFDOO\7KHUHVRUW Looking after 12 282 294 GHYHORSPHQWDW0RXQW:ROVHOH\LQFOXGHV home/family H[WHQVLYHJROILQJDQGOHLVXUHIDFLOLWLHV Retired 177 176 353 DORQJZLWKYDU\LQJDFFRPPRGDWLRQQHHGV Unable to work due to 7KHFRQFHQWUDWLRQRIOLJKWLQGXVWU\LV permanent sickness or 95 98 193 PDLQO\RQWKHVRXWKZHVWHUQVLGHRIWRZQ disability Other 9 8 17 LQFOXGLQJ%XUQVLGH$XWRF\O 7XOORZ /WG Total 1,455 1,580 3,035 RQHRIWKHWRZQ¶VODUJHVWHPSOR\HUV Table 7: Population aged 15 years and over by Principal Economic Status and Sex - Census 2011 7KLVGUDIWSODQVHHNVWRSURPRWH HPSOR\PHQWHQWHUSULVHDQGWRXULVP ,Q$SULOUHFRUGVVKRZWKDWWKHUH DVVRFLDWHGGHYHORSPHQWLQRUGHUWR ZHUHSHUVRQVLQ7XOORZRQWKH/LYH SURYLGHRSSRUWXQLWLHVIRU7XOORZWREHFRPH 5HJLVWHU PDOHVDQGIHPDOHV DVHOIVXVWDLQLQJWRZQDVZHOODV HQFRXUDJLQJDQGIDFLOLWDWLQJWKHPL[HGXVH $VSDWLDODQDO\VLVRIWKH3REDO+DDVH± UHJHQHUDWLRQRIWKHWRZQFHQWUHZLWK 3UDWVFKNH'HSULYDWLRQ,QGH[ +3,QGH[ 0DUNHW6TXDUHEHLQJRISDUWLFXODU KLJKOLJKWVWKDW7XOORZVFRUHVDLQWKLV LPSRUWDQFH LQGH[DQGWKLVLVFODVVHGPDUJLQDOO\EHORZ WKHQDWLRQDODYHUDJH 4.1.1 Employment Profile 4.1.2 Strengths of Location in Tullow $FFRUGLQJWR&HQVXVWKHUHZHUH SHUVRQVDJHG\HDUVDQGRYHULQ 7XOORZKDVJRRGURDGLQIUDVWUXFWXUHZLWK WKHODERXUIRUFHDQGRIWKHVH WKH1WUDYHUVLQJWKURXJKWKHWRZQ SHUVRQV ZHUH³at work´LQWKH7XOORZDUHD OHDGLQJWR'XEOLQ¶V0DQGWKH5 FRPSULVLQJRIWKHRYHUDOOSRSXODWLRQ FURVVLQJWKHWRZQWR:LFNORZ7KHWRZQ LVZLWKLQRQHKRXUVGULYLQJGLVWDQFHRI 'XEOLQDQG:DWHUIRUGDLUSRUWVDQG'XEOLQ DQG5RVVODUHVHDSRUWV 7KHWRZQLVDOVRSUR[LPDWHWRODUJHUWRZQV VXFKDV&DUORZ1DDV1HZEULGJH .LONHQQ\DQG(QQLVFRUWK\DOOEHLQJZLWKLQ D NP PLOH UDGLXVRI7XOORZ
Tullow Draft LAP 2016-2022 -21 - %XVeLUHDQQSURYLGHVDGDLO\VHUYLFHHDFK PDQDJHPHQWEURDGEDQGUHFUHDWLRQDQG ZD\FRPPXWHUOLQNWR'XEOLQYLD7DOODJKW DPHQLW\SURYLVLRQDORQJZLWKYLVXDO 7KHUHDUHDOVRDOLPLWHGUDQJH XVXDOO\ LPSURYHPHQWSURMHFWVWRVXSSRUWWKH RQHWZRMRXUQH\VDGD\HDFKZD\ RI%XV WRZQ¶VHFRQRPLFYLEUDQF\ eLUHDQQ([SUHVVZD\VHUYLFHVOLQNLQJWKH WRZQWR'XEOLQ1HZ5RVV:DWHUIRUGDQG 4.3 Strategic Approach 5RVVODUH(XURSRUW--.DYDQDJKDQG6RQV URXWHIURP+DFNHWVWRZQWR&DUORZDOVR 7KLVGUDIW/$3VHHNVWRGHYHORS7XOORZDV VHUYHVWKHWRZQ7KHPDLQVWRSSLQJSODFH DVWURQJG\QDPLFWRZQZKLFKZLOOSURYLGH IRUEXVHVLVRQWKH6TXDUH IRUDVXVWDLQDEOHHFRQRPLFIXWXUHFUHDWLQJ MREVIRUDVNLOOHGZRUNIRUFHEDVHGRQD 7XOORZLVSUR[LPDWHWRYDULRXVWKLUGOHYHO JRRGTXDOLW\RIOLIHIRUDOOLWVFLWL]HQV7KH FROOHJHVDQGDQHGXFDWHGSRSXODWLRQ FRKRUWLVUHTXLUHGWRVXSSRUWKLJKO\VNLOOHG DSSURDFKZLOOEHDFKLHYHGE\ HFRQRPLFHQWHUSULVHV x $VVLVWLQJGHYHORSPHQWRIDOO 4.2 Challenges HFRQRPLFVHFWRUVLQFOXGLQJ FRPPHUFHDQGWRXULVP &DUORZ&RXQW\&RXQFLOXQGHULWVUHPLWIRU GHYHORSPHQWE\WKH (FRQRPLF'HYHORSPHQWDQG%XVLQHVV LPSOHPHQWDWLRQRIUHOHYDQWSROLFLHV 6XSSRUW YLDLWV/RFDO(QWHUSULVH2IILFH WRFDWHUIRUVXFKJURZWK ZLOOZRUNLQFROODERUDWLRQZLWK(QWHUSULVH ,UHODQG,'$&KDPEHURI&RPPHUFH x 3URYLGLQJDGHTXDWHLQIUDVWUXFWXUDO 'HYHORS7XOORZ$VVRFLDWLRQ/WGDQGWKH IDFLOLWLHVJRRGTXDOLW\KRXVLQJDQG EXVLQHVVVHFWRUWRSURPRWH7XOORZDVDQ FRPPXQLW\IDFLOLWLHV DWWUDFWLYHORFDWLRQIRULQZDUGLQYHVWPHQW 7RWKHZHVWRIWKHWRZQ&DUORZ&RXQW\ x 3URPRWLQJHEXVLQHVV &RXQFLOKDYHDIXOO\VHUYLFHGLQGXVWULDO HVWDWHZLWKDYDLODEOHVLWHVZKLOHWKH x =RQLQJVXIILFLHQWDQGDSSURSULDWHO\ %XVLQHVV3DUNRQWKHZHVWRIWKHWRZQLV ORFDWHGODQGVIRULQGXVWULDODQG QHDUFDSDFLW\ FRPPHUFLDOGHYHORSPHQW +LJKOHYHOHGXFDWLRQDODWWDLQPHQWLVDSUH x 3URYLVLRQRIHQWHUSULVHDUHDVDQG UHTXLVLWHWRDWWUDFWKLJKTXDOLW\MREV,Q WUDLQLQJLQIUDVWUXFWXUHDVZHOODV RIWKRVH\HDUVDQGRYHULQ7XOORZ WKHFUHDWLRQRIVPDOOLQFXEDWLRQ ZKRVHIXOOWLPHHGXFDWLRQKDGFHDVHG XQLWVIRUVPDOOVWDUWXS ZHUHHGXFDWHGWRDWPRVWSULPDU\ EXVLQHVVHV OHYHORQO\DIXUWKHUDWWDLQHGVHFRQG OHYHOZKLOHZHUHHGXFDWHGWRWKLUG x (QFRXUDJHPHQWRIFROODERUDWLYH OHYHO,WLVHVWLPDWHGWKDWRIWKH VWUXFWXUHVIRFXVLQJRQHFRQRPLF QDWLRQDOSRSXODWLRQDUHWKLUGOHYHO GHYHORSPHQW JUDGXDWHV x 'HYHORSPHQWRIWKHSXEOLFUHDOP 4XDOLW\RIOLIHLVQRZDNH\GHWHUPLQDQWRI DQGDPHQLWLHVVRDVWRLPSURYH DWRZQ¶VVXFFHVVGHPDQGHGQRWRQO\E\ WKHTXDOLW\RIOLIHRIHPSOR\HHV LWVUHVLGHQWVEXWDOVRQHFHVVDU\WRDWWUDFW DQGUHVLGHQWV DQGKROGRQWRDWDOHQWHGZRUNIRUFH 6WUDWHJLFDVVHWVQHHGWREHSURPRWHGLQ x $GGUHVVLQJZKHUHIHDVLEOHDQ\ RUGHUWRFRPSHWHDQGFROODERUDWHZLWK LQIUDVWUXFWXUDOGHILFLHQFLHVWKDW RWKHUWRZQVLQFOXGLQJ&DUORZDQG PD\EHKLQGHULQJHFRQRPLF %DJHQDOVWRZQIRUHFRQRPLFLQYHVWPHQW GHYHORSPHQWDQGDLPWRHQVXUH WKDWVXVWDLQDEOHLQIUDVWUXFWXUH $GGUHVVLQJKLJKOHYHOVRIXQHPSOR\PHQW IDFLOLWDWHVHFRQRPLFGHYHORSPHQW DYDLODELOLW\RIDIIRUGDEOHFKLOGFDUHIDFLOLWLHV DQGHQVXULQJDYDLODELOLW\RIJRRGTXDOLW\ KRXVLQJVWRFNLVDNH\UHTXLUHPHQW
,WLVDOVRLPSRUWDQWWKDWWKHWRZQKDV H[FHOOHQWLQIUDVWUXFWXUDOSURYLVLRQLQVXFK DUHDVDVWUDQVSRUWDWLRQDQGWUDIILF
Tullow Draft LAP 2016-2022 -22 - x KHFWDUHVLV]RQHGIRU (QWHUSULVHDQG(PSOR\PHQWWRWKH ZHVWDQGVRXWKZHVWHUQVLGHRI WRZQPXFKRIZKLFKLV XQGHYHORSHG7KLVZLOOVXLWD YDULHW\RIDSSURSULDWHXVHV x )RUWKHUHXVHDQGUHGHYHORSPHQW RIEURZQILHOGODQGVLHWKRVHODQGV IRUPHUO\XVHGIRURWKHUXVHVDQG XQGHUXWLOLVHGODQGV 4.4.3 Economic Policies for Tullow
4.4 Policies and Objectives It is the policy of Carlow County Council:
4.4.1 Enterprise and Industry EC 1: 7RDFFHOHUDWHWKHVXVWDLQDEOH GHYHORSPHQWRI7XOORZWKURXJK 7XOORZLVDVWUDWHJLFORFDWLRQLQ&RXQW\ VXVWDLQDEOHHPSOR\PHQWFUHDWLRQLQD &DUORZIRUHQWHUSULVHLQGXVWU\DQG VWUXFWXUHGDQGFRKHVLYHZD\ HPSOR\PHQWZLWKWKHPDMRUHPSOR\HUV UHFRJQLVLQJLWVLPSRUWDQFHDVRQHRI EHLQJ%XUQVLGH$XWRF\O/WG0RXQW WKHNH\GULYHUVRIHFRQRPLFJURZWKLQ :ROVHOH\5HVRUW7HOODE'R\OHV+LUHDQG &RXQW\&DUORZ 6DOHV6XSHUYDOXDQG7HVFR EC 2: 7RIDFLOLWDWHGHYHORSPHQWDJHQFLHV VXFKDV,'$,UHODQGLQSDUWQHUVKLS Workers by Industry ZLWK&DUORZ&RXQW\&RXQFLOWR Daytime Working Industry SURPRWHGHYHORSPHQWRIIRUHLJQ Population RZQHGDQGLQGLJHQRXVVHFWRUKLJKHU Agriculture, forestry and 11 YDOXHDGGHGNQRZOHGJHEDVHG fishing LQGXVWULDODQGLQWHUQDWLRQDOO\WUDGHG Building and construction 17 DFWLYLWLHV Manufacturing industries 136 Commerce and trade 496 EC 3: 7RIRVWHUDQGVXSSRUWLQGXVWU\DQG Transport and 24 HQWHUSULVHLQ7XOORZLQFOXGLQJ communications LQGLJHQRXVEXVLQHVVHV Public administration 44 Professional services 341 EC 4: 7RHQVXUHWKHDYDLODELOLW\RIODQGVIRU Other 126 HPSOR\PHQWXVHVDOOLHGWRGHILQHG Total 1,195 GHYHORSPHQWQHHGVDQGWRGHYHORS Table 8: Daytime Working Population Tullow VDPHLQFRQMXQFWLRQZLWKWKHUHOHYDQW Census 2011 'HYHORSPHQW$JHQFLHV
4.4.2 Location of Employment lands EC 5: 7RSURPRWHLQQRYDWLYHHFRQRPLF in Tullow VHFWRUVDQGHQFRXUDJHFOXVWHULQJ ZKLFKSRVLWLYHO\H[SORLWVV\QHUJLHV 7KLV'UDIW/$3VHHNVWRLGHQWLI\DUDQJHRI EHWZHHQLQWHUFRQQHFWHGFRPSDQLHV RSWLPXPORFDWLRQVZKLFKFDQSUHVHQW RSSRUWXQLWLHVIRUWKHORFDWLRQRILQGXVWU\ EC 6: 7RIDFLOLWDWHDQGHQFRXUDJHWKH DQGZDUHKRXVLQJVSHFLILFVSHFLDOLVHG GHYHORSPHQWRIWKHDOWHUQDWLYHHQHUJ\ VHFWRUDQGWRUHFRJQLVHLWVSRWHQWLDOLQ HQWHUSULVHDQGHPSOR\PHQWXVHVDQG WKHFUHDWLRQRI(QWHUSULVHDQG WRXULVPXVHVWKURXJKRXWWKHSODQDUHD,Q RSSRUWXQLWLHV SDUWLFXODUWKHSODQSURYLGHV EC 7: 7RVXSSRUWDQGIDFLOLWDWHWKH x KHFWDUHVRIODQG]RQHGIRU GHYHORSPHQWRIVWDUWXSHQWHUSULVH LQGXVWU\RQWKHVRXWKZHVWHUQVLGH XQLWVIRUORFDOLQGLJHQRXVHQWHUSULVHV RIWKHWRZQZKLFKFDQIDFLOLWDWH LQ7XOORZ IXUWKHUPDQXIDFWXULQJHQJLQHHULQJ DQGRWKHUDSSURSULDWHXVHV EC 8: 7RIDFLOLWDWHLQQRYDWLYHZRUNSUDFWLFHV VXFKDVµOLYH±ZRUN¶XQLWVZKHUHWKH\ GRQRWQHJDWLYHO\LPSDFWRQUHVLGHQWLDO DPHQLW\
Tullow Draft LAP 2016-2022 -23 - EC 9: 7RLPSURYHDFFHVVWRPDMRUDUHDVRI 4.4.4 Retail HPSOR\PHQWWKURXJKVXVWDLQDEOH WUDQVSRUWPRGHV 7XOORZLVWKHPDLQUHWDLOFHQWUHIRUWKHHDVW RI&RXQW\&DUORZDQGVHUYHVDQH[WHQVLYH EC 10: 7RVXSSRUWFKLOGFDUHIDFLOLWLHVLQ UHWDLOFDWFKPHQWDUHDWKDWLQFOXGHV DSSURSULDWHORFDWLRQVWKHUHE\ DGMRLQLQJDUHDVLQ&RXQW\:LFNORZ,Q SURPRWLQJODERXUPDUNHWSDUWLFLSDWLRQ UHWDLOWHUPV7XOORZDFWVDVDFRQYHQLHQFH DPRQJSDUHQWVDQGVXSSRUWLQJ UHWDLOFHQWUHIRUWKHVXUURXQGLQJFDWFKPHQW SDUHQWVLQDFFHVVLQJHPSOR\PHQW WUDLQLQJDQGHGXFDWLRQ DQGDOVRSURYLGHVDUDQJHRI FRPSOHPHQWDU\XVHVVXFKDVILQDQFLDO EC 11: 7RDFWLYHO\HQFRXUDJHWKH LQVWLWXWLRQVUHVWDXUDQWVDQGSXEOLFKRXVHV UHGHYHORSPHQWRIEURZQILHOGVLWHVDQG UHXVHRIGLVXVHGEXLOGLQJVIRU 7KHWRZQFHQWUHFRUHLVFRQFHQWUDWHG HQWHUSULVHDQGHPSOR\PHQWFUHDWLRQ DURXQG0DUNHW6TXDUHDQG%ULGJH6WUHHW VXEMHFWWRPHHWLQJ'HYHORSPHQW DQGWKHWRZQKDVDUHODWLYHO\VWURQJ 0DQDJHPHQW&ULWHULDDVSUHVHQWHGLQ UHSUHVHQWDWLRQLQWHUPVRIFRQYHQLHQFH WKH&RXQW\'HYHORSPHQW3ODQ VWRUHVDFFRPPRGDWLQJQDWLRQDO LQWHUQDWLRQDOPXOWLSOHVVXFKDV7HVFR EC 12: 7RHQFRXUDJHDQGIDFLOLWDWHDW 6XSHUYDOX/LGODQG$OGL7KHUHDUHDOVR DSSURSULDWHGHVLJQDWHGORFDWLRQV VPDOOHUFRQYHQLHQFHVWKURXJKRXWWKHWRZQ VPDOOLQGLJHQRXVLQGXVWULHVLQ UHFRJQLWLRQRIWKHLULQFUHDVLQJ VXFKDV6SDUDQG&HQWUD&ROOHFWLYHO\ LPSRUWDQFHLQSURYLGLQJORFDO WKHVHODUJHDQGVPDOOHURSHUDWRUVODUJHO\ HPSOR\PHQWDQGKHOSLQJWRVWLPXODWH FDWHUIRUWKHFRQYHQLHQFHVKRSSLQJQHHGV HFRQRPLFDFWLYLW\ RIWKHORFDOSRSXODWLRQ
EC 13: 7RSURPRWHSURWHFWLPSURYH 7XOORZLVDOVRVHUYLFHGE\DQXPEHURI HQFRXUDJHDQGIDFLOLWDWHWKH VPDOOHULQGHSHQGHQWFRPSDULVRQJRRGV GHYHORSPHQWRIWRXULVPLQ7XOORZDV UHWDLOHUVJHQHUDOO\ORFDWHGZLWKLQWKHWRZQ DQLPSRUWDQWFRQWULEXWRUWRMRE FHQWUHKRZHYHUWKHVHDUHPDLQO\ORFDO FUHDWLRQLQWKHWRZQ EXVLQHVVHVZLWKQRQDWLRQDOLQWHUQDWLRQDO FRPSDULVRQPXOWLSOHVRSHUDWLQJRXWRI 7XOORZ
It is an objective of the Council: $GGLWLRQDOO\RQWKHRXWVNLUWVRIWRZQWKHUH ECO 1:7RSURPRWHDQGIDFLOLWDWHWKH DUHVRPHUHWDLOZDUHKRXVLQJVHOOLQJ GHYHORSPHQWRIOLJKWLQGXVWU\ SULPDULO\EXON\JRRGVVXFKDVIXUQLWXUH PDQXIDFWXULQJZDUHKRXVLQJDQG DQGKRXVHKROGJRRGV6XFKXVHVDUH ORJLVWLFVRQODQGV]RQHGLQGXVWU\DQG ORFDWHGSULQFLSDOO\WRWKHVRXWKRIWKHULYHU ZDUHKRXVLQJ'HYHORSPHQWVPXVW RQWKH7KRPDV7UD\QRU5RDGDORQJWKH DFKLHYHDKLJKVWDQGDUGRIOD\RXWDQG 1RQWKH%XQFORG\5RDGDQGLQWKH GHVLJQLQFOXGLQJODQGVFDSLQJDQG 7XOORZ%XVLQHVV3DUNWRWKHVRXWKRIWKH VFUHHQLQJDQGWKHGHOLYHU\RIDKLJK WRZQRIIWKH1 TXDOLW\ZRUNLQJHQYLURQPHQWZKLFKLV DWWUDFWLYHWRERWKFXVWRPHUVDQG 'XHWRWKHH[SDQVLYHUXUDOKLQWHUODQGDORW HPSOR\HHV RIDJULFXOWXUDOEXVLQHVVHVDUHEDVHGLQWKH WRZQDQGDUHFRQFHQWUDWHGDORQJWKH1 ECO 2:7RIDFLOLWDWHDQGSURPRWHWKHJURZWKRI WRWKHVRXWKRIWKHULYHU7KHVHLQFOXGH WKH,QGXVWULDO(VWDWHRQWKHVRXWK ZHVWHUQVLGHRIWKHWRZQZLWKDPL[RI DJULFXOWXUDOPDFKLQHU\VDOHVDQGKLUH HPSOR\PHQWXVHVZLWKLQDKLJKTXDOLW\ VDOHVRIDQLPDOIRRGVWXIIVDQGIHUWLOLVHUDQG ODQGVFDSHGGHYHORSPHQWLQFOXGLQJ OLYHVWRFNVDOHV RIILFHEDVHGLQGXVWU\HQWHUSULVHDQG LQFXEDWRUXQLWVEXVLQHVVVFLHQFHDQG 7KHYDFDQF\OHYHOVZLWKLQWKHFRUHUHWDLO WHFKQRORJ\ DUHDRI7XOORZDUHVLJQLILFDQWO\ORZHUWKDQ WKHOHYHOVRIYDFDQF\REVHUYHGLQ&DUORZ 7RZQDQG%DJHQDOVWRZQ
Tullow Draft LAP 2016-2022 -24 -
Map 3: Tullow Core Retail Area (Source: Carlow Retail Strategy (CDP 2015-2021)
Tullow Draft LAP 2016-2022 -25 - Tullow Draft LAP 2016-2022 -26 - It is the policy of Carlow County Council: It is an objective of the Council:
EC 14: 7RSURWHFWDQGVWUHQJWKHQWKHUHWDLO ECO 3:7RPDLQWDLQWKHUROHRI7XOORZ¶VWRZQFRUH SULPDF\RI7XOORZZLWKLQWKH&RXQW\DQG DUHDDVWKHSULPDU\UHWDLOFHQWUHIRU PRUHVSHFLILFDOO\ZLWKLQ(DVWHUQ&DUORZ FRQYHQLHQFHDQGORFDOFRPSDULVRQ VKRSSLQJWKURXJKFRQWLQXLQJWRGHYHORS EC 15: 7RHQFRXUDJHWKHGHYHORSPHQWRIWKHUHWDLO WKHUHWDLOHQYLURQPHQWWKHTXDOLW\RIWKH DQGVHUYLFHUROHRI7XOORZDVDVHOI SXEOLFUHDOPWKHUDQJHRIUHWDLOXVHVDQG VXVWDLQLQJFHQWUHLQDFFRUGDQFHZLWKWKH WRIDFLOLWDWHFRPSOHPHQWDU\XVHVWRUHWDLO SROLFLHVFRQWDLQHGLQWKH&DUORZ&RXQW\ 'HYHORSPHQW3ODQDQGWKH ECO 4:7RDFWLYHO\SURPRWHIURPDSODQQLQJ 5HWDLO3ODQQLQJ*XLGHOLQHV SHUVSHFWLYHWKHUDQJHRIVSHFLDOLVWVKRSV ZLWKLQWKHWRZQFRUHZKLFKZLOOFRQWULEXWH EC 16: 7RSURWHFWWKHUHWDLOIXQFWLRQRIWKH&RUH WRWKHFKDUDFWHURIWKHWRZQDQG 6KRSSLQJ$UHD DWWUDFWLYHQHVVRIWKHDUHDDVDGHVWLQDWLRQ IRUVKRSSLQJ EC 17: 7RVXVWDLQWKHYLWDOLW\DQGYLDELOLW\RIWKH ECO 5: 7RVHHNWRVHFXUHIXQGLQJWRLPSOHPHQW PDLQVKRSSLQJDUHDDQGWRHQFRXUDJH HQYLURQPHQWDOLPSURYHPHQWVIRUWKHWRZQ PHDVXUHVWRLPSURYHLWVDWWUDFWLYHQHVV FRUHDUHDVXFKDVLPSURYLQJIDFLOLWLHVIRU SHGHVWULDQVSURYLVLRQRIDKLJKTXDOLW\ EC 18: 7RDGKHUHWRWKHSURYLVLRQVRIWKH VWUHHWVFDSHLPSURYHGFRQQHFWLYLW\ZLWK 6HTXHQWLDO$SSURDFKLQWKHFRQVLGHUDWLRQ DGMRLQLQJUHVLGHQWLDODUHDVDQGWRXULVW RIUHWDLODSSOLFDWLRQVORFDWHGRXWVLGHRI DWWUDFWLRQV &RUH5HWDLO$UHD
EC 19: 7RSURPRWHDQGIDFLOLWDWHWKHGHYHORSPHQW RIORFDOPDUNHWVGHYRWHGWRWKHVDOHRI 4.5 Brownfield / Derelict / Vacant / ORFDODJULFXOWXUDODQGFUDIWSURGXFHDQG Underutilised Sites VXSSRUWWKHLUUROHDVYLVLWRUDWWUDFWLRQV ZKLOVWQRWGHWUDFWLQJIURPWKHORFDOVPDOO VKRSV 7KHUHDUHDQXPEHURIEURZQILHOGYDFDQWDQG GHUHOLFWVLWHVLQ7XOORZVRPHRIZKLFKFRQWLQXH EC 20: 7RHQVXUHWKDWEHVWTXDOLW\RIGHVLJQLV WRGHWUDFWIURPWKHRYHUDOODPELHQFHRIWKH DFKLHYHGIRUDOOSURSRVHGUHWDLO WRZQ7KH&RXQFLOLVFRPPLWWHGWRXVLQJLWV GHYHORSPHQWVDQGWKDWGHVLJQUHVSHFWV SRZHUVXQGHUWKH'HUHOLFW6LWHV$FW WR DQGHQKDQFHVWKHVSHFLILFFKDUDFWHULVWLFV HQVXUHWKDWUHOHYDQWODQGRZQHUVWDNHWKH RIWKHWRZQ QHFHVVDU\VWHSVWRSURWHFWDQGHQKDQFHWKH VWUHHWVFDSHLQ7XOORZ EC 21: 7RSXUVXHDOODYHQXHVRIIXQGLQJWRVHFXUH UHVRXUFHVIRUWKHFRQWLQXHGHQKDQFHPHQW 4.5.1 Town Centre Opportunity Sites UHQHZDODQGUHJHQHUDWLRQRIWKHSXEOLF UHDOPRIWKH7RZQ&HQWUH :LWKLQWKHWRZQFHQWUHWKHUHDUHDQXPEHURI RSSRUWXQLW\VLWHVLGHQWLILHGIRUUHGHYHORSPHQW EC 22: 7RGLVFRXUDJHQRQUHWDLODQGH[FHVVLYH ORZHUJUDGHUHWDLOXVHVVXFKDVWDNH VHH0DS 6SHFLILFIORRGULVNUHTXLUHPHQWV DZD\¶VDQGEHWWLQJRIILFHVLQWKHFRUHUHWDLO DVVRFLDWHGZLWKWKHVHVLWHVDUHFRQWDLQHGLQ DUHDDQGRWKHUSULQFLSDOVWUHHWVLQWKHWRZQ WKH6)5$IRUWKLVGUDIWSODQDQGLQ&KDSWHU FHQWUHLQWKHLQWHUHVWVRIPDLQWDLQLQJDQG /DQG8VH=RQLQJ2EMHFWLYHV VXVWDLQLQJWKHUHWDLODWWUDFWLRQRIWKHWRZQ FHQWUH Site 1: Mill Street Car Park
EC 23: 7RLPSURYHWKHSXEOLFUHDOPDQGVXSSRUW 7KHVLWHFRPSULVHVDQH[LVWLQJVXUIDFHFDU ERXWLTXHVW\OHUHWDLOLQJLQWKHWRZQFHQWUH SDUNORFDWHGWRWKHHDVWRI%ULGJH6WUHHWDQGWR EC 24: 7RVHFXUHWKHFRQWLQXHGFRQVROLGDWLRQRI WKHVRXWKRI0LOO6WUHHWDQGDFURVVIURPWKH 7XOORZ7RZQ&HQWUHWKURXJKSURJUHVVLQJ 7XOORZ&LYLF2IILFHV7KHVLWHKDVIURQWDJHWR WKHUHJHQHUDWLRQRIEDFNODQGDQGEURZQ 0LOO6WUHHWDQGWKH,QQHU5HOLHI5RDGDQGLV ILHOGDUHDVLQWKHWRZQFHQWUH FRQVLGHUHGWREHDNH\WRZQFHQWUHRSSRUWXQLW\ VLWH,WLVVWUDWHJLFDOO\ORFDWHGWRIRUPDQ EC 25: 7RHQFRXUDJHDQGIDFLOLWDWHWKHGHOLYHU\RI H[WHQVLRQWRWKHWRZQFHQWUHFRUHDQGKDVWKH WRXULVPUHODWHGUHWDLOGHYHORSPHQWVDQG LQLWLDWLYHVLQDQGDURXQGWKH7RZQ&HQWUH SRWHQWLDOWRGHOLYHUDGGLWLRQDOUHWDLO GHYHORSPHQWWKDWZRXOGFRPSOHPHQWDQG
Tullow Draft LAP 2016-2022 -27 - LPSURYHH[LVWLQJVHUYLFHVLQWKHWRZQ$OVR WKHUHGHYHORSPHQWRIWKLVVLWHKDVWKHSRWHQWLDO WRGLUHFWO\OLQNZLWKWKHWRZQFHQWUHFRUHDW0LOO 6WUHHWOHDGLQJWR0DUNHW6TXDUHDQG%ULGJH 6WUHHWDQGLWVUHGHYHORSPHQWPD\DFWDVD FDWDO\VWIRUDGGLWLRQDOGHYHORSPHQWDQGWKH DWWUDFWLRQRIDGGLWLRQDOXVHVDWWKHVHORFDWLRQV
Site 2: The Thomas Traynor Road
7KLVVLWHLVORFDWHGRQERWKVLGHVRIWKH 7KRPDV7UD\QRU5RDGQHDULWVMXQFWLRQZLWK WKH1WRWKHVRXWKRIWKH5LYHU6ODQH\7KH VLWHFXUUHQWO\FRQVLVWVRIDQXPEHURI ZDUHKRXVHOLJKWLQGXVWULDOXQLWVDORQJVLGHWKH ULYHUDQG:\QQH¶VJUDLQVWRUHIDFLOLW\LVDORQJ WKHVRXWKHUQVLGHRIWKLVDSSURDFKURDG WRZDUGVWKH17KHVLWHLVFRQVLGHUHGWREH DNH\RSSRUWXQLW\VLWHDQGVKRXOGEHSULRULWLVHG IRUGHYHORSPHQW7KHVLWHLVVWUDWHJLFDOO\ ORFDWHGDORQJDPDLQDSSURDFKWRWKHWRZQ FHQWUHDQGWKHDUHDVUHGHYHORSPHQWZRXOG DOORZIRUUHSODFHPHQWRIVRPHRIWKHH[LVWLQJ EXLOGLQJVZLWKDKLJKTXDOLW\GHYHORSPHQW ZKLFKZRXOGLPSURYHWKHFKDUDFWHUDQG DSSHDUDQFHRIWKHDUHD
It is the policy of Carlow County Council:
EC 26: 7RSURPRWHWKHUHGHYHORSPHQWDQG JHQHUDWLRQRIVWUDWHJLFVLWHVDQGYDFDQW DUHDVZLWKLQDQGDGMDFHQWWRWKHWRZQ FHQWUHWRDFKLHYHDFRQVROLGDWHGWRZQZLWK DQLQWHQVLW\RIGHYHORSPHQWIURPWKHFRUH WRWKHHGJH
EC 27: 7RSURPRWHTXDOLW\LQDUFKLWHFWXUHDQG XUEDQGHVLJQ
EC 28: 7RHQFRXUDJHDQGIDFLOLWDWHWKHUHXVHDQG UHJHQHUDWLRQRIYDFDQWGHUHOLFWODQG EXLOGLQJV7KH&RXQFLOZLOOXVHLWVSRZHUV ZKHUHDSSURSULDWHWRFRQVLGHUVXFKVLWHV IRULQFOXVLRQLQWKH5HJLVWHURI'HUHOLFW 6LWHV
Tullow Draft LAP 2016-2022 -28 - Map 4: Tullow Town Centre Opportunity Sites
Tullow Draft LAP 2016-2022 -29 - Tullow Draft LAP 2016-2022 -30 - HQYLURQPHQWDQGUROHRIWKHUXUDODUHDDVD VWUDWHJLFDVVHW
4.6 Rural and Agricultural Development
7XOORZGXHWRLWVORFDWLRQLQHDVWHUQ&RXQW\ &DUORZLVDPDUNHWWRZQVHUYLQJDQH[SDQVLYH UXUDOKLQWHUODQGZKLFKDOVRLQFOXGHVSDUWVRI ZHVW&RXQW\:LFNORZ7KHUXUDOHFRQRP\LVDQ LPSRUWDQWFRPSRQHQWRIWKHWRZQ¶VRYHUDOO HFRQRP\7KHUHLVDSSUR[LPDWHO\ KHFWDUHVRIDJULFXOWXUDOO\]RQHGODQGZLWKLQWKH ERXQGDU\:KLOVWWKLVODQGLV]RQHGIRU DJULFXOWXUDOSXUSRVHVLWDOVRDFWVDVD JUHHQEHOWDURXQGWKHHQYLURQVRI7XOORZ SUHYHQWLQJXUEDQVSUDZO
&HUWDLQW\SHVRIUXUDOHQWHUSULVHVDQG DJULEXVLQHVVHVSHFLDOO\WKRVHWKDWLQYROYH QDWXUDOUHVRXUFHVPD\DWDQDSSURSULDWH VFDOHKDYHDUROHWRSOD\LQWKHDJULFXOWXUDO ]RQH6WUDWHJLFIRRGSURGXFWLRQDQG SURFHVVLQJKDVEHFRPHDQLPSRUWDQW FRPSRQHQWRIWKHUXUDOHFRQRP\7KLVDUHDRI HFRQRPLFGHYHORSPHQWZLOOEHHQFRXUDJHG DQGSURPRWHG5XUDOEDVHGWRXULVPZKLFK LQFOXGHVILVKLQJIRUHVWU\WUHNNLQJHTXLQHDQG IDUPEDVHGDFWLYLWLHVDOVRSURYLGHV RSSRUWXQLWLHVIRUWKHGLYHUVLILFDWLRQRIWKHUXUDO HFRQRP\
*LYHQWKHLPSRUWDQFHRIWKHUXUDOHQYLURQPHQW LWLVHVVHQWLDOWKDWLWVLQWHJULW\LVPDLQWDLQHG DQGHQKDQFHGDQGWKDWWKHDFWLYLWLHVZKLFKUHO\ XSRQLWGRQRWGHJUDGHRUGHWUDFWIURPLW
It is the policy of Carlow County Council:
EC 29: 7RSURPRWHDQHQYLURQPHQWDOO\ VXVWDLQDEOHDJULFXOWXUDOKRUWLFXOWXUDO VHFWRUZKLFKFRQWULEXWHVWRDG\QDPLFDQG VXFFHVVIXOUXUDOHFRQRP\
EC 30: 7RSURPRWHWKHGLYHUVLILFDWLRQRIWKHUXUDO HFRQRP\DQGWKHGHYHORSPHQWRIUXUDO LQGLJHQRXVLQGXVWU\ZKLOHVDIHJXDUGLQJWKH
Tullow Draft LAP 2016-2022 -31 -
Tullow Draft LAP 2016-2022 -32 - CHAPTER 5 HOUSING AND SUSTAINABLE NEIGHBOURHOODS
HQVXUHWKHGHOLYHU\RITXDOLW\KRXVLQJDQG WKHFUHDWLRQRIVXVWDLQDEOHFRPPXQLWLHV WKH/$3PXVWVHHNWRGHOLYHU
x 2FFXSDQF\RIH[LVWLQJYDFDQW UHVLGHQWLDOXQLWVWKURXJKRXWWKHWRZQ
x +LJKTXDOLW\VSDFLRXVKRXVLQJXQLWV
x *RRGOHYHOVRIDPHQLW\LQWHUPVRI JUHHQRSHQVSDFH
x $GDSWDEOHDQGIOH[LEOHXQLWVWKDWUHDGLO\ SURYLGHIRUFKDQJLQJQHHGVRYHUWLPH LQFOXGLQJWKHQHHGVRIIDPLOLHVZLWK FKLOGUHQ
x +LJKTXDOLW\ZHOOGHVLJQHGFRPPXQDO 5.1 Introduction DUHDV
7XOORZKDVH[SHULHQFHGUDSLGSRSXODWLRQ x 6XVWDLQDEOHEXLOGLQJGHVLJQVZKLFKDUH JURZWKLQDVKRUWSHULRGRIWLPHDQGRYHU HQHUJ\HIILFLHQWDQGXWLOLVHUHQHZDEOH RQHWKLUGRISULYDWHKRXVLQJXQLWV HQHUJ\UHVRXUFHV FRQVWUXFWHGLQ7XOORZKDYHWDNHQSODFH SRVW:KLOHWKHWRZQKDVDJRRG x 'HOLYHU\RIVRFLDODQGFRPPXQLW\ QHWZRUNRIVRFLDODQGFRPPXQLW\IDFLOLWLHV IDFLOLWLHVLQWDQGHPZLWKUHVLGHQWLDO DVXVWDLQDEOHWRZQQHHGVWREHDWWUDFWLYH GHYHORSPHQWV DVDSODFHWROLYHIRUDOOSHRSOH3URYLGLQJ ,PSOHPHQWDWLRQRIDFWLRQVIURPWKH/RFDO DGDSWDEOHKRPHVZKLFKDUHDIIRUGDEOH (FRQRPLFDQG&RPPXQLW\3ODQZLOOKHOS SOHDVDQWDQGFRQQHFWHGWRDUHDVZKHUH SURYLGHWKHVWUDWHJLFIUDPHZRUNIRU SHRSOHZRUNDQGVRFLDOLVHLVIXQGDPHQWDO SXEOLFDOO\IXQGHGHFRQRPLFORFDODQG WRWKHFUHDWLRQRIDFRPSDFWWRZQDQGD FRPPXQLW\GHYHORSPHQWSURJUDPPHVLQ NH\IDFWRULQSURYLGLQJTXDOLW\RIOLIH WKHFRXQW\
$JRRGQHLJKERXUKRRGVKRXOGEHRID 5.3 Strategic Approach VFDOHWRVXSSRUWDUDQJHRIVHUYLFHVDQG IDFLOLWLHVDQGVPDOOHQRXJKWRIRVWHUD 7KHDSSURDFKWRSURYLGLQJTXDOLW\KRPHV VHQVHRIFRPPXQLW\DQGEHORQJLQJZLWK DQGVXVWDLQDEOHQHLJKERXUKRRGVZLOOEH HVVHQWLDOVHUYLFHVDQGIDFLOLWLHVDOOZLWKLQ DFKLHYHGE\ ZDONLQJGLVWDQFHRIHDFKRWKHU x (QFRXUDJLQJXSWDNHRIYDFDQWXQLWV 5.2 Challenges x 3URYLGLQJIRUDQDSSURSULDWHTXDQWLW\ DQGTXDOLW\RIUHVLGHQWLDO 7KHNH\SULQFLSOHZKLFKGLUHFWVWKH DFFRPPRGDWLRQLQFRUSRUDWLQJ KRXVLQJSROLFLHVLQWKLVSODQLVWKHGHOLYHU\ VXVWDLQDEOHGHQVLWLHVDQGGHVLJQV RIKLJKTXDOLW\OLYLQJHQYLURQPHQWLQ QHLJKERXUKRRGVZLWKDUDQJHRIKRXVH x 3URYLGLQJIRUDYDULHW\RIKRXVLQJ W\SHVDQGVXIILFLHQWFRPPXQLW\IDFLOLWLHVWR W\SRORJLHVDQGWHQXUHVZKLFKDUH VHUYHWKHQHHGVRIUHVLGHQWV,WLV DGDSWDEOHIOH[LEOHDQGPHHWIDPLO\ LPSRUWDQWWKDWKRXVLQJDQGDVVRFLDWHG QHHGVDQGWKHFKDQJLQJQHHGVRI SK\VLFDODQGFRPPXQLW\LQIUDVWUXFWXUHLQ SHRSOHWKURXJKRXWWKHLUOLYHV 7XOORZLVRIDKLJKVWDQGDUGIRUDOOZKR x 3URYLGLQJIRUKRXVLQJWKDWLVDFFHVVLEOH ZDQWWROLYHZLWKLQWKHWRZQ,QRUGHUWR DQGDIIRUGDEOHIRUDOOUHVLGHQWVWKURXJK
Tullow Draft LAP 2016-2022 - 33 -
WKHLPSOHPHQWDWLRQRIWKHKRXVLQJ ]RQLQJH[WHQGLQJRXWZDUGVIURPWKHWRZQ VWUDWHJ\ FRUH$VWURQJHPSKDVLVLVDOVRSODFHGRQ HQFRXUDJLQJLQILOORSSRUWXQLWLHVDQGEHWWHU x 3URYLGLQJIRUWKHFUHDWLRQRIDWWUDFWLYH PL[HGXVHVXVWDLQDEOHQHLJKERXUKRRGV XVHRIXQGHUXWLOLVHGODQGVZLWKRSWLRQVIRU ZKLFKEHQHILWIURPWKHSKDVHGGHOLYHU\ EURZQILHOGUHJHQHUDWLRQSULRULWLVHG RIVXSSRUWLQJLQIUDVWUXFWXUH Location (Pl Committed / Site Size (ha) Unit Potential x 3URYLGLQJIRUWKHLQWHJUDWLRQRIQHZ Ref) 6LWHUHI GHYHORSPHQWDQGDVVRFLDWHG LQIUDVWUXFWXUHZLWKWKHH[LVWLQJWRZQDQG 6LWHUHI ODQGVFDSHE\H[WHQGLQJWKHIRFXV EH\RQGWKHUHVLGHQWLDOVFKHPHZLWKDQ 6LWHUHI HTXDOHPSKDVLVRQWKHTXDOLW\RIWKH VXUURXQGLQJDUHD 6LWHUHI 5.4 Policies and Objectives 6LWHUHI 5.4.1 Compliance with Core 6LWHUHI Strategy 7KH&RUH6WUDWHJ\LQWKHFXUUHQW&RXQW\ 'HYHORSPHQW3ODQVHWVRXWDQHZKRXVLQJ 1RWH 3DUW6FKHPHDSSURYHG6W3DWULFNV XQLWWDUJHWIRU7XOORZRYHUWKHSHULRG 3DUN QRXQLWV $VRXWOLQHGLQ6HFWLRQDQG Table 9: Permitted Units on Residentially 7DEOHWKHRYHUDOOXQLWWDUJHWLVXQLWV Zoned Land EHWZHHQ9DOLGSODQQLQJ SHUPLVVLRQVH[LVWIRUUHVLGHQWLDOXQLWV H[FOXGLQJQRSHUPLWWHGXQLWVLQ0RXQW 0DSLGHQWLILHVWKHORFDWLRQRISHUPLWWHG :ROVHOH\5HVRUW $QXPEHURI UHVLGHQWLDOVFKHPHVDQGNH\LQILOO SHUPLVVLRQVKRZHYHUDUHGXHWRH[SLUH UHVLGHQWLDOVLWHVZKLFKFRPSULVHWKH EHIRUHWKHHQGRIDQGFRPSULVH EDODQFHRIODQGVDVVRFLDWHGZLWKWKH XQLWV,WLVXQOLNHO\WKDWDOOSHUPLVVLRQPD\ XQILQLVKHGKRXVLQJVFKHPHVRI3KHOLP ZLOOEHLPSOHPHQWHGZLWKLQWKHWLPHIUDPH :RRG3DUN*DWHDQG*OHQGDOH(VWDWHV SHUPLVVLEOH$VRI$SULOWKHUHDUH DOVRXQLWVZKLFKDUHEXLOWDQG :LWKWKHH[FHSWLRQRIWKHIRUHJRLQJ XQRFFXSLHG SHUPLWWHGDQGXQILQLVKHGVFKHPHV RQO\ RQHDGGLWLRQDOVLWHDGMDFHQWWRWKHWRZQ 7KH&DUORZ&RXQW\'HYHORSPHQW3ODQ FHQWUHKDVEHHQ]RQHGSKDVHUHVLGHQWLDO UHFRJQLVHVWKDWWKH7XOORZ/$3 FRPSULVLQJDSSUR[LPDWHO\KDZLWKD VLJQLILFDQWO\RYHU]RQHG SRWHQWLDOWRGHOLYHUFLUFD XQLWV ODQGVIRUUHVLGHQWLDOSXUSRVHV7KLVSODQ SURYLGHVIRUWKHUH]RQLQJRIODQGIURP $PRQLWRULQJPHFKDQLVPZLOOEHUHTXLUHG UHVLGHQWLDODQGPL[HGXVH]RQLQJVWR WRHQVXUHFRPSOLDQFHZLWKWKHFRUH DOWHUQDWLYHODQGXVH]RQLQJVLQFOXGLQJ VWUDWHJ\ VLJQLILFDQWDJULFXOWXUDO]RQLQJV7KHVH ODQGVDUHORFDWHGODUJHO\RQWKHSHULSKHU\ It is the Policy of the Council RIWKHWRZQDQGPD\EHFRQVLGHUHGIRU HP 1: 7RPRQLWRUWKHVFDOHUDWHDQGORFDWLRQ GHYHORSPHQWXQGHUDQ\IXUWKHUUHYLHZRI RIQHZO\SHUPLWWHGGHYHORSPHQWWR WKH7XOORZ/RFDO$UHD3ODQLQWKHPHGLXP HQVXUHFRPSOLDQFHZLWKWKHFRUH WRORQJHUWHUPLQDFFRUGDQFHZLWKWKHFRUH VWUDWHJ\ZLWKUHJDUGWRSRSXODWLRQ VWUDWHJ\WKHQSHUWDLQLQJ WDUJHWVLQRUGHUWRDFKLHYHWKHGHOLYHU\ RIVWUDWHJLFSODQOHGDQGFRRUGLQDWHG EDODQFHGGHYHORSPHQWZLWKLQWKH &RQWUROOHGSKDVLQJRIODQGLVUHTXLUHGWR WRZQ HQVXUHFRPSOLDQFHZLWKWKHSURYLVLRQVRI WKHVWUDWHJ\3KDVLQJRIODQGPXVWEH HP 2: 7RRSHUDWHDQRUGHURISULRULW\IRUWKH EDVHGRQDFOHDUVHTXHQWLDODSSURDFKZLWK UHOHDVHRIUHVLGHQWLDOODQGVWRFRPSO\
Tullow Draft LAP 2016-2022 - 34 -
ZLWKWKH&RUH6WUDWHJ\RIWKH&DUORZ RIWHQXUHXQLWVL]HEXLOGLQJGHVLJQDQGWR &RXQW\'HYHORSPHQW3ODQ HQVXUHGHPRJUDSKLFEDODQFHLQUHVLGHQWLDO DVIROORZV FRPPXQLWLHV/DUJHUUHVLGHQWLDOVFKHPHV L 7KHODQGVLGHQWLILHGDV³1HZ ZLOOEHUHTXLUHGWRSKDVHWKHLUEXLOGLQJ 5HVLGHQWLDO±3KDVH´ODQGXVH SURJUDPPHVRDVWRHQVXUHWKDWLPSRUWDQW ]RQLQJREMHFWLYHPD\EHDSSURSULDWH SK\VLFDOVRFLDODQGFRPPXQLW\ VXEMHFWWRFRPSOLDQFHZLWKWKHFRUH LQIUDVWUXFWXUHDUHGHOLYHUHGLQWDQGHPZLWK VWUDWHJ\WDUJHWVIRUUHVLGHQWLDO UHVLGHQWLDOGHYHORSPHQW&DUORZ&RXQW\ GHYHORSPHQWZLWKLQWKHOLIHWLPHRIWKLV &RXQFLOZLOOVHHNWRHQVXUHWKDWVXFK SODQ GHYHORSPHQWLVSKDVHGLQOLQHZLWKWKH LL 7KHODQGVLGHQWLILHGDV³1HZ DYDLODELOLW\RIHVVHQWLDOLQIUDVWUXFWXUHVXFK 5HVLGHQWLDO±3KDVH´ODQGXVH ]RQLQJREMHFWLYHDUHQRWDYDLODEOHIRU DVWUDQVSRUWVFKRROVFKLOGFDUHIDFLOLWLHV UHVLGHQWLDOGHYHORSPHQWZLWKLQWKH KHDOWKIDFLOLWLHVDQGUHFUHDWLRQDOIDFLOLWLHV OLIHWLPHRIWKLV/$3XQOHVVWKH3ODQLV It is the Policy of the Council UHYLHZHGDPHQGHGLQDFFRUGDQFH ZLWKSODQQLQJOHJLVODWLRQ HP 6: 7RHQFRXUDJHDQGIRVWHUWKHFUHDWLRQ RIDWWUDFWLYHPL[HGXVHVXVWDLQDEOH HP 3: 7RIDFLOLWDWHZKHUHDSSURSULDWH QHLJKERXUKRRGVZKLFKFRQWDLQD UHVLGHQWLDOGHYHORSPHQWRQ YDULHW\RIKRXVLQJW\SHVDQGWHQXUHV DSSURSULDWHLQILOOUHJHQHUDWLRQDQG ZLWKVXSSRUWLQJFRPPXQLW\IDFLOLWLHV WRZQFHQWUHVLWHVLQDFFRUGDQFHZLWK SXEOLFUHDOPDQGUHVLGHQWLDODPHQLWLHV WKHSULQFLSOHVRISURSHUSODQQLQJDQG HP 7: 7RSURPRWHWKHGHYHORSPHQWRI VXVWDLQDEOHGHYHORSPHQW XQGHUXWLOLVHGLQILOOWRZQFHQWUHVLWHV DQGWRIDFLOLWDWHKLJKTXDOLW\ HP 4: 7RKDYHUHJDUGWRWKH'R(&/* GHYHORSPHQWZKLFKUHVSHFWVWKH *XLGHOLQHVRQµ4XDOLW\+RXVLQJIRU GHVLJQRIVXUURXQGLQJGHYHORSPHQW 6XVWDLQDEOH&RPPXQLWLHV±%HVW DQGWKHFKDUDFWHURIWKHDUHD 3UDFWLFH*XLGHOLQHVIRU'HOLYHULQJ +RPHV6XVWDLQLQJ&RPPXQLWLHV HP 8: 7RUHTXLUHODUJHUVFKHPHVWREH µ'HOLYHULQJ+RPHV6XVWDLQLQJ GHYHORSHGLQDSKDVHGPDQQHU &RPPXQLWLHV±6WDWHPHQWRQ+RXVLQJ HQVXULQJWKDWQHFHVVDU\FRPPXQLW\ 3ROLF\¶ µ6XVWDLQDEOH8UEDQ LQIUDVWUXFWXUHLVGHOLYHUHGLQWDQGHP +RXVLQJ 'HVLJQ6WDQGDUGVIRU1HZ ZLWKUHVLGHQWLDOGHYHORSPHQW $SDUWPHQWV¶ DQG6XVWDLQDEOH HP 9: 7RHQFRXUDJHVWURQJIURQWDJHVDORQJ 5HVLGHQWLDO'HYHORSPHQWLQ8UEDQ PDLQWKRURXJKIDUHVFUHDWLQJGHILQLWH $UHDV¶DQGWKHDFFRPSDQ\LQJ8UEDQ EXLOGLQJOLQHVDQGFRQWLQXLW\RIWKH 'HVLJQ0DQXDO %HVW3UDFWLFH*XLGH VWUXFWXUHRIWKHWRZQFHQWUH HP 10: 7RHQVXUHWKDWQHZKRXVLQJ HP 5: 7RUHTXLUHWKDWDOOQHZUHVLGHQWLDO GHYHORSPHQWFORVHWRH[LVWLQJKRXVHV GHYHORSPHQWVFRPSO\ZLWKWKH UHIOHFWWKHFKDUDFWHUDQGVFDOHRIWKH +RXVLQJ6WUDWHJ\DQG'HYHORSPHQW H[LVWLQJKRXVHVXQOHVVWKHUHDUH 0DQDJHPHQW6WDQGDUGVRIWKH&DUORZ H[FHSWLRQDOGHVLJQUHDVRQVIRUGRLQJ &RXQW\'HYHORSPHQW3ODQ RWKHUZLVH RUDVPD\EHDPHQGHG HP 11: 7RUHTXLUHDSSOLFDWLRQVIRUUHVLGHQWLDO GHYHORSPHQWZKHUHDSSURSULDWHWR 5.4.2 Sustainable Residential GHPRQVWUDWHWKHSURYLVLRQRIDQ Areas DSSURSULDWHPL[RIGZHOOLQJW\SHV KDYLQJUHJDUGWRWKHIROORZLQJ 7KH&RXQFLOZLOOUHTXLUHWKHSURYLVLRQRI x 7KHQDWXUHRIWKHH[LVWLQJKRXVLQJ QHLJKERXUKRRGVUDWKHUWKDQWUDGLWLRQDO VWRFNDQGH[LVWLQJVRFLDOPL[LQWKH DUHD KRXVLQJHVWDWHV7KHQHLJKERXUKRRG FRQFHSWLVEDVHGRQWKHSULQFLSOHWKDW x 7KHGHVLUDELOLW\RISURYLGLQJPL[HG FRPPXQLWLHV SHRSOHVKRXOGEHDEOHWRDFFHVVPDQ\RI x 7KHSURYLVLRQRIDUDQJHRIKRXVLQJ WKHUHTXLUHPHQWVRIGDLO\OLYLQJZLWKLQHDV\ W\SHVDQGWHQXUHV UHDFKRIWKHLUKRPH9DULHGKRXVLQJ x 7KHQHHGWRSURYLGHDFKRLFHRI W\SRORJLHVZLOODOVREHVRXJKWZLWKLQ KRXVLQJVXLWDEOHIRUDOODJHJURXSV QHLJKERXUKRRGVLQRUGHUWRHQFRXUDJHD DQGSHUVRQVDWGLIIHUHQWVWDJHVRIWKH GLYHUVHFKRLFHRIKRXVLQJRSWLRQVLQWHUPV OLIHF\FOH
Tullow Draft LAP 2016-2022 - 35 -
Tullow Draft LAP 2016-2022 - 36 -
Map 5: Residential Sites
Tullow Draft LAP 2016-2022 - 37 -
Tullow Draft LAP 2016-2022 - 38 -
5.4.3 Sustainable Building 5.4.5 Good Property Management Design *RRGSURSHUW\PDQDJHPHQWDUUDQJHPHQWV &DUORZ&RXQW\&RXQFLOZLOOVXSSRUWD DUHQHHGHGWRVHFXUHWKHVDWLVIDFWRU\ VXVWDLQDEOHDSSURDFKWRKRXVLQJ XSNHHSDQGPDLQWHQDQFHRIFRPPXQDO GHYHORSPHQWE\SURPRWLQJKLJKVWDQGDUGV DUHDVDQGIDFLOLWLHV&DUORZ&RXQW\ RIHQHUJ\HIILFLHQF\LQDOOKRXVLQJ &RXQFLOZLOOHQGHDYRXUWRWDNHLQFKDUJH GHYHORSPHQWVSURPRWLQJLPSURYHPHQWVWR GHYHORSPHQWVDVVRRQDVSRVVLEOH WKHHQYLURQPHQWDOSHUIRUPDQFHRIEXLOGLQJ IROORZLQJFRPSOLDQFHZLWKUHOHYDQW LQFOXGLQJWKHXVHRIUHQHZDEOHHQHUJ\DQG FRQGLWLRQVDQGLQDFFRUGDQFHZLWK&DUORZ WKURXJKWKHVSDWLDOSODQQLQJOD\RXW &RXQW\&RXQFLO¶V³7DNLQJLQ&KDUJH GHVLJQDQGGHWDLOHGVSHFLILFDWLRQRI 3ROLF\´ SURSRVDOV It is the Policy of the Council It is the Policy of the Council HP 14: 7RUHTXLUHFRPSOLDQFHZLWK HP 12: 7RSURPRWHPRUHVXVWDLQDEOH &DUORZ&RXQW\&RXQFLO¶VSROLF\ GHYHORSPHQWWKURXJKHQHUJ\HQGXVH RQWKHWDNLQJLQFKDUJHRI HIILFLHQF\LQFUHDVLQJWKHXVHRI UHVLGHQWLDOGHYHORSPHQWV UHQHZDEOHHQHUJ\DQGLPSURYHG HQHUJ\SHUIRUPDQFHRIDOOQHZ 5.4.6 Unfinished Estates GHYHORSPHQW 5.4.4 Quality Housing for All 7KHUHDUHILYHXQILQLVKHGHVWDWHVLQ7XOORZ DQGSODQQLQJSHUPLVVLRQVUHPDLQVYDOLGRQ +RXVLQJZLWKORQJWHUPDGDSWDELOLW\DQG WZRVFKHPHV:KHUHDSSURSULDWHWKH SRWHQWLDOIRUIOH[LELOLW\DOORZVIRUFKDQJHDV &RXQFLOZLOOVHHNWKHFRPSOHWLRQRI FLUFXPVWDQFHVDOWHUDQGIDPLOLHVJURZ XQILQLVKHGVFKHPHVWRHQVXUHSXEOLF $GDSWDELOLW\WKDWDOORZVIRUWKHDOWHUDWLRQRI KHDOWKDQGVDIHW\LVPDLQWDLQHGDQGWKDW WKHIDEULFRIDEXLOGLQJDQGIOH[LELOLW\ZKLFK HVVHQWLDOVHUYLFHVVXFKDVURDGVSXEOLF DOORZVIRUVSDFHVWRDFFRPPRGDWHD OLJKWLQJIRRWSDWKVSLSHGVHUYLFHVDQG UDQJHRIXVHVDUHNH\FRQVLGHUDWLRQVLQ DPHQLW\DUHDVDUHVDWLVIDFWRULO\FRPSOHWHG WKHGHVLJQRIDKRPH&DUORZ&RXQW\ 7KHRQXVLVRQWKHGHYHORSHUWR &RXQFLOZLOOKDYHUHJDUGWR/LIHWLPH+RPHV GHPRQVWUDWHWKDWWKHFRPSOHWLRQRIDQ\ JXLGDQFHFRQWDLQHGLQ6HFWLRQRIWKH XQILQLVKHGHVWDWHFRPSOLHVZLWKWKH 'HSDUWPHQWRI(QYLURQPHQW&RPPXQLW\ SULQFLSOHVRIVXVWDLQDEOHGHYHORSPHQWDQG DQG/RFDO*RYHUQPHQWµ4XDOLW\+RXVLQJ LVRIDKLJKTXDOLW\VWDQGDUG IRU6XVWDLQDEOH&RPPXQLWLHV±%HVW 3UDFWLFH*XLGHOLQHVIRU'HOLYHULQJ+RPHV It is the Policy of the Council 6XVWDLQLQJ&RPPXQLWLHV¶ HP 15: 7RKDYHUHJDUGWRWKH'R(&/*¶V µ6WDNHKROGHUV&RGHRI3UDFWLFH It is the Policy of the Council EHWZHHQWKH5HSUHVHQWDWLYH%RGLHV HP 13: 7RHQVXUHWKDWDOOKRXVLQJLVGHVLJQHG 'HDOLQJZLWK8QILQLVKHG+RXVLQJ LQDZD\WKDWLVDGDSWDEOHDQGIOH[LEOH 'HYHORSPHQWV WRWKHFKDQJLQJQHHGVRIWKH KRPHRZQHUKDYLQJUHJDUGWRWKH /LIHWLPH+RPHV*XLGDQFHFRQWDLQHG LQ6HFWLRQRIWKH'HSDUWPHQWRI (QYLURQPHQW&RPPXQLW\DQG/RFDO *RYHUQPHQWµ4XDOLW\+RXVLQJIRU 6XVWDLQDEOH&RPPXQLWLHV±%HVW 3UDFWLFH*XLGHOLQHVIRU'HOLYHULQJ +RPHV6XVWDLQLQJ&RPPXQLWLHV¶
Tullow Draft LAP 2016-2022 - 39 -
5.4.8 Demolition and Reuse
7KHGHPROLWLRQRIH[LVWLQJKRXVLQJLV JHQHUDOO\GLVFRXUDJHGRQVXVWDLQDELOLW\ JURXQGV,WPD\DOVROHDGWRDORVVRI UHVLGHQWLDODFFRPPRGDWLRQDQG VWUHHWVFDSHFKDUDFWHU3URYLGLQJ UHVLGHQWLDODFFRPPRGDWLRQRQXSSHUIORRUV LVHQFRXUDJHGSDUWLFXODUO\LQWKHWRZQ FHQWUHDUHDDVLWZLOOFRQWULEXWHWRWKH FUHDWLRQRIDYLEUDQWPL[HGXVHFRPSDFW XUEDQFRUH
5.4.7 Apartment Living It is the Policy of the Council
7KHSURYLVLRQRIDSDUWPHQWGHYHORSPHQW HP 18: 7RGLVFRXUDJHWKHGHPROLWLRQRI RURWKHUW\SHVRIUHVLGHQWLDOGHYHORSPHQW KDELWDEOHKRXVLQJXQOHVV VWUHHWVFDSHHQYLURQPHQWDODQG PD\EHFRQVLGHUHGDWDSSURSULDWH DPHQLW\FRQVLGHUDWLRQVDUH ORFDWLRQVZLWKLQWKHWRZQFHQWUHDUHD VDWLVILHG 6XFFHVVIXODSDUWPHQWOLYLQJUHTXLUHVWKDW WKHVFKHPHPXVWEHGHVLJQHGDVDQ HP 19: 7RUHVLVWWKHORVVRIUHVLGHQWLDO LQWHJUDOSDUWRIWKHQHLJKERXUKRRG XVHRQXSSHUIORRUVDQGDFWLYHO\ VXSSRUWSURSRVDOVWKDWUHWDLQRU $SDUWPHQWVWDQGDUGVDLPWRHQVXUHWKDW EULQJXSSHUIORRUVDERYHJURXQG IORRUSUHPLVHVLQWRUHVLGHQWLDO QHZDSDUWPHQWGHYHORSPHQWVSURYLGH XVH KRXVLQJZLWKKLJKOHYHOVRIDPHQLW\ ZLWKLQ LQGLYLGXDODSDUWPHQWV ZLWKLQWKHRYHUDOO 5.4.9 Social and Affordable Housing GHYHORSPHQWLQFOXGLQJDOOFRPPXQDO IDFLOLWLHV DQGE\HQVXULQJWKDWVXLWDEOH 7KH&DUORZ&RXQW\&RXQFLO+RXVLQJ VRFLDOLQIUDVWUXFWXUHDQGRWKHUVXSSRUW 6WUDWHJ\RIWKH&DUORZ&RXQW\ IDFLOLWLHVDUHDYDLODEOHLQWKH 'HYHORSPHQW3ODQDQGWKH QHLJKERXUKRRG SROLFLHVDQGREMHFWLYHVFRQWDLQHGLQ It is the Policy of the Council &KDSWHU+RXVLQJRIWKH&DUORZ&RXQW\ 'HYHORSPHQW3ODQDGGUHVVHV HP 16 7RUHVWULFWDSDUWPHQWGHYHORSPHQWV LVVXHVDVVRFLDWHGZLWKKRXVLQJLQWKH JHQHUDOO\WRWRZQFHQWUHORFDWLRQVRU FRXQW\LQFOXGLQJKRXVLQJQHHGWKHQHHG VXLWDEO\ORFDWHGVLWHVDGMRLQLQJSXEOLF WUDQVSRUWFRQQHFWLRQV$SDUWPHQWV IRUKRXVLQJXQLWVRIGLIIHUHQWW\SHVDQG ZLOOQRWEHSHUPLWWHGZKHUHWKHUHLVDQ VL]HVLPSURYLQJVRFLDOPL[DQGFDWHULQJ RYHUFRQFHQWUDWLRQRIWKLVW\SHRI IRUWKRVHZLWKVSHFLDOQHHGVLQFOXGLQJWKH GHYHORSPHQW+LJKHUGHQVLW\ HOGHUO\WUDYHOOHUVKRPHOHVVDQGGLVDEOHG VFKHPHVZLOORQO\EHFRQVLGHUHG SHRSOH ZKHUHWKH\H[KLELWDKLJKDUFKLWHFWXUDO GHVLJQVWDQGDUGFUHDWLQJDQDWWUDFWLYH It is the Policy of the Council DQGVXVWDLQDEOHOLYLQJHQYLURQPHQW HP 20: 7RVHFXUHWKHLPSOHPHQWDWLRQRIWKH HP 17: 7RVHHNWKHSURYLVLRQRIKLJKTXDOLW\ &DUORZ+RXVLQJ6WUDWHJ\ DSDUWPHQWVZKHUHSHUPLWWHGZLWKLQ RUDQ\DPHQGPHQWRUUHYLHZWKHUHWR VXVWDLQDEOHQHLJKERXUKRRGVE\ GXULQJWKHOLIHWLPHRIWKLVSODQ DFKLHYLQJDSSURSULDWHIORRUDUHDVL]HV DQGOHYHOVRIDPHQLW\ZLWKLQHDFK HP 21 7RSURPRWHWKHSURYLVLRQRI DSDUWPHQWGHYHORSPHQW DQGHQVXULQJ DSSURSULDWHDFFRPPRGDWLRQIRU WKDWVXLWDEOHVRFLDOLQIUDVWUXFWXUHDQG SHRSOHZLWKVSHFLDOQHHGVLQFOXGLQJ RWKHUVXSSRUWIDFLOLWLHVDUHDYDLODEOHLQ SHRSOHZLWKGLVDELOLWLHVVWXGHQWV WKHQHLJKERXUKRRG WUDYHOOHUVWKHKRPHOHVVDQGWKH HOGHUO\LQFRQMXQFWLRQZLWKYROXQWDU\ ERGLHVDQGWKHSULYDWHVHFWRULQ DFFRUGDQFHZLWKWKH&DUORZ&RXQW\
Tullow Draft LAP 2016-2022 - 40 -
'HYHORSPHQW3ODQ RUDV PD\EHDPHQGHG
5.4.10 Social Inclusion and Regeneration 6RFLDOLQFOXVLRQLVLPSRUWDQWLQFUHDWLQJ VXVWDLQDEOHQHLJKERXUKRRGV,QWKH &HQVXVRIDSSUR[LPDWHO\RIWKH UHVLGHQWVLQ7XOORZZHUH3ROLVKQDWLRQDOV 7KHSURPRWLRQRILQFOXVLYH QHLJKERXUKRRGVWKDWFDWHUIRUDOO QDWLRQDOLWLHVDJHJURXSVEDVHGRQWKH SULQFLSOHVRIXQLYHUVDOGHVLJQTXDOLW\RI GHVLJQDQGJRRGVHUYLFHVDQGIDFLOLWLHVWR DOOZLOOEHDSULRULW\7KHUHJHQHUDWLRQRI WKHWRZQFHQWUHDQGLQFUHDVLQJ FRQQHFWLYLW\EHWZHHQQHLJKERXUKRRGVLQWR WKHIDEULFRIWKHWRZQLVDOVRHVVHQWLDOWR DFKLHYHWKLV It is the Policy of the Council HP 22: 7RVXSSRUWXUEDQUHJHQHUDWLRQLQ RUGHUWRHQKDQFHVRFLDOFRKHVLRQDQG WKHSRWHQWLDOIRUSRVLWLYHFKDQJH
HP 23: 7RSURPRWHVXVWDLQDEOH QHLJKERXUKRRGVZKLFKFDWHUIRUWKH QHHGVRISHUVRQVRIDOOVWDJHVLQWKHLU OLIHF\FOHLHFKLOGUHQSHRSOHRI ZRUNLQJDJHHOGHUO\SHRSOHZLWK GLVDELOLWLHV
HP 24: 7RSURPRWHPXOWLXVHRIFRPPXQLW\ IDFLOLWLHVDQGRXWGRRUVKDUHGVSDFHV ZKLFKDUHDFFHVVLEOHWRDOO6XFK GHYHORSPHQWVVKRXOGEHLQ DFFRUGDQFHZLWKWKHSULQFLSOHVRI XQLYHUVDOGHVLJQ
Tullow Draft LAP 2016-2022 - 41 -
Tullow Draft LAP 2016-2022 - 42 -
CHAPTER 6 TOWN CENTRE, LANDSCAPE AND PUBLIC REALM
6.1 Introduction WRZQFHQWUHVWKHµOLYLQJDERYHWKHVKRS¶ FRQFHSWLVQRWSURPLQHQWLQ7XOORZWRZQ 7XOORZLVDFRPSDUDWLYHO\ROGWRZQRULJLQDWLQJ FHQWUH IURP$QJOR1RUPDQWLPHV,WVXIIHUHGDGHFOLQH LQVL]HGXULQJWKHODWHPLGGOHDJHVEXWHYROYHG )DFWRUVZKLFKLPSDFWRQWKHLPDJHRIWKHWRZQ DVDPDUNHWWRZQLQWKHWKDQGWKFHQWXULHV LQFOXGHTXDOLW\RIEXLOWIRUP SXEOLFUHDOP 7KHSUHVHQWOD\RXWHYROYHGDURXQG0DUNHW VKRSIURQWV XVHRIFRORXU PDLQWHQDQFHDQG 6TXDUHZLWKDFRPSDFWWRZQFHQWUH7KHWRZQ XSNHHSRIEXLOGLQJV2WKHULVVXHVZKLFKZRXOG FHQWUHRI0DUNHW6TXDUHFRQVLVWVRIDZLGH DIIHFWWKHYLWDOLW\RI7XOORZLQFOXGHSRRUPL[RI VTXDUHRIIZKLFKDV\VWHPRIVPDOODQGQDUURZ XVHVODFNRIDFWLYHIURQWDJHVRQWRWKHVWUHHW VWUHHWVOHDGDZD\IURPWKHWRZQFHQWUHWR DVZHOODVWKHDPRXQWRIVRFLDODQGFXOWXUDO RWKHUDUHDVRIWKHWRZQ DFWLYLW\ZLWKLQWKHSXEOLFUHDOP
7XOORZDOVRKDVDGLVWLQFWLYHVHQVHRISODFH 9DFDQWVLWHVGHUHOLFWEXLOGLQJVDQGHPSW\ GHULYHGIURPDYDULHW\RIHOHPHQWVLQFOXGLQJ VKRSXQLWVLQSDUWLFXODULQWKHWRZQFHQWUH WKH5LYHU6ODQH\LWVLPSRUWDQFHDVDPDUNHW KDYHDQHJDWLYHLPSDFWRQWKHYLDELOLW\RID DQGDJULFXOWXUDOWRZQVHUYLQJDQH[WHQVLYH WRZQDQGDVDUHVXOWZHDNHQLWVSRVLWLRQDVWKH KLQWHUODQGZKLFKH[WHQGVLQWRERWK&RXQW\¶V SULPDU\FRPPHUFLDOFHQWUHZLWKLQWKHWRZQ :LFNORZDQG.LOGDUH7KHWRZQDOVRKDVDQ 7XOORZKDVDJRRGPL[RIUHWDLOLQWKHFRUH H[WHQVLYHKLVWRU\ZLWKVHYHUDOEXLOGLQJVRI WRZQFHQWUHZLWKPDMRUVXSHUPDUNHWV KLVWRULFDODQGDUFKLWHFWXUDOVLJQLILFDQFHDQGD QHZVDJHQWVIORULVWVVHYHUDOSXEOLFKRXVHV UDQJHRIXVHVDQGDFWLYLWLHV RQHZKLFKRIIHUVIRRGDOOGD\DFDIpFORWKHV DQGJLIWRXWOHWVVHYHUDOKDLUDQGEHDXW\ 7KHYLVXDOTXDOLWLHVRI7XOORZGHILQHWKHWRZQ¶V VDORQVSKDUPDFLHVEDQNVDFUHGLWXQLRQ XQLTXHLGHQWLW\DQGVHQVHRISODFH7KH DQGPRUH7KXV7XOORZRIIHUVVHUYLFHVDQG SULQFLSDOYLVXDOHOHPHQWWRWKHWRZQLV0DUNHW VKRSSLQJWRDODUJHSRSXODWLRQLQWKHWRZQDQG 6TXDUH7KLVVSDFHH[WHQGVIURPWKHQRUWKRI VXUURXQGLQJDUHD %ULGJH6WUHHWWRWKH'XEOLQ5RDGDWWKHWRSRI WKHWRZQDQGLWVPDLQIRFDOSRLQWDQGODQGPDUN 7XOORZ¶VXUEDQIDEULFDQGLPDJHIRUPD EHLQJ)U-RKQ0XUSK\0HPRULDO6WDWXHLQWKH IXQGDPHQWDOSDUWRIWKHWRZQ¶VFKDUDFWHUDQG 6TXDUH WKHUHIRUHPXVWEHHQKDQFHGWKURXJKWKH SROLFLHVDQGREMHFWLYHVRIWKLV/RFDO$UHD3ODQ 7KH5LYHU6ODQH\LVDQLPSRUWDQWYLVXDO 0HDVXUHVVXFKDVLQFUHDVLQJSHUPHDELOLW\ HOHPHQWZKLFKFDQEHPDLQO\HQMR\HGRQWKH LQWHQVLI\LQJGHYHORSPHQWDQGLPSURYLQJWKH DSSURDFKHVIURPWKHZHVWWRWKHWRZQDQG RYHUDOOLPDJHRI7XOORZZLOOFRQVROLGDWHDQG DORQJWKH1HZ/LQN5RDGZKLFKLQFOXGHV VWUHQJWKHQWKHWRZQFRUHDQGVXSSRUWLWVUROH VHDWLQJDUHDVDORQJWKHULYHUVLGH7KHYLVXDO DVWKHSULQFLSOHFRPPHUFLDODUHD7KHWRZQ FKDUDFWHULVWLFVRIWKLVDUHDODUJHO\FRPSULVH ZRXOGDOVREHQHILWIURPWKHSURPRWLRQRIKLJK WKHULYHUVFDSHDQGLWVPDWXUHODQGVFDSH TXDOLW\VKRSIURQWVDQGXVHRIFRORXUVFKHPHV VXFKDVKHULWDJHFRORXUV 6.2 Challenges )XWXUHGHYHORSPHQWPXVWEHVXVWDLQDEOHDQG 6XFFHVVIXOWRZQVDUHRIWHQMXGJHGLQWHUPVRI LQWHJUDWHGWRDFKLHYHDFRPSDFWZHOO WKHLUYLWDOLW\DQGYLDELOLW\ZKLFKDUHGHHPHGDV FRQQHFWHGYLDEOHDQGYLWDOWRZQ7KH WKHHVVHQWLDOHOHPHQWVRIWKULYLQJWRZQFHQWUHV FKDOOHQJHVDUHWKHUHIRUHWKUHHIROG 9LWDOLW\LVWKHFRQVLGHUDWLRQRIDVXFFHVVIXO SXEOLFUHDOPZKLFKLVPHDVXUHGLQVRFLDOWHUPV x6WUHQJWKHQLQJWKHWRZQE\LPSURYLQJWKH ZKHUHDVYLDELOLW\LVDJDXJHRIVXFFHVVIXO LPDJHSK\VLFDODQGHQYLURQPHQWDOTXDOLWLHVRI GHYHORSPHQWZKLFKLVPHDVXUHGLQILQDQFLDO WKHSXEOLFUHDOP WHUPV,WLVLPSRUWDQWWRQRWHWKDWWKHVHWZR VHSDUDWHLVVXHVDUHZKROO\UHOLDQWDQG x(QFRXUDJLQJWKHFRQVROLGDWLRQRIWKHWRZQ LQWHUGHSHQGHQWRQHDFKRWKHULIDVXFFHVVIXO LPSURYLQJFRQQHFWLYLW\DQGSHUPHDELOLW\ DQG DQGDWWUDFWLYHWRZQFHQWUHLVWREHDFKLHYHG IDFLOLWDWLQJWKHFRPSUHKHQVLYHPL[HGXVH UHJHQHUDWLRQRIWKHFRUHUHWDLODUHD 7KHWRZQFHQWUHKDVDVHQVHRIYLWDOLW\ZLWK ORZHUOHYHOVRIYDFDQF\WKDQRWKHUWRZQRI x([WHQGLQJWKHIRUPDQGVWUXFWXUHRIWKHWRZQ VLPLODUVL]H+RZHYHUDVLVWKHFDVHLQPDQ\ IRUWKHEHQHILWRIWKHH[LVWLQJFRPPXQLWLHVDQG
Tullow Draft LAP 2016-2022 - 43 - GHYHORSLQJZHOOFRQQHFWHGVXVWDLQDEOH x 7KH5LYHU)URQW%XLOGLQJW\SRORJLHV QHLJKERXUKRRGV LQFOXGHRSHUDWLRQDODQGGHUHOLFW LQGXVWULDOEXLOGLQJVFDUSDUNLQJFLYLF 6.3 Strategic Approach RIILFHVDQGFRPPHUFLDOEXLOGLQJV 0DQ\EXLOGLQJVEDFNRQWRWKHULYHU 7KHVWUDWHJLFDSSURDFKIRU7XOORZLVWRVHHNWR WKRXJKWRWKHVRXWKHDVWRIWKHEULGJH HVWDEOLVKDQDWWUDFWLYHVHOIVXIILFLHQWDQG WKHUHLVJUHHQVSDFHDQGWKHSXEOLF VXVWDLQDEOHWRZQZLWKDXQLTXHFKDUDFWHUDQG SDUNDGMRLQLQJWKHULYHUVLGH KLJKTXDOLW\RIOLIHLQDSODFHZKHUHWKHQHHGV DQGDVSLUDWLRQVRIWKHFRPPXQLW\FDQEH x 7KH,QGXVWULDO$UHD7KLVDUHDRIWKH UHDOLVHG WRZQRXWWKH%XQFORG\5RDGDQGDOVR DORQJWKH5DWKRH5RDGFRPSULVHV ,QRUGHUWRDFKLHYHVDPHWKHIROORZLQJ LQGXVWULDOEXLOGLQJVDQGVKHGV GHYHORSPHQWSULQFLSOHVPXVWEHDGKHUHGWR LQFOXGLQJPHGLXPVFDOHHQJLQHHULQJ ZRUNVDQGODUJHFRPPHUFLDOXQLWV x 3URWHFWDQGHQKDQFHH[LVWLQJSRVLWLYH 7KLVLVDOVRZKHUHWKHEXONRIWKH DVSHFWVRIFKDUDFWHUHQYLURQPHQWDQG LQGXVWULDODQGHQWHUSULVHDQG KHULWDJH HPSOR\PHQWODQGVZLOOEHORFDWHGLQ WKHQHZSODQ x 3URPRWHFRPSDFWDQGVXVWDLQDEOH GHYHORSPHQWZKLOVWSURYLGLQJIRUWKH JURZWKDQGLPSURYHPHQWRIWKHWRZQ It is a policy of Carlow County Council: x 3URPRWHWKHVXVWDLQDEOH &$ 7RSURWHFWWKHWUDGLWLRQDOXUEDQVWUXFWXUHRI UHGHYHORSPHQWRINH\LQILOODQG VWUHHWVDQGODQHVLQWKHWRZQE\ RSSRUWXQLW\VLWHV PDLQWDLQLQJKLVWRULFEXLOGLQJOLQHVDQG PLQLPLVLQJURDGDQGMXQFWLRQZLGHQLQJ x $FKLHYHWKHJUHDWHVWPL[DQGUDQJHRI DQGZKHUHDSSURSULDWHUHVWRULQJKLVWRULF XVHVSRVVLEOHDQGSURWHFWWKHYLWDOLW\RI EXLOGLQJOLQHV WKHWRZQ¶VFRUHUHWDLODUHD &$ 7RSURWHFWWKHKLVWRULFXUEDQIDEULFRIILQH SORWVDQGVXEGLYLVLRQVE\DYRLGLQJ x 3ULRULWLVHWKHXVHDQGHQMR\PHQWRIWKH H[WHQVLYHFRQVROLGDWLRQRIWKHSORWVDQGWR WRZQVWUHHWVDQGVSDFHVE\ SURPRWHQDUURZGHHSSORWVLQ SHGHVWULDQVDQGF\FOLVWVZKLOH UHGHYHORSPHQWSURSRVDOVIURQWLQJWKHPDLQ SURYLGLQJIRUDOOPHDQVRIWUDYHODQG VWUHHWV LQFUHDVHGSURYLVLRQIRURIIVWUHHW SDUNLQJ &$ 7RSURWHFWWKHLQWHJULW\DQGFKDUDFWHURI LPSRUWDQWEXLOGLQJJURXSVLQWKHWRZQE\ x $WWUDFWDUHVLGHQWLDOSRSXODWLRQWRWKH HQVXULQJWKDWQHZGHYHORSPHQWDQG WRZQFHQWUHWKURXJKKLJKTXDOLW\ UHGHYHORSPHQWLVFRPSDWLEOHLQWHUPVRI DSSHDUDQFHDQGVFDOH GHVLJQ &$ 7RSURWHFWIHDWXUHVDQGVLWHVRIKLVWRULFDO x 3URPRWHVXVWDLQDEOHGHYHORSPHQWDQG LQWHUHVWDQGWKHLUFRQWH[WVHWWLQJLQDQ\ HQHUJ\HIILFLHQWWHFKQRORJLHV GHYHORSPHQWWKURXJKDSSURSULDWH VWDWXWRU\DQGSROLF\SURWHFWLRQ 6.4 Character Areas
7XOORZFRQWDLQVVHYHUDOFKDUDFWHUDUHDVWKDW DUHGLVWLQFWIURPRWKHUSDUWVRIWKHWRZQFHQWUH 7KHVHDUHDVLQFOXGH
x 7KHWRZQFHQWUHZKLFKLVODUJHO\WKH FRPSDFWWUDGLWLRQDOFRUHVXUURXQGLQJ 0DUNHW6TXDUH%XLOGLQJVFDOHLV FRQVLVWHQWO\WRVWRUH\V7KHVWUHHW IURQWDJHLVJHQHUDOO\FRQWLQXRXV SURYLGLQJHQFORVXUHDQGDQDFWLYH VWUHHWVFDSH
Tullow Draft LAP 2016-2022 - 44 - 0DS 7XOORZ&KDUDFWHU$UHDV
Tullow Draft LAP 2016-2022 - 45 - Tullow Draft LAP 2016-2022 - 46 - 6.5 Land Use and Function /8 7RVHFXUHDEURDGEDVHRIHPSOR\PHQWDQG HQWHUSULVHLQWKHWRZQWKURXJKVPDOOPHGLXP 3URYLGLQJRSSRUWXQLWLHVIRUEXVLQHVVDQG DQGODUJHVFDOHFRPPHUFLDOGHYHORSPHQW HPSOR\PHQWKRXVLQJUHFUHDWLRQDQGKHDOWK /8 7RUHTXLUHWKHLQFOXVLRQRIRSSRUWXQLWLHVIRU DUHDOOHVVHQWLDOLQJUHGLHQWVIRUKHDOWK\WRZQV PL[HGXVHVLQQHZGHYHORSPHQWLQWKHWRZQ 7KHIXWXUHRI7XOORZKLQJHVRQLWUHWDLQLQJDQG FHQWUH HQKDQFLQJDGLYHUVHUDQJHRIXVHVDQG DFWLYLWLHV([LVWLQJUDQJHRIDFWLYLWLHVLQ /8 7RUHLQIRUFHWRXULVPUHODWHGIDFLOLWLHVDQG 7XOORZ¶VFRUHUHWDLODUHDDUHRXWOLQHGLQ0DS VHUYLFHVDQGWRDFWLYHO\PDUNHW7XOORZ ,QUHFHQW\HDUVWKHUHKDVEHHQDWHQGHQF\IRU GHYHORSPHQWWRORFDWHRQWKHIULQJHRI7XOORZ /8 7RUHWDLQDQGLPSURYHWKHH[LVWLQJKRXVLQJ ZKLOVWODUJHSDUWVRIWKHWRZQFHQWUHVXFKDV VWRFNLQWKHWRZQFHQWUHDQGIRFXVRQ RSSRUWXQLWLHVIRUDUDQJHRIKRXVHKROGW\SHV WKHFDUSDUNRQWKH1HZ/LQN5RDG0LOO6WUHHW LQWKHWRZQ DQGEDFNODQGDUHDVUHPDLQXQGHUXVHGRU YDFDQW1HZKRXVLQJGHYHORSPHQWVLQWKH /8 7RLQYHVWLJDWHWKHIHDVLELOLW\RIGHYHORSLQJRI WRZQFHQWUHKDYHDOVREHHQOLPLWHGLQWHUPVRI ZDWHUUHODWHGDFWLYLWLHVVXEMHFWWRWKH TXDQWLW\DQGTXDOLW\UHIOHFWLQJWKHJUDGXDO UHTXLUHPHQWVRIWKH+DELWDWV'LUHFWLYH GHFUHDVHLQWKHWRZQFHQWUHSRSXODWLRQ'XH WRWKHLPEDODQFHLQWKHWRZQLQIDYRXURIWKH /8 7RHQFRXUDJHWRZQFHQWUHVHUYLFHVWRXULVP IULQJHWKLVKDVKDGDNQRFNRQHIIHFWRQWKH DQGOLYLQJDORQJWKHULYHUIURQWZKHUH WRZQFHQWUHZLWKLWVGHFOLQHXSXQWLOUHFHQWO\ DSSURSULDWH 7KLV/$3VHHNVWRFUHDWHDEDODQFHGDQGVHOI It is an objective of Carlow County Council: VXVWDLQLQJGHYHORSPHQWRIWKHWRZQE\ SURPRWLQJWKHJUHDWHVWPL[DQGUDQJHRI /82 7RH[WHQGWKHH[LVWLQJSHGHVWULDQQHWZRUN FRPSDWLEOHXVHVLQOLQHZLWKWKHFXUUHQW]RQLQJ DQGIDFLOLWLHVDQGORRNDWWKHSRVVLELOLW\RI REMHFWLYHIRUWRZQFHQWUHDFWLYLWLHVDQGE\ F\FOLQJIDFLOLWLHV VHHNLQJDEDODQFHEHWZHHQWKHGHYHORSPHQW RIWKHWRZQFHQWUHDQGWKHIULQJH /82 7RSURYLGHVPDOOVFDOHOHLVXUHUHFUHDWLRQ IDFLOLWLHVLQWKHWRZQFHQWUHVXFKDVIRU H[DPSOHDWHQQLVFRXUWEDVNHWEDOOFRXUW :LWKLQWKLV/$3WKHUHDUHDOVRRSSRUWXQLWLHVWR VNDWHSDUN FRQVROLGDWHWKHH[LVWLQJUHWDLOFRUH7KLV VKRXOGEHVXSSOHPHQWHGE\UHVLGHQWLDOXVH /82 7RUHTXLUHWKHLQWHJUDWLRQRIRIIVWUHHWFDU ZKHUHSRVVLEOH$EURDGHUUDQJHRIXVHV SDUNLQJIDFLOLWLHVLQWKHUHGHYHORSPHQWRI PD\EHDSSURSULDWHWRWKHULYHUIURQWLQFOXGLQJ ODUJHVLWHV VHUYLFHVWRXULVPDQGOLYLQJRSSRUWXQLWLHV$ QXPEHURIRSSRUWXQLW\VLWHVDUHDOVRLGHQWLILHG VHH6HFWLRQ WKDWPD\EHVXLWDEOHIRUD EURDGUDQJHRIWRZQFHQWUHXVHVLQFOXGLQJ UHWDLOHPSOR\PHQWDQGHQWHUSULVH
It is a policy of Carlow County Council:
/8 7RVHHNWRDWWUDFWDUHVLGHQWLDOSRSXODWLRQ DQGFRPPHUFLDODFWLYLW\LQWKHWRZQFHQWUH WKURXJKKLJKTXDOLW\GHVLJQZLWKD FRQWLQXRXVVWUHHWIURQWDJHZLWKDYDULHW\RI EXLOGLQJVZHOOPDLQWDLQHGDQGDWWUDFWLYH IDFDGHVDQGDFWLYHJURXQGIORRUVSURYLGLQJ DSOHDVDQWDQGGLVWLQFWLYHSODFH /8 7RSULRULWLVHWKHXVHDQGHQMR\PHQWRIWKH WRZQVWUHHWDQGVSDFHVE\SHGHVWULDQVDQG F\FOLVWVZKLOHSURYLGLQJIRUDOOPHDQVRI WUDYHODQGLQFUHDVHGSURYLVLRQRIRIIVWUHHW SDUNLQJ /8 7RSURPRWHWKHPL[HGXVHQDWXUHRIWKH WRZQDQGWRSUHVHUYHLWVUROHDVWKHFHQWUH RIEXVLQHVVDQGFRPPHUFHLQ7XOORZ
Tullow Draft LAP 2016-2022 - 47 -
Tullow Draft LAP 2016-2022 - 48 - 0DS 7XOORZ&RUH5HWDLO$UHD±%XLOGLQJ8VHV
Tullow Draft LAP 2016-2022 - 49 -
Tullow Draft LAP 2016-2022 - 50 - 6.6 Landscape x 6XUIDFHVLQFOXGLQJIRRWSDWKVDQG FDUULDJHZD\VDUHRISRRUTXDOLW\RU 7KHWRSRJUDSK\RI7XOORZULVHVWRWKHQRUWK UHVWULFWHG HDVWRIWKHWRZQRQFH\RXFURVVWKHEULGJHDQG x 6WUHHWIXUQLWXUHLVOLPLWHG DOVRLQDQRUWKZHVWHUO\GLUHFWLRQDORQJWKH x 6WUHHWOLJKWLQJLVXQDWWUDFWLYH &DVWOHGHUPRW5RDGDQGJUDGXDOO\LQDZHVWHUO\ x 6WUHHWSODQWLQJLVLQWHUPLWWHQWDQG GLUHFWLRQDQGHYHQVRXWRQFHSDVW$EEH\ x &DUSDUNLQJGRPLQDWHV 6WUHHWWRZDUGV/LGODQG7HVFR7KH5LYHU 6ODQH\DQGVXUURXQGLQJODQGVDUHGHVLJQDWHG DFDQGLGDWH6SHFLDO$UHDRI&RQVHUYDWLRQ It is a policy of Carlow County Council:
It is the policy of Carlow County Council: 60 7RHQVXUHWKDWDQ\QHZGHYHORSPHQWLV ZHOOFRQQHFWHGWRWKHUHVWRIWKHWRZQDQG / 7RFRQWULEXWHWRZDUGVWKHSURWHFWLRQRI LVZLWKLQDFRPIRUWDEOHZDONLQJGLVWDQFH FRXQW\DQGORFDOOHYHOODQGVFDSH GHVLJQDWLRQVIURPLQFRPSDWLEOH 60 7RVHHNWRUHGXFHFOXWWHULQWKHWRZQ GHYHORSPHQWV3URSRVDOVIRUGHYHORSPHQW FHQWUHDQGWRPDNHWKHWRZQFHQWUHD WKDWKDYHWKHSRWHQWLDOWRVLJQLILFDQWO\ SHGHVWULDQIULHQGO\SODFHE\LPSURYLQJ DGYHUVHO\LPSDFWXSRQWKHVHGHVLJQDWLRQV VDIHW\DQGFRPIRUWDQGLPSURYLQJ VKDOOEHDFFRPSDQLHGE\DQDVVHVVPHQW SHGHVWULDQIDFLOLWLHVVXFKDVVWUHHW RIWKHSRWHQWLDOODQGVFDSHDQGYLVXDO IXUQLWXUHIRRWSDWKVDQGFURVVLQJV LPSDFWVRIWKHSURSRVHGGHYHORSPHQW GHPRQVWUDWLQJWKDWODQGVFDSHLPSDFWV 60 7RLPSURYHWKHQHWZRUNRIZDONLQJURXWHV KDYHEHHQDQWLFLSDWHGDQGDYRLGHGWRD LQDQGWKURXJKWKHWRZQFHQWUHDQG OHYHOFRQVLVWHQWZLWKWKHVHQVLWLYLW\RIWKH EHWZHHQQRWDEOHIHDWXUHVDQGDWWUDFWLRQV ODQGVFDSHDQGWKHQDWXUHRIWKH GHVLJQDWLRQ 60 7RXWLOLVHH[LVWLQJIHDWXUHVVXFKDVWKH 5LYHU6ODQH\DVWKHIRFXVDQGEDVLVIRU GHYHORSLQJZDONLQJURXWHVFRQQHFWLQJWKH WRZQWRLWVZLGHUFRXQW\FRQWH[WVXEMHFWWR 6.7 Streets and Movement WKHUHTXLUHPHQWVRIWKH+DELWDWV'LUHFWLYH 60 7RUHGXFHXQQHFHVVDU\YHKLFXODUWUDIILF 7XOORZJUHZDURXQG0DUNHW6TXDUHWKHFHQWUH IURPWKHWRZQFHQWUH RIWKHWRZQDQGDVDUHVXOWKDVDV\VWHPRI QDUURZURDGVOHDGLQJRIIWKLVZLGHDUHDZKLFK It is an objective of Carlow County Council: SURYLGHVJRRGOHYHOVRISHUPHDELOLW\7KH PDLQDSSURDFKURDGVWRWKHPDLQVTXDUHDUH 602 7RGHVLJQDWHRIIVWUHHWFDUSDUNLQJDUHDVDW 0LOO6WUHHWWKH'XEOLQ5RDG 1 %ULGJH NH\VLWHV 6WUHHWDQGWKH%DOO\PXUSK\5RDG 602 7RXSJUDGHDQGUHVXUIDFH0DUNHW6TXDUH 7KHVXVWDLQDEOHGHYHORSPHQWRIXUEDQDUHDV DQGSRVVLEO\HOLPLQDWHVRPHFDUSDUNLQJ VSDFHVRXWVLGHWKH%DQNRI,UHODQGDQG UHOLHVRQPLQLPLVLQJUHOLDQFHRQWKHFDUWR LQFUHDVHSHGHVWULDQDFFHVVWRDOORZIRU FDUU\RXWGDLO\IXQFWLRQV$WWKHVDPHWLPHWKH WHPSRUDU\HYHQWVVXFKDVIDLUVIDUPHUV XVHRIHQYLURQPHQWDOO\IULHQGO\PRGHVRI PDUNHWVHWF WUDQVSRUWVXFKDVZDONLQJF\FOLQJDQGSXEOLF WUDQVSRUWVKRXOGEHHQFRXUDJHG 6.8 Public Spaces and Public Realm ,Q7XOORZWKHUHDUHWKUHHPDLQHOHPHQWVWKDW VXSSRUWWKHHQKDQFHPHQWRIWKHWRZQDQG 7KHSXEOLFUHDOPLQDWRZQLVFRPSULVHGRI WKHVHDUHHQKDQFLQJZDONLQJURXWHV VWUHHWVVTXDUHVSDUNVFRXUW\DUGVDOOH\V GHVLJQDWLQJFDUSDUNLQJDUHDVRXWVLGHRIWKH PDOOVFDUSDUNVDQGWKHVSDFHVEHWZHHQ WRZQFHQWUHDQGPRGLI\LQJWKHIORZRIWKURXJK EXLOGLQJVDOOWKRVHSDUWVRIWKHWRZQWKDWDUH WUDIILFWRLPSURYHFLUFXODWLRQDQGUHGXFH DFFHVVLEOHWRWKHSXEOLF)HDWXUHVZLWKLQ FRQJHVWLRQ SXEOLFUHDOPPD\LQFOXGHWUHHVVHDWVIORZHU SODQWHUVSXEOLFDUWDQGVFXOSWXUHWUDIILFVLJQV 7KHTXDOLW\RI7XOORZ¶VVWUHHWVDQGVSDFHVLV UDLOLQJVVWHSVZDWHUIHDWXUHVDQGDGYHUWLVLQJ FRPSURPLVHGZKHUH KRDUGLQJV7KHXVHRIVSDFHFDQYDU\IURPD SODFHWRPHHWRUUHOD[VWUHHWFDIHVDQG x :LUHVFDSHGRPLQDWHV UHVWDXUDQWVDYHQXHIRUHYHQWVDUHDIRU WUDGLQJWRDSODFHIRUSXEOLFDUWDQGVFXOSWXUH 6XFFHVVIXOSXEOLFUHDOPLQDWRZQLVHVVHQWLDO
Tullow Draft LAP 2016-2022 - 51 - LQWKHFUHDWLRQRIDQDWWUDFWLYHDQGVXVWDLQDEOH It is a policy of Carlow County Council: OLYLQJDQGZRUNLQJHQYLURQPHQWDQGWKH HVWDEOLVKPHQWRIDXQLTXHLGHQWLW\DQGVHQVH 35 7RSURPRWHGLYHUVLW\VWUXFWXUHDQG RISODFHIRUWKHWRZQ FRQWLQXLW\LQWKHSXEOLFUHDOPWKURXJKWKH FUHDWLRQPDLQWHQDQFHDQGUHVWRUDWLRQRI XUEDQVSDFHVVXFKDVVWUHHWVDQGVTXDUHV 0DUNHW6TXDUHDQGWKH5LYHUIURQWHVSHFLDOO\ DQGWRSURYLGHDSOHDVDQWVHQVHRISODFH DORQJWKH,QQHU5HOLHI5RDGDUHWKHSULQFLSDO DQGHQFORVXUH XUEDQVSDFHVLQ7XOORZ(DFKVSDFHLVXQLTXH LQIRUPDQGIXQFWLRQDQGHQULFKHVWKHXUEDQ 35 7RSULRULWLVHWKHLPSURYHPHQWRIDQG IDEULFRIWKHWRZQ8QIRUWXQDWHO\WKHYDOXHRI DFFHVVWRVXEMHFWWRWKHUHTXLUHPHQWVRI WKHVHVSDFHVKDVGHWHULRUDWHGZKHUH WKH+DELWDWV'LUHFWLYHWKHZDWHUIURQWDUHD GHYHORSPHQWKDVQRWEHHQV\PSDWKHWLFWRWKH DQGWKHUHWDLOFRUHIRUWKHHQMR\PHQWRI LQWHJULW\RIWKHSXEOLFGRPDLQ2WKHUIRFDO ERWKYLVLWRUVDQGUHVLGHQWVDOLNH VSDFHVLQFOXGHMXQFWLRQVDQGLQWHUVHFWLRQV ZKHUHDFWLYLW\DQGPRYHPHQWLVFRQFHQWUDWHG DQGFRUQHUEXLOGLQJVDUHSURPLQHQW It is an objective of Carlow County Council:
,Q7XOORZLWLVLPSRUWDQWWRSURWHFWWKH 352 7RXSJUDGHIRRWSDWKDQGURDGZD\VXUIDFHV GLVWLQFWLYHPDUNHWDQGDJULFXOWXUDOFKDUDFWHURI ZKHUHDSSURSULDWHDQGVHHNUHPRYDORI RYHUKHDGZLUHV WKHWRZQDQGWRHQKDQFHWKHTXDOLW\RIWKHEXLOW HQYLURQPHQWVRDVWRHQDEOHSHRSOHWR 352 7RHQULFKWKHORFDOVWUHHWVFDSHFKDUDFWHU FRQWLQXHOLYLQJLQDWWUDFWLYHDQGVDIH WKURXJKWKHSURYLVLRQRIDSSURSULDWH VXUURXQGLQJVDQGWRHQVXUHDVLPLODUVWDQGDUG VWUHHWSDYLQJIXUQLWXUHDQGSODQWLQJRI IRUIXWXUHJHQHUDWLRQV7KLVFDQEHDFKLHYHG VWUHHWWUHHVDWDSSURSULDWHORFDWLRQV WKURXJKSURPRWLQJQHZGHYHORSPHQWSODFHV DQGVSDFHVWKDWDUHRIKLJKTXDOLW\ZKLFK SURPRWHVXVWDLQDEOHOLIHVW\OHVDUH DSSURSULDWHO\VFDOHGDUHUHVSRQVLYHWRWKHLU FRQWH[WXDOVXUURXQGLQJVDPHQLW\KHULWDJH HQYLURQPHQWDQGODQGVFDSHRIWKHWRZQDQG FRQWULEXWHWRWKHIXWXUHSRWHQWLDORIWKHDUHD
7KHNH\DLPIRUSXEOLFVSDFHLQ7XOORZLVWR SODFHUHQHZHGHPSKDVLVRQWKHTXDOLW\DQG GHVLJQRISXEOLFVSDFHLQWKHWRZQ7KH5LYHU 6ODQH\WKHWRZQVPDUNHWVTXDUHDQGPDLQ DSSURDFKURDGVFDQEHUHJDUGHGDVWKH SULPDU\VWUXFWXULQJHOHPHQWVWKDWWRJHWKHU ZLWKWKH WKDQGWK&HQWXU\EXLOGLQJVWRFN FROOHFWLYHO\GHILQHWKHXQLTXHXUEDQFKDUDFWHU RI7XOORZ ,PSURYLQJSXEOLFVSDFHLQWKHWRZQZLOOLQYROYH x 8SJUDGLQJRIWKHNH\VWUHHWVDQG VSDFHV DQG x &RQVROLGDWLRQDQGDXJPHQWDWLRQ RIH[LVWLQJWUHHOLQHVDQGJURXSV DQGQHZVWUXFWXUHGWUHHSODQWLQJ RQWKHDSSURDFKHVWRWKHWRZQ DQGDORQJNH\URXWHV 7KHVHDUHMRLQWO\GHVLJQHGWRLQFUHDVHWKH DWWUDFWLYHQHVVRIWKHUHWDLOFRUHDVD GHVWLQDWLRQDQGVWUHQJWKHQWKHDSSURDFKHV DQGVHQVHRIDUULYDOLQWRWKHWRZQ
Tullow Draft LAP 2016-2022 - 52 - 0DS 7XOORZ3XEOLF6SDFHV
Tullow Draft LAP 2016-2022 - 53 -
Tullow Draft LAP 2016-2022 - 54 - 6.9 Projects .H\SURMHFWVLQYROYLQJWKHSXEOLFDQGSULYDWH VHFWRUVZLOOSOD\DQLPSRUWDQWUROHLQSURPRWLQJ VXVWDLQDEOHGHYHORSPHQWIRU7XOORZ7RZQ x 7RZQ3DUN ([WHQGDQGHQKDQFHWKLV &HQWUH7KHIROORZLQJDUHSURMHFWVWKDWZRXOG DUHDVRDVWRSURYLGHJUHDWHU JRVRPHZD\LQLPSURYLQJWKHSXEOLFUHDOP FRQQHFWLYLW\WRWKHWRZQFHQWUHDQG DQGRYHUDOODWWUDFWLYHQHVVRIWKHWRZQ UHVLGHQWLDODUHDV x %ULGJH 3RZHUZDVKLQJWKHVWRQHRQ x %ULGJH6WUHHW0DUNHW6TXDUH WKHEULGJHDQGSDLQWLQJWKHROGODPS &KXUFK6WUHHW0LOO6WUHHW$EEH\ OLJKWLQJSUHVHQW7KHVHDORQJZLWKWKH 6WUHHW 5HVXUIDFLQJRIWRZQFHQWUH UDLVHGER[SODQWLQJWKDWLVSUHVHQWLQ DUHDVWRHQKDQFHSHGHVWULDQ VXPPHUPRQWKVZLOOKXJHO\HQKDQFH HQYLURQPHQW WKLVPDLQFRUULGRUWKURXJKWKHWRZQ x 7RZQ&HQWUH1HLJKERXUKRRG x 0LOO6WUHHW,QQHU5HOLHI5RDG&DU &HQWUH 5HPRYDORIZLUHVFDSHIURP 3DUN6LWH 'HYHORSPHQWWR WRZQFHQWUHVWUHHWV FRPSOHPHQWDQGHQKDQFHH[LVWLQJ FKDUDFWHUDQGKHULWDJHRI7XOORZ 7KHIROORZLQJLPDJHVVKRZKRZDQXPEHURI NH\DUHDVZLWKLQWKH7XOORZ3ODQDUHDFDQEH x 7KH7KRPDV7UD\QRU5RDG 7KLV WUDQVIRUPHGLQWRDWWUDFWLYHFLYLFVSDFHV DUHDZRXOGEHQHILWIURPUHJHQHUDWLRQ DQGDOVRWKLVVKRXOGLQFOXGHGHVLJQV ZKLFKUHODWHWRWKH5LYHUUXQQLQJLQ FORVHSUR[LPLW\WRWKHVLWH
Tullow Draft LAP 2016-2022 - 55 -
)LJ 9LHZWRVRXWKRIEULGJHLQ7XOORZ
)LJ ,QGLFDWLYH7UDQVIRUPDWLRQRIYLHZWRVRXWKRIEULGJHLQ7XOORZ
Tullow Draft LAP 2016-2022 - 56 -
)LJ 9LHZRI0DUNHW6TXDUH
)LJ ,QGLFDWLYH7UDQVIRUPDWLRQRI0DUNHW6TXDUH
Tullow Draft LAP 2016-2022 - 57 -
)LJ 9LHZRIVRXWKHUQEDQNRI5LYHU6ODQH\ RSSRVLWH6XSHUYDOX&DUSDUN
)LJ ,QGLFDWLYH7UDQVIRUPDWLRQRIVRXWKHUQEDQNRI5LYHU6ODQH\ RSSRVLWH6XSHUYDOX&DUSDUN
Tullow Draft LAP 2016-2022 - 58 - 6.10 Guidelines for Future 7KHILQHJUDLQSORWVXEGLYLVLRQV LHGHHS Development SORWVZLWKQDUURZVWUHHWIURQWDJH RIWKHWRZQ FHQWUHVKRXOGLQIRUPWKHGHYHORSPHQWRIDQ\ IXWXUHWRZQFHQWUHRUDGMDFHQWGHYHORSPHQW 2QEURZQILHOGVLWHVWKHUHDUHRSSRUWXQLWLHVWR Sustainability UHWDLQVRPHRIWKHODUJHUSORWVEXWDOVRWR FUHDWHVPDOOHUSDUFHOVRIPL[HGVL]HIRU 6XVWDLQDELOLW\FULWHULDIRUIXWXUHGHYHORSPHQW GHYHORSPHQW,WLVLPSRUWDQWWKDWWKLVHVVHQWLDO VKRXOGEHFRQVLGHUHGDWPDFURDQGPLFUR HOHPHQWRIFKDUDFWHULGHQWLW\DQGGLYHUVLW\LV OHYHOV)XUWKHUVXVWDLQDEOHREMHFWLYHVVKRXOG UHWDLQHGLQQHZGHYHORSPHQWE\SULRULWLVLQJ QRWRQO\VHHNWRVDWLVI\HQYLURQPHQWDOFULWHULD VHQVLWLYHLQILOOGHYHORSPHQWDQGE\ EXWDOVRHQVXUHWKDWVRFLDODQGHFRQRPLF GLVFRXUDJLQJDPDOJDPDWLRQRILQGLYLGXDOSORWV REMHFWLYHVDUHDFKLHYHG LQWRODUJHUVLWHVE\GHYHORSHUV $WDPDFUROHYHOSURSRVHGGHYHORSPHQWVKRXOG $OWKRXJKGHYHORSPHQWRIVRPHH[LVWLQJODUJH VHHNWR VLWHVLQWKHWRZQLVOLNHO\WREHDSSURDFKHGLQD PRUHFRPSUHKHQVLYHPDQQHUWKHEUHDNLQJXS x 8WLOLVHODQGHIIHFWLYHO\ RIH[LVWLQJODUJHVLWHVLQWRVPDOOHUSDUFHOVZLWK VKDUHGFRXUW\DUGVZLOOEHHQFRXUDJHG x (QVXUHDQDGHTXDWHPL[RIXVHVDUH SDUWLFXODUO\RQWKRVHSDUWVRIWKHVLWHIURQWLQJ SURYLGHGORFDOO\LQRUGHUWRUHGXFHWKH H[LVWLQJVWUHHWV QHHGWRWUDYHODQG Built Form x 0D[LPLVHDFFHVVWRVXVWDLQDEOHPRGHV RIWUDQVSRUWLQFOXGLQJF\FOLQJDQG 1HZGHYHORSPHQWVVKRXOGDGDSWWKHSHULPHWHU SXEOLFWUDQVSRUW EORFNW\SRORJ\DQGUHVSHFWWKHHVWDEOLVKHG KLVWRULFDOVWUHHWSDWWHUQ7KHSHULPHWHUEORFN $WDVLWHSODQQLQJOHYHOVXVWDLQDEOHXUEDQIRUP W\SRORJ\SURPRWHVDXQLW\RIEXLOWIRUPLQWHUPV VKRXOGHQVXUHDSSURSULDWHPLFURFOLPDWHVDUH RIFRQWLQXLW\RIEXLOGLQJOLQHZKLOVWIDFLOLWDWLQJD HVWDEOLVKHGEHWZHHQEXLOGLQJV(TXDOO\ ILQHJUDLQDQGYDULHW\RISORWVL]HVDQGEXLOGLQJ VXVWDLQDEOHXUEDQIRUPVVKRXOGHQVXUHWKDW KHLJKWVZLWKLQHDFKEORFN EXLOGLQJVUHFHLYHDGHTXDWHOHYHOVRIOLJKW YHQWLODWLRQDQGSDVVLYHVRODUHQHUJ\ZKLOVW Height and Scale PLQLPLVLQJKHDWORVVDQGH[SRVXUH $WWKLVVFDOHSURSRVDOVVKRXOGDOVRLQYHVWLJDWH 7KHFRQWH[WKHLJKWRIWKHDUHDLVLQIOXHQFHGE\ WKHIHDVLELOLW\RI WKHIROORZLQJSDUDPHWHUV x $OWHUQDWLYHHQHUJ\VRXUFHV x 5HVSHFWLQJH[LVWLQJVFDOHDQG W\SRORJLHVRIWKHWRZQ x 6XVWDLQDEOH8UEDQ'UDLQDJH6\VWHPV 68'V DQG x $FKLHYLQJVXVWDLQDEOHGHQVLWLHVRI GHYHORSPHQW x :DVWHUHF\FOLQJIDFLOLWLHV x 0DLQWDLQLQJDKXPDQVFDOHWRVWUHHWV $WDPLFUROHYHOEXLOGLQJGHVLJQVVKRXOGVHHN VSDFHVDQGWKHULYHUIURQW WR x 5HGXFHHQHUJ\GHPDQGLQFOXGLQJ x 3URYLGLQJDSSURSULDWHOHYHOVFRQWLQXLW\ WKHUPDOHQHUJ\IRUVSDFHDQGZDWHU DQGHQFORVXUH KHDWLQJDQGHOHFWULFDOHQHUJ\IRU SRZHUDQGOLJKWLQJ x 5HIOHFWLQJORFDOFRQVWUDLQWVVXFKDV SURWHFWHGVWUXFWXUHVDQGH[LVWLQJ x 0D[LPLVHVRODUSRWHQWLDODQGDVSHFW GHYHORSPHQW DQG x (PSKDVLVLQJSODFHDQGORFDWLRQ x 3URYLGHIRUEXLOGLQJHYROXWLRQWKURXJK DGDSWDEOHGHVLJQ x (PSKDVLVLQJVLJQLILFDQWXVHRUIXQFWLRQ x 0DLQWDLQLQJTXDOLW\SULYDWHDQGVHPL Urban Grain SULYDWHRSHQVSDFHV
Tullow Draft LAP 2016-2022 - 59 - 1HZEXLOGLQJVRQWKHULYHUIURQWVKRXOGEHD PLQLPXPRIWZRVWRUH\VZLWKH[FHSWLRQDOO\ZHOO GHVLJQHGSURSRVDOVXSWRIRXUVWRUH\VEHLQJ FRQVLGHUHGRQWKHLULQGLYLGXDOPHULWV+HLJKW YDULDWLRQZLOOEHHQFRXUDJHGWKURXJKGLYHUVLW\ RIEXLOGLQJXVDJHDQGW\SH 7KHFRQWH[WKHLJKWRIWKHWRZQFHQWUHLV JHQHUDOO\WZRWRWKUHHVWRUH\V,WPD\EH SRVVLEOHIRUKLJKHUEXLOGLQJVWRDFKLHYHWKLV WKURXJKJRRGTXDOLW\GHVLJQKRZHYHUDQG SURSRVDOVLQH[FHVVRIWKLVFRQWH[WKHLJKWZLOO EHH[DPLQHGRQWKHLULQGLYLGXDOPHULW
Access and Car Parking
,QGLYLGXDORUµRZQGRRU¶DFFHVVVKRXOGEH UHTXLUHGZKHUHIHDVLEOH9HKLFXODUDFFHVVWR WKHUHDUVKRXOGEHFDUHIXOO\FRQVLGHUHGKDYLQJ UHJDUGWRWKHWUDGLWLRQRISURYLGLQJDUFKHG ODQHVHLWKHUEHWZHHQRUXQGHUEXLOGLQJV,Q SDUWLFXODUFDUHPXVWEHWDNHQWRDYRLGRYHU VL]HGRUFUXGHO\GHVLJQHGJDWHVRUUDPSVWKDW XQGXO\GLVUXSWWKHFRQWLQXLW\RIWKH VWUHHWVFDSH ,QODUJHUGHYHORSPHQWVWKHLPSDFWRIQHZ VWUHHWDFFHVVRQWKHFRQWLQXLW\RIWKHVWUHHW VKRXOGEHPLQLPLVHG6LGHODQHRUVWUHHW DFFHVVVKRXOGEHFRQVLGHUHGZKHUHSRVVLEOH LQSUHIHUHQFHWRDFFHVVRIIPDLQWRZQFHQWUH VWUHHWV'HYHORSPHQWSURSRVDOVIRUODUJHVLWHV ZLOOEHUHTXLUHGWRDFFRPPRGDWHSURYLVLRQIRU PXOWLOHYHOFDUSDUNLQJ'HYHORSPHQWVZKHUH VLJQLILFDQWORDGLQJDQGXQORDGLQJLVOLNHO\WR RFFXUZLOOEHUHTXLUHGWRVHHNVROXWLRQVRQVLWH
Tullow Draft LAP 2016-2022 - 60 - CHAPTER 7 TRANSPORTATION AND MOVEMENT
7.1 Introduction &RXQFLOLVWRSURYLGHDE\SDVVRIWKHWRZQ FHQWUHWRWKHQRUWKZKLFKZRXOGUHPRYHWKHE\ 7KHDYDLODELOLW\RIDQHIILFLHQWWUDQVSRUWV\VWHP SDVVDEOHWUDIILFIURPWKHWRZQFHQWUH8QWLO LVYLWDOIRUWKHGHYHORSPHQWRI7XOORZDQGLWV VXFKWLPHDVWKLVLVGHOLYHUHGLQWHUYHQWLRQVZLOO H[SDQVLYHKLQWHUODQGDVLWZLOOHQKDQFHWKH EHXQGHUWDNHQWRDOOHYLDWHWKHFRQJHVWLRQ,WLV H[SHFWHGWKDWZRUNZLOOFRPPHQFHLQWR FDSDELOLW\RIWKHWRZQWRVXSSRUWEXVLQHVV ZLGHQWKHEULGJHDWWKHLQWHUVHFWLRQRIWKH1 FRPPHUFLDODQGPDQXIDFWXULQJDFWLYLWLHVWKDW DQGWKH5ZKLFKLVH[SHFWHGWRSURYLGHWKH DUHFUXFLDOIRUWKHWRZQVFRQWLQXHG VSDFHQHFHVVDU\IRUDURXQGDERXWDWWKLV GHYHORSPHQW MXQFWLRQ7KLVZLOOPDNHULJKWWXUQLQJ PDQRHXYUHVHDVLHUDQGZLOOFRQWULEXWHWR 7KHSURYLVLRQRIWUDQVSRUWLQIUDVWUXFWXUHSOD\V HDVLHUWUDIILFPRYHPHQWWKURXJKWKHWRZQ DFHQWUDOUROHLQWKHHFRQRP\RIDQ\XUEDQ FHQWUH FHQWUHZLWKWKHDWWUDFWLYHQHVVRIDORFDWLRQIRU EXVLQHVVDQGUHVLGHQWLDOGHYHORSPHQW 7UDIILFFRQJHVWLRQDW&KXUFK6WUHHWDQG%ULGJH GHSHQGHQWRQWKHSURYLVLRQRIDIXOOUDQJHRI 6WUHHWDWSHDNPRUQLQJDQGHYHQLQJWLPHVLV WUDQVSRUWDWLRQVHUYLFHV7KH1QDWLRQDOURXWH DOVRSUREOHPDWLFLQWKHWRZQFHQWUH UXQQLQJWKURXJKWKHWRZQWKHSUR[LPLW\WRWKH 0 PRWRUZD\DQGWKHUHJLRQDOURDGQHWZRUN 7KHSUHYLRXV/$3LQGLFDWHGDUHOLHI URDGV\VWHPDURXQGWKHWRZQWRIDFLOLWDWHE\ VHUYLQJWKHWRZQQDPHO\WKH55DQG SDVVDEOHWUDIILFXVLQJWKHUHJLRQDOURDG WKH5DUHLPSRUWDQWLQIUDVWUXFWXUDODVVHWV QHWZRUNWRHDVWFRDVWPLGODQGVDQGWKH ZKLFKFDQFRQWULEXWHWRWKHIXWXUHVXVWDLQDEOH 1DWLRQDO3ULPDU\5RDGFRUULGRU7KLVREMHFWLYH GHYHORSPHQWRIWKHDUHD LVDOVRFRQWDLQHGZLWKLQWKLV/$3DQGE\ IDFLOLWDWLQJE\SDVVDEOHWUDIILF+*9VLQ ,QDGGLWLRQWKHHIIHFWLYHLQWHJUDWLRQRIODQGXVH SDUWLFXODUZRXOGEHGLYHUWHGIURPWKHWRZQ DQGWUDQVSRUWDWLRQZLOOJHQHUDWHDQGUHLQIRUFH FHQWUHWKHUHE\PDLQWDLQLQJDPRUHDSSURSULDWH VXVWDLQDEOHVHWWOHPHQWSDWWHUQVDQGPDNHWKH HQYLURQPHQWDOTXDOLW\WRWKHWRZQFHQWUH PRVWHIILFLHQWXVHRIODQG,QWKLVUHJDUGWKH 3ODQKDVDVLJQLILFDQWSDUWWRSOD\LQVHHNLQJWR GHOLYHUVXVWDLQDEOHGHYHORSPHQWLQWRWKHIXWXUH DQGPLQLPLVLQJWKHQHHGWRWUDYHOE\FDU
7.2 Challenges
$FFHVVDQGFLUFXODWLRQURXWHVLQ7XOORZDUH ODUJHO\GHILQHGE\WKHKLVWRULFDOGHYHORSPHQW RIWKHWRZQDQGLWVUHODWLRQVKLSWRLWV WRSRJUDSK\DVZHOODVWKH5LYHU6ODQH\ZKLFK DFWDVDEDUULHUDQGUHVWULFWVDFFHVV3ULYDWH FDULVWKHPDLQPHDQVRIDFFHVVLELOLW\LQ7XOORZ ZLWKFRQVLGHUDEOHDPRXQWVRIWUDIILFUXQQLQJ 7.3 Strategic Approach WKURXJKWKHWRZQ &DUORZ&RXQW\&RXQFLOUHFRJQLVHVWKDWWKH 3HUPHDELOLW\ZLWKLQWKHWRZQFHQWUHLV FXUUHQWWUHQGVLQWUDQVSRUWDWLRQDUH UHVWULFWHGWRDQH[WHQWDVPDQ\VWUHHWVRIIWKH XQVXVWDLQDEOHLQSDUWLFXODUWKHLQFUHDVHLQ 1DUHH[WUHPHO\QDUURZZLWKVRPHEHLQJ YHKLFXODUWUDIILFWKURXJKRXWWKHWRZQZKLFKLQ RQHZD\V\VWHPV$OVRFRQQHFWLRQVDQG WXUQFDXVHVFRQJHVWLRQDQGUHGXFHVWUDIILF OLQNDJHVEHWZHHQUHVLGHQWLDODUHDVEDFNLQWR IORZHVSHFLDOO\DWSHDNWLPHVVXFKDVVFKRROV WKHWRZQFHQWUHDUHSRRU7KHPDLQDUWHU\ EXVLQHVVHVDQGIDFWRULHVRSHQLQJFORVLQJ WKURXJKWKHWRZQQDPHO\WKH1H[SHULHQFHV KRXUV7KH&RXQFLOWKHUHIRUHKDVD FRQJHVWLRQSDUWLFXODUO\RQ%ULGJH6WUHHWDQG UHVSRQVLELOLW\WRHQFRXUDJHDPRGDOFKDQJH &KXUFK6WUHHWDWWKHSHDNKRXUWLPHV7KH IURPSULYDWHFDUXVDJHWRPRUHVXVWDLQDEOH PHGLXPWRORQJWHUPREMHFWLYHRIWKH PHDQVVXFKDVZDONLQJF\FOLQJDQGLQFUHDVHG XVDJHRISXEOLFWUDQVSRUW
Tullow Draft LAP 2016-2022 - 61 -
7KHSURYLVLRQRIDIXOOUDQJHRIWUDQVSRUWDWLRQ It is the policy of Carlow County Council: VHUYLFHVIRUWKRVHUHVLGLQJLQDQGDOVRIRU WKRVHZRUNLQJLQDQGYLVLWLQJ7XOORZLVFUXFLDO TP 1: 7RFRQWLQXHWRSURPRWHDPRGDOVKLIWIURP LQSURPRWLQJDPRGDOFKDQJHWRDPRUH SULYDWHFDUXVHWRZDUGVLQFUHDVHGXVHRI PRUHVXVWDLQDEOHPRGHVRIWUDQVSRUWVXFK VXVWDLQDEOHWUDQVSRUWQHWZRUNLQWKHWRZQDQG DVF\FOLQJZDONLQJDQGSXEOLFWUDQVSRUW LWVHQYLURQV DQGWRLPSOHPHQWWKHLQLWLDWLYHVFRQWDLQHG LQ*RYHUQPHQW¶V³6PDUWHU7UDYHO$ 7KHDSSURDFKLVWR 6XVWDLQDEOH7UDQVSRUW)XWXUH ´
TP 2: 7RLPSURYHWKHSHGHVWULDQHQYLURQPHQW 3ODFHDVWURQJHUHPSKDVLVRQ DQGSURPRWHWKHGHYHORSPHQWRIDQHWZRUN VXVWDLQDEOHPRGHVRIWUDQVSRUWVXFK RISHGHVWULDQURXWHVZKLFKOLQNUHVLGHQWLDO DVZDONLQJF\FOLQJDQGSXEOLF DUHDVZLWKUHFUHDWLRQDOHGXFDWLRQDO WUDQVSRUWSDUWLFXODUO\IRUVKRUWWULSV HPSOR\PHQWDQGWRXULVWGHVWLQDWLRQVWR DQGMRXUQH\VWRZRUNDQGVFKRRO FUHDWHDSHGHVWULDQHQYLURQPHQWWKDWLV VDIHDQGDFFHVVLEOHE\DOO ,PSURYHDQGHQKDQFHFRQQHFWLYLW\ TP 3: 7RVXSSRUWFRRUGLQDWLRQE\WUDQVSRUW EHWZHHQWKHWRZQFHQWUHUHVLGHQWLDO SURYLGHUVWRSURPRWHOLQNHGXSWUDQVSRUW DUHDVFRPPXQLW\IDFLOLWLHVWRXULVW VHUYLFHVHQDEOLQJFRPSOHWHFRYHUDJHRI DWWUDFWLRQVDQGDPHQLW\DUHDVZKHUH 7XOORZWKURXJKWKHFUHDWLRQRIDQ LQWHJUDWHGWUDQVSRUWKXE7KLVZLOOEH DSSURSULDWH GHYHORSHGE\SURYLGLQJEXVVWRSVEH\RQG 0DUNHW6TXDUHF\FOHSDUNLQJVWDQGVDW ,PSURYHWUDQVSRUWDQGPRYHPHQW YDULRXVORFDWLRQVLQWKHWRZQDQGE\ ZLWKLQWKHWRZQDQGUHGXFH SURYLGLQJJRRGSHGHVWULDQIDFLOLWLHV FRQJHVWLRQ WKURXJKRXW7XOORZ TP 4: 7RVXSSRUWWKH*RYHUQPHQW¶V(OHFWULF 7.4 Smarter Travel 7UDQVSRUW3URJUDPPH±E\ IDFLOLWDWLQJWKHUROORXWRIEDWWHU\FKDUJLQJ 7KH7XOORZ'UDIW/RFDO$UHD3ODQUHFRJQLVHV LQIUDVWUXFWXUHIRUHOHFWULFYHKLFOHVDW DQGVXSSRUWVWKHLPSRUWDQFHRIVXVWDLQDEOH YDULRXVORFDWLRQVWKURXJKRXW7XOORZ WUDQVSRUWLQFOXGLQJWKHHIIHFWLYHLQWHJUDWLRQRI ODQGXVHDQGWUDQVSRUWDQGHQFRXUDJLQJD It is an objective of Carlow County Council: PRGDOVKLIWIURPSULYDWHWUDQVSRUWWRSXEOLF WUDQVSRUWZDONLQJDQGF\FOLQJ,QWKH TO 1: 7RSURYLGHDSSURSULDWHIDFLOLWLHVIRU &HQVXVWKHPRVWSRSXODUPHDQVRIWUDYHOOLQJ SHGHVWULDQVDQGIRUSHRSOHZLWKVSHFLDO PRELOLW\QHHGVLQOLQHZLWKWKHDLPVRIWKH WRZRUNZDVE\FDU GULYHU ZLWKWKLVPRGH (XURSHDQ&KDUWHURI3HGHVWULDQ5LJKWV DFFRXQWLQJIRURIDOOMRXUQH\V SHUVRQVFRPPXWHGXVLQJSXEOLFWUDQVSRUW EXV TO 2: 7RSURPRWHDQGIDFLOLWDWHWKHSURYLVLRQRI RUUDLO 7KHDYHUDJHMRXUQH\WLPHZDV VHFXUHSDUNLQJDUHDVIRUELF\FOHVLQ7XOORZ PLQXWHVDQGRIZRUNHUVIDFHGD WRZQFHQWUHDQGDWNH\WRXULVWDWWUDFWLRQV FRPPXWLQJWLPHLQH[FHVVRIPLQXWHV WKURXJKRXWWKHWRZQ RIDOOKRXVHKROGVLQ7XOORZKDGWZRRU PRUHFDUV 7KHGUDIW/$3KDVKDGGXHUHJDUGWR DSSOLFDEOHQDWLRQDOOHJLVODWLRQDQGSROLF\ LQFOXGLQJ6PDUWHU7UDYHO $1HZ7UDQVSRUW 3ROLF\IRU,UHODQG ZKLFKVHWVRXW ILYHJRDOVIRUVXVWDLQDEOHWUDQVSRUWDWLRQ7KH 6SDWLDO3ODQQLQJDQG1DWLRQDO5RDGV *XLGHOLQHVIRU3ODQQLQJ$XWKRULWLHV 7KH 7UDIILF0DQDJHPHQW*XLGHOLQHV DQGWKH 'HVLJQ0DQXDOIRU8UEDQ5RDGVDQG6WUHHWV 7KLVQHZPDQXDODLPVWRHQGWKH SUDFWLFHRIGHVLJQLQJVWUHHWVDVWUDIILF FRUULGRUVDQGLQVWHDGIRFXVHVRQWKHQHHGVRI 7.5 Transport Infrastructure SHGHVWULDQVF\FOLVWVDQGSXEOLFWUDQVSRUW XVHUV 7XOORZKDVJRRGLQIUDVWUXFWXUHLQWHUPVRILWV URDGVQHWZRUN,WKDVDFFHVVWRDLUSRUWVDQG
Tullow Draft LAP 2016-2022 - 62 -
VHDSRUWVEHLQJORFDWHG NPIURP'XEOLQ *RYHUQPHQW'HSDUWPHQWVDQGRWKHU NPIURP:DWHUIRUGDQGNPIURP DJHQFLHVWKURXJKWKHSURYLVLRQRI 5RVVODUH DSSURSULDWHVLJQDJHPLQLPLVLQJRU UHPRYLQJH[LVWLQJWUDIILFKD]DUGVDQG 7KHWRZQLVDOVRVWUDWHJLFDOO\ORFDWHGRQWKH SUHYHQWLQJWKHFUHDWLRQRIDGGLWLRQDORU 1DQGZLWKLQPLQXWHVIURPWKH0 'XEOLQ QHZWUDIILFKD]DUGV WR:DWHUIRUGPRWRUZD\'XHWR-XQFWLRQDQG RQWKH0 EHLQJZLWKLQPLQXWHVIURP 7XOORZWKLVLVDQLPSRUWDQWIDFWRUDIIHFWLQJWKH It is an objective of Carlow County Council: SK\VLFDOH[SDQVLRQRIWKHWRZQ7KHFORVH SUR[LPLW\RILQWHUFKDQJHVDVZHOODVEHLQJRQ TO 3: 7RLQYHVWLJDWHWKHIHDVLELOLW\RISURYLGLQJ WKH1OHDGLQJWR'XEOLQWKHVHLQIOXHQFHWKH WKH7XOORZ5HOLHI5RDGWRIDFLOLWDWHE\ ORFDWLRQDQGWKHYLDELOLW\RIQHZLQGXVWULDODQG SDVVDEOHWUDIILFXVLQJWKH1RUWKH5 EXVLQHVVDUHDVWKDWDUHGHYHORSHGDV 5RU5 DFFHVVLELOLW\WRWKHVHPDMRUWUDQVSRUWFRUULGRUV TO 4: 7RFRQWLQXHWRXSJUDGHWKHFRQGLWLRQRI DUHDQLPSRUWDQWEXVLQHVVGHWHUPLQDQW URDGDQGIRRWSDWKVXUIDFHVLQFRQMXQFWLRQ ZLWKWKH&RXQFLO¶VDQQXDOURDGV 7KHWRZQLVDOVRZLWKLQNPRI&DUORZNP SURJUDPPH RI1DDVDQG NPIURP.LONHQQ\DQGLVDOVR VHUYHGE\WKH5UHJLRQDOURXWHIURPWKH TO 5: 7RPRQLWRUDQGXSJUDGHZKHUHQHFHVVDU\ HDVWFRDVWWRWKHPLGODQGVWKH5WR&DUORZ WKHVWDQGDUGRISXEOLFOLJKWLQJWKURXJKRXW DQGWKH5WR&DVWOHGHUPRW WKHWRZQ It is the policy of Carlow County Council: TO 6: 7RLQYHVWLJDWHDQGVHHNWKHLPSURYHPHQW RISHGHVWULDQIDFLOLWLHVWKURXJKRXWWKHWRZQ TP 5 7RHQVXUHWKDWWKHURDGDQGVWUHHWQHWZRUN TO 7: 7RLPSURYHGHILFLHQFLHVLQSDYHPHQW RI7XOORZLVVDIHDQGFRQYHQLHQWWKDWLW VXUIDFHTXDOLW\DQGJHQHUDODOLJQPHQWDQG KDVDGHTXDWHFDSDFLW\WRDFFRPPRGDWH WRSURWHFWIXWXUHURDGOLQHVZKHUHUHTXLUHG PRWRULVHGWUDIILFDQGQRQPRWRULVHG PRYHPHQWVWKDWLWKDVDKLJK HQYLURQPHQWDOTXDOLW\ZLWKDSSURSULDWH DGMDFHQWGHYHORSPHQWDQGEXLOWIRUP 7.6 Public Transport SDUWLFXODUO\LQWKHFDVHRIXUEDQVWUHHWV DQGVWUHHWVFDSHVDQGWKDWDGHTXDWH %RWK%XV(LUHDQQDQGSULYDWHRSHUDWRUVUXQD SDUNLQJIDFLOLWLHVDUHSURYLGHGWRVHUYHWKH UHJXODUEXVVHUYLFHVHUYLQJWKHDUHD7KHUHLV QHHGVRIWKHWRZQ DVHUYLFHEHWZHHQ'XEOLQDQG%XQFORG\ZKLFK SDVVHVWKURXJK7XOORZHDFKGD\$OVR-- ,QWKLVUHJDUGWKHSULQFLSOHVDSSURDFKHV .DYDQDJK¶V%XVUXQVDQLQWHUFRXQW\VHUYLFH DQGVWDQGDUGVDVVHWRXWLQUHOHYDQW ZKLFKZRXOGDOVRLQFOXGH7XOORZDVRQHRILWV QDWLRQDOSROLF\VKDOOLQIRUPIXWXUHWUDQVSRUW VWRSV LQIUDVWUXFWXUHDQGXUEDQGHYHORSPHQW7KLV VKDOOLQFOXGHWKH6SDWLDO3ODQQLQJDQG &XUUHQWO\EXVHVVWRSRQWKHURDGVLGHLQ 1DWLRQDO5RDGV*XLGHOLQHVWKH 0DUNHW6TXDUHZKLFKFDQFDXVHFRQJHVWLRQDW 6XVWDLQDEOH5HVLGHQWLDO'HYHORSPHQWLQ EXV\WLPHV,WZRXOGEHSUHIHUDEOHLID 8UEDQ$UHDV*XLGHOLQHVIRU3ODQQLQJ GHVLJQDWHGEXVVWRSVKHOWHUZHUHSURYLGHG $XWKRULWLHV DQGDFFRPSDQ\LQJ8UEDQ SRVVLEO\RQWKH'XEOLQ5RDGQHDU$OGL)O\QQV 'HVLJQ0DQXDO WKH7UDIILF 6HUYLFH6WDWLRQRURQWKH%XQFORG\5RDGQHDU 0DQDJHPHQW*XLGHOLQHVWKH7UDIILF 2¶7RROHV6HUYLFH6WDWLRQZKHUHDPXFKVDIHU DQG7UDQVSRUW$VVHVVPHQW*XLGHOLQHV WKH'HVLJQ0DQXDOIRU8UEDQ5RDGV VWRSSLQJSRLQWFRXOGEHSURYLGHGIRUERWKWUDIILF DQG6WUHHWV WKH15$'HVLJQ DQGWKRVHXVLQJWKHVHEXVVHUYLFHV 0DQXDOIRU5RDGVDQG%ULGJHV DV DSSURSULDWHWRWKHUHJLRQDOURDGQHWZRUN It is the policy of Carlow County Council: RXWVLGHDUHDVVXEMHFWWRDUHGXFHGXUEDQ VSHHGOLPLW DQGDQ\XSGDWHVRU TP 7: 7RFRRSHUDWHZLWKSXEOLFWUDQVSRUWVHUYLFH IRUWKFRPLQJJXLGHOLQHVLQUHODWLRQWRVWUHHW SURYLGHUVWRHQVXUHWKDWDGHTXDWHSXEOLF GHVLJQDQGZDONLQJF\FOLQJIDFLOLWLHV WUDQVSRUWVHUYLFHVDUHSURYLGHGWRWKH WRZQ TP 6: 7RSURPRWHURDGDQGWUDIILFVDIHW\ PHDVXUHVLQFRQMXQFWLRQZLWKUHOHYDQW TP 8: 7RVXSSRUWWKHSURYLVLRQRISXEOLFWUDQVSRUW VHUYLFHVE\UHVHUYLQJODQGLQVXLWDEOH
Tullow Draft LAP 2016-2022 - 63 -
ORFDWLRQVIRUSXEOLFWUDQVSRUWLQIUDVWUXFWXUH LQFORVHSUR[LPLW\WRWKHWRZQFHQWUHDQGWR DQGDQFLOODU\IDFLOLWLHVVXFKDVSDUNDQG VHHNWKHSURYLVLRQRIVDPHIROORZLQJ ULGH LGHQWLILFDWLRQRIVXLWDEOHVLWHV TO 10: 7RSURYLGHDFFHVVLEOHFDUSDUNLQJVSDFHV DWDSSURSULDWHORFDWLRQVWKURXJKRXWWKH WRZQ It is an objective of Carlow County Council:
TO 8: 7RLQYHVWLJDWHWKHIHDVLELOLW\RISURYLGLQJD EXVVKHOWHUHLWKHURUERWKWRWKHQRUWKRI WKHWRZQDQGWRWKHVRXWKRIWKHWRZQ
7.7 Traffic Management and Parking
7KHDLPRI&DUORZ&RXQW\&RXQFLOLVWR VXSSRUWWKHHQKDQFHPHQWRIWKHXUEDQVWUHHW QHWZRUNWRSURPRWHWKHHIILFLHQF\RIWUDIILF FLUFXODWLRQDQGPDQDJHPHQWDURXQG7XOORZ DQGWRIDFLOLWDWHWKHDSSURSULDWHSURYLVLRQRI SDUNLQJFRQYHQLHQWWRWKHWRZQFHQWUH
'XHWRWKHPDLQWUDQVSRUWFRUULGRUWKURXJKWKH WRZQEHLQJWKH1WKLVFDQJHQHUDWHWUDIILF FRQJHVWLRQDW&KXUFK6WUHHW0DUNHW6TXDUH DQG%ULGJH6WUHHWGXULQJSHDNSHULRGV7KLV FDQEHH[DFHUEDWHGGXHWRWKHPHUJLQJRIWKH 5WKH5DQGWKH5RQWRWKH1DW WKHEULGJHVRXWKRIWKHWRZQRUDWWKHQRUWKRI WKHWRZQFHQWUHDW&KXUFK6WUHHW
,QWHUPVRIFDUSDUNVWKHUHLVDVXUIDFHSXEOLF FDUSDUNRQ%DUUDFN6WUHHWORFDWHGWRWKHUHDU RI6XSHUYDOXDQGDFDUSDUNRII0DUNHW6TXDUH 0LOO6WUHHWDGMDFHQWWRWKH&UHGLW8QLRQ7KHUH DUHDQXPEHURIRWKHUVXUIDFHFDUSDUNV DVVRFLDWHGZLWKEXVLQHVVHVLQWKHWRZQ
It is the policy of Carlow County Council:
TP 9: 7RPRQLWRUWUDIILFPRYHPHQWVLQWKHWRZQ DQGWRSURYLGHSDVVLYHWUDIILFFDOPLQJ PHDVXUHVDWDSSURSULDWHORFDWLRQVDVWKH QHHGDULVHV
TP 10: 7RHQVXUHWKDWQHZHQWUDQFHVDUHORFDWHG LQVXFKDPDQQHUDVWRSURYLGHHIIHFWLYH YLVLELOLW\IRUERWKXVHUVRIWKHHQWUDQFHDQG XVHUVRIWKHSXEOLFURDGVDQGIRRWSDWKV WKURXJKRXWWKHWRZQDQGLWVHQYLURQVVR WKDWRSSRUWXQLWLHVIRUFRQIOLFWLQJWUDIILF PRYHPHQWVDUHDYRLGHGLQWKHLQWHUHVWVRI SXEOLFVDIHW\
It is an objective of Carlow County Council:
TO 9: 7RH[DPLQHWKHIHDVLELOLW\RISURYLGLQJ DGGLWLRQDORIIVWUHHWFDUSDUNLQJZLWKLQDQG
Tullow Draft LAP 2016-2022 - 64 -
CHAPTER 8 COMMUNITY, SOCIAL AND RECREATIONAL DEVELOPMENT 8.1 Introduction DJHVDQGQDWLRQDOLWLHVDVWKHUHDUHPDQ\ GLYHUVHFRPPXQLWLHVLQ7XOORZ6RFLDOLQFOXVLRQ 7XOORZKDVPDQ\FRPPXQLW\IDFLOLWLHV LVLPSRUWDQWLQWKDWLWHQVXUHVDOOSHRSOHDUH FRPPXQLW\JURXSVFOXEVDQGUHFUHDWLRQDO SURYLGHGZLWKHTXDORSSRUWXQLWLHVWR DPHQLW\IDFLOLWLHV$QLPSRUWDQWGULYHULQWKH SDUWLFLSDWH&DUORZ&RXQW\&RXQFLOZLOOHQVXUH SURYLVLRQRIVXFKIDFLOLWLHVLVWKHORQJVWDQGLQJ WKDWWKHUHDUHDGHTXDWHODQGV]RQHGIRU DQGVXVWDLQHGDFWLYLW\DPRQJWKHFRPPXQLW\ FRPPXQLW\DQGUHFUHDWLRQDOSXUSRVHVZLWKLQ DQGLQWHUHVWJURXSVLQSURYLGLQJIDFLOLWLHVLQ WKLV'UDIW/$3DQGZLOOVHHNWRVXSSRUWWKH 7XOORZZKLFKEHQHILWORFDOVDQGWKRVHEH\RQG FRQVROLGDWLRQDQGHQKDQFHPHQWRIH[LVWLQJ WKHWRZQ7KH&RXQFLOZLOOVXSSRUWDQGHQJDJH UHFUHDWLRQDODQGFRPPXQLW\IDFLOLWLHVZLWKLQ ZLWKWKHORFDOFRPPXQLW\DQGJRYHUQPHQW 7XOORZ GHSDUWPHQWVLQUHODWLRQWRWKHGHYHORSPHQWRI H[LVWLQJRUQHZIDFLOLWLHVZLWKLQ7XOORZDQGLWV 8.3 Strategic Approach VXUURXQGLQJKLQWHUODQGV &DUORZ&RXQW\&RXQFLOZLOOWDNHWKHIROORZLQJ ,WLVUHFRJQLVHGWKDWWKHSURYLVLRQRIVXFK DSSURDFKLQIDFLOLWDWLQJWKHSURYLVLRQRIJRRG IDFLOLWLHVDUHFULWLFDOWRWKHFUHDWLRQRI TXDOLW\VRFLDOFRPPXQLW\DQGUHFUHDWLRQDO VXVWDLQDEOHFRPPXQLWLHVDQGFRQVWLWXWHDQ IDFLOLWLHVEHQHILFLDOWRDOOSHUVRQVLQ7XOORZ LPSRUWDQWHOHPHQWLQVRFLDOLQIUDVWUXFWXUH ZKLFKZLOOFRQWLQXHWRPDNH7XOORZDGHVLUDEOH x &RQWLQXHWRVXSSRUWDQGIDFLOLWDWH SODFHLQZKLFKWROLYHZRUNDQGUHFUHDWH YROXQWDU\RUJDQLVDWLRQVZLWKLQWKHWRZQ DQGFRPPXQLW\RI7XOORZ 8.2 Challenges x 3URPRWHWKHGHYHORSPHQWRIVRFLDO FDSLWDOE\SURYLGLQJRSSRUWXQLWLHVIRU $QH[SDQGLQJSRSXODWLRQJHQHUDWHVDQ LQWHUDFWLRQSDUWLFLSDWLRQDQGWKHFR LQFUHDVHGGHPDQGIRUWKHSURYLVLRQRI RUGLQDWHGSURYLVLRQRISXEOLFVHUYLFHV VHUYLFHVFRPPXQLW\IDFLOLWLHVVFKRROSODFHV DQGDPHQLWLHV,WLVHVVHQWLDOWKDWWKHVH x 0DNH7XOORZDQDWWUDFWLYHSODFHWROLYH IDFLOLWLHVDUHSURYLGHGLQWDQGHPZLWKQHZ DQGZRUNE\EXLOGLQJVWURQJLQFOXVLYH GHYHORSPHQWDQGDVQHZFRPPXQLWLHV FRPPXQLWLHVWKDWKDYHDVHQVHRI HPHUJH7KHSULPDU\UROHRIWKH3ODQQLQJ SODFHDQGEHORQJLQJZLWKDGHTXDWH $XWKRULW\UHJDUGLQJVRFLDODQGFRPPXQLW\ SURYLVLRQRIDQGDFFHVVWRVHUYLFHV LQIUDVWUXFWXUHLVWKHSURYLVLRQRIWKHSODQQLQJ DQGIDFLOLWLHVWRPHHWIXWXUHQHHGV IUDPHZRUNLQWKH/$37KLVLQFOXGHVWKH ]RQLQJRIVXIILFLHQWODQGVDWDSSURSULDWH ORFDWLRQVWRDFFRPPRGDWHHGXFDWLRQDO 8.4 Community Facilities FRPPXQLW\OHLVXUHDQGUHFUHDWLRQDOIDFLOLWLHV DORQJZLWKSURYLGLQJWKHSROLFLHVDQGREMHFWLYHV 7XOORZSRVVHVVHVDZHDOWKRIFRPPXQLW\ LQWKHSODQZKLFKVXSSRUWDQGIDFLOLWDWHIXWXUH IDFLOLWLHVORFDWHGWKURXJKRXWWKH'UDIW3ODQ TXDOLW\GHYHORSPHQWVRIWKLVNLQG DUHD7KHVHLQFOXGHDKHDOWKFHQWUHDQXUVLQJ KRPHDIDPLO\UHVRXUFHFHQWUHOLEUDU\ILUH 6RPHNH\FKDOOHQJHVLQDFKLHYLQJGHOLYHU\RI VWDWLRQFRPPXQLW\KDOOFLYLFRIILFHV VRFLDODQGFRPPXQLW\IDFLOLWLHVLQFOXGH FRPPXQLW\FHQWUHVVXFKDV)RUZDUG6WHSV DGHTXDWHIXQGLQJSURYLVLRQDQGHQYLURQPHQWDO 7XOORZ Tullow Draft LAP 2016-2022 - 65 - HQFRXUDJHGWKURXJKRXWFOXEVDQGFRPPXQLW\ UHVHUYLQJVXLWDEO\ORFDWHGODQGDQG JURXSV RUE\WKHXVHRIWKHGHYHORSPHQW PDQDJHPHQWSURFHVVWRHQVXUH It is the policy of Carlow County Council to: SURYLVLRQLVPDGHIRUVXFKIDFLOLWLHV DVWKH&RXQFLOFRQVLGHUVDSSURSULDWH CF 1: 7RVXSSRUWDQGQXUWXUH CFO 3: 7RFRQWLQXHWRVXSSRUWDQGIDFLOLWDWH LQWHUJHQHUDWLRQDODQGFURVVFXOWXUDO YROXQWDU\RUJDQLVDWLRQVLQWKHWRZQ UHODWLRQVKLSVWKURXJKWKH DQGHQYLURQV GHYHORSPHQWRIFRPPXQLW\LQLWLDWLYHV VXFKDVFRPPXQLW\ JDUGHQVDOORWPHQWV CFO 4: 7RDGYDQFHVRFLDOLQFOXVLRQDQG FRPPXQLW\GHYHORSPHQWE\ GHYHORSLQJWKHFRRUGLQDWHGGHOLYHU\ CF 2: 7RSURPRWHWKHGHYHORSPHQWRI RIVHUYLFHVDQGIDFLOLWLHVLQ7XOORZ VXVWDLQDEOHFRPPXQLWLHVRQWKHEDVLV RIDKLJKTXDOLW\RIOLIHZKHUHSHRSOH FDQOLYHZRUNDQGHQMR\DFFHVVWRD 8.5 Educational Facilities ZLGHUDQJHRIFRPPXQLW\KHDOWKDQG HGXFDWLRQDOIDFLOLWLHVVXLWDEOHIRUDOO 7XOORZLVVHUYHGE\WKUHH1DWLRQDO6FKRROVDQG DJHVQHHGVDQGDELOLWLHV RQHVHFRQGDU\VFKRRO7KHSULPDU\VFKRROV DUH6W&ROXPED¶V166FRLO3KDGUDLJ1DRID CF 3: 7RHQFRXUDJHKLJKVWDQGDUGVLQWKH DQG6FRLO1DLVLXQWD0XLQH/RXUGHVDQGWKH GHVLJQDQGILQLVKHVRIFRPPXQLW\ SRVWSULPDU\VFKRROEHLQJ7XOORZ&RPPXQLW\ IDFLOLWLHV 6FKRRO CF 4: 7RRSWLPLVHH[LVWLQJDQGSURSRVHG Name Enrolment SK\VLFDOUHVRXUFHVLQIUDVWUXFWXUHE\ VXSSRUWLQJPXOWLIXQFWLRQDOEXLOGLQJ 2015/2016 IDFLOLW\XVHDQGSURYLVLRQ 3ULPDU\ 6W&ROXPED¶V CF 5: 7RHQFRXUDJHWKHVLWLQJRIFRPPXQLW\ 1DWLRQDO6FKRRO IDFLOLWLHVLQVXLWDEOHORFDWLRQVFORVHWR H[LVWLQJIDFLOLWLHVVHUYLFHVDQGSXEOLF 6FRLO3KDGUDLJ WUDQVSRUWURXWHV 1DRID CF 6: 7RUHFRJQLVHWKHLPSRUWDQFHRI FRPPXQLW\SDUWLFLSDWLRQLQWKH LPSURYHPHQWRIH[LVWLQJFRPPXQLW\ 6FRLO1DLVXLQWD DQGUHFUHDWLRQDOIDFLOLWLHVDQG 0XLQH/RXUGHV HQFRXUDJHLQFUHDVHGLQYROYHPHQWRI ORFDOJURXSVERWKLQGHSHQGHQWO\DQG LQDVVRFLDWLRQZLWKWKHUHOHYDQW VWDWXWRU\ERGLHVLQWKHIXWXUH 3RVW3ULPDU\ 7XOORZ SURYLVLRQRIVXFKIDFLOLWLHV&DUORZ &RPPXQLW\ 331VWUXFWXUHVDUHDYLWDOVRXUFHLQ 6FKRRO WHUPVRISURJUHVVLQJFRPPXQLW\ SDUWLFLSDWLRQ CF 7: 7RFRQVLGHUWKHDFFRPPRGDWLRQRI VPDOOVFDOHFRPPXQLW\HQWHUSULVH GHYHORSPHQWVZLWKLQH[LVWLQJDQG Table 10: Profile of existing schools in Tullow SURSRVHGFRPPXQLW\IDFLOLWLHV (Source: DoES) VXEMHFWWRDSSURSULDWHGHVLJQOD\RXW DQGVHUYLFLQJ It is an objective of Carlow County Council: CFO 1: 7RHQGHDYRXUWRHQVXUHWKDWDOO FRPPXQLW\VRFLDODQGUHFUHDWLRQDO IDFLOLWLHVDUHLQFOXVLYHDQGDFFHVVLEOH WRDOO CFO 2: 7RDVVLVWDVIDUDVSRVVLEOHLQWKH SURYLVLRQRIFRPPXQLW\IDFLOLWLHVE\ Tullow Draft LAP 2016-2022 - 66 - &DUORZ&RXQW\&RXQFLOKDVPDGHVXLWDEOH VHUYLFHVFHQWUHDWHQQLVFOXEDQGDUXJE\FOXE SURYLVLRQLQWKLV'UDIW3ODQE\]RQLQJ ZKLFKLVORFDWHGRXWVLGHWKHSODQDUHD DSSURSULDWHODQGVWRIDFLOLWDWHWKHGHYHORSPHQW DQGSRWHQWLDOIXWXUHH[SDQVLRQRIVFKRROV 7XOORZDOVRKDVD6FRXWV'HQLQWKHIRUPHU ZKHUHIHDVLEOHDQGZLOOFRQWLQXHWRZRUNZLWK FRXUWKRXVHDFKLOGUHQ¶VSOD\SDUNDQGVNDWH WKH'HSDUWPHQWRI(GXFDWLRQDQG6NLOOVDQGDOO SDUNEHVLGHWKH5LYHU6ODQH\DQG7HVFR¶V VFKRROVWRIDFLOLWDWHDOOIXWXUHHGXFDWLRQDO UHTXLUHPHQWVDVQHFHVVDU\3DUWLFXODU ,WLVDOVRDFNQRZOHGJHGWKDWVRPHRIWKHVH DFFRXQWQHHGVWREHWDNHQRIWKH&RUH IDFLOLWLHVDUHH[SDQGLQJZLWKWKH%URWKHU/HR¶V 6WUDWHJ\SRSXODWLRQWDUJHWWKHH[WHQWRI 3DUNQRZFRQWDLQLQJDZDONLQJWUDFNDURXQG KRXVLQJODQGV]RQHGZLWKLQWKH'UDIW3ODQDUHD WKHSHULPHWHURILWVVLWH$OVR7XOORZ7HQQLV DQGWKHIXWXUHHIIHFWVWKDWWKLVZLOOKDYHRQ &OXELVSODQQLQJWRH[SDQGDQGLWLVDQWLFLSDWHG VFKRROFDSDFLWLHVDQGHGXFDWLRQDOGHPDQGV WKDWLWZLOOFRQWDLQLQGRRUFRXUWVWDEOHWHQQLV URRPVPHHWLQJURRPVDQGDJ\P7KHSURMHFW REMHFWLYHVDUHWRFUHDWHDXQLTXHTXDOLW\ FRPPXQLW\EDVHGVSRUWVIDFLOLW\ZLWKWHQQLVDV WKHDQFKRUVSRUWZKLOHSURYLGLQJWKHORFDODQG ZLGHUFRPPXQLW\ZLWKDEURDGUDQJHRI VHUYLFHVDQGIDFLOLWLHVWKDWDUHODFNLQJLQ 7XOORZ,WLVKRSHGWKDWWKHVHIDFLOLWLHVFDQEH PXOWLXVHWRPD[LPLVHWKHYDOXHRIWKHIDFLOLW\ IRUWKHORFDOFRPPXQLW\VXUURXQGLQJ KLQWHUODQGDQGWRZQVDQGYLOODJHVLQWKH LPPHGLDWHDUHD It is the policy of Carlow County Council to: EU 1: 7RIDFLOLWDWHDQGFRRSHUDWHLQWKH SURYLVLRQRIVFKRROVFUqFKHVDQG RWKHUHGXFDWLRQDQGFKLOGFDUH IDFLOLWLHV EU 2: 7RIDFLOLWDWHWKHSURYLVLRQRI FRQWLQXLQJHGXFDWLRQDOIDFLOLWLHVZKLFK SURYLGHIRUOLIHORQJOHDUQLQJIRUDOO LQFOXGLQJWKHHOGHUO\ It is an objective of Carlow County Council: &DUORZ&RXQW\&RXQFLODFNQRZOHGJHVWKHYHU\ LPSRUWDQWUROHVWKDWVSRUWLQJDQGVRFLDOFOXEV EUO 1: 7RDFWLYHO\DVVLVWDQGOLDLVHZLWKWKH SOD\LQHQKDQFLQJWKHVRFLDODQGUHFUHDWLRQDO 'HSDUWPHQWRI(GXFDWLRQDQG6NLOOVLQWKH OLIHRIWKHWRZQ¶VFRPPXQLWLHV)DFLOLWLHVIRU SURYLVLRQRIQHZDQGDGGLWLRQDOVFKRRO SODFHVDVPD\EHUHTXLUHG ERWKIRUPDODQGLQIRUPDOUHFUHDWLRQDQG FDWHULQJIRUWKHHQWLUHFRPPXQLW\RIDOODELOLWLHV DUHUHTXLUHG 8.6 Sports, Recreation and Play :DONLQJWUDLOVZKLFKDUHDFWLYHO\XVHGE\WKH FRPPXQLW\DQGYLVLWRUVDOLNHDUHEHFRPLQJ &KLOGUHQ¶VSOD\LVLPSRUWDQWWRWKHLU LQFUHDVLQJO\SRSXODU7KH5LYHU6ODQH\UXQV GHYHORSPHQW,WLVWKURXJKSOD\WKDWWKH\OHDUQ WKURXJK7XOORZDQGFXUUHQWO\WKHUHLVQR WRVRFLDOLVHDQGLQWHUDFWZLWKWKHZRUOG,Q ZDONLQJWUDLODORQJWKLVULYHU$ORRSHGZDON VXSSRUWLQJSOD\ZHQHHGUHVLGHQWLDODUHDV DORQJWKHULYHUDQGEH\RQGWRZDUGV$OWDPRQW SDUNVDQGRSHQVSDFHVWKDWDUHVDIHDQG *DUGHQVDQGEDFNWRWRZQZRXOGEHD HQMR\DEOHIRUFKLOGUHQRIGLIIHUHQWDJHV7XOORZ ZHOFRPHIDFLOLW\LQWKHWRZQVXEMHFWWR SRVVHVVHVDQDEXQGDQFHRIUHFUHDWLRQDO FRPSOLDQFHZLWKHQYLURQPHQWDOOHJLVODWLRQDQG IDFLOLWLHVWKHVHLQFOXGH*$$DQGVRFFHU DVVHVVPHQW SLWFKHVIRRWEDOOVRFFHUKXUOLQJFOXEVDJROI FRXUVHDQGOHLVXUHFHQWUHDW0RXQW:ROVHOH\ DND\DNLQJFOXEDER[LQJFOXED\RXWK Tullow Draft LAP 2016-2022 - 67 - &XUUHQWO\LQ7XOORZWKHUHLVDODFNRILQGRRU It is an objective of Carlow County Council: VSRUWLQJDQGUHFUHDWLRQDOIDFLOLWLHVIRUDOODJHV $SDUWIURP0RXQW:ROVHOH\DUHVRUWKRWHO SPO 1: 7RHQGHDYRXUWRSURYLGHSOD\VSDFHV WKHUHLVQROHLVXUHFHQWUHRUVZLPPLQJSRROLQ WKURXJKRXWWKHWRZQ WKHWRZQZKLFKZRXOGEHEHQHILFLDOWRWKH ORFDOVDQGUHVLGHQWVLQWKHDUHD,QGRRU SPO 2: 7RHQFRXUDJHDQGIDFLOLWDWHWKHSURYLVLRQ IDFLOLWLHVLQFOXGLQJDVWURWXUIIDFLOLWLHVJ\PV RIDGXOWDPHQLWLHVLQSDUNVVXFKDVWDEOH WHQQLVRXWGRRUJ\PVEDVNHWEDOOFRXUWV FRPPXQLW\KDOODQGRXWGRRUH[HUFLVH ERZOLQJJUHHQVDQGDVVRFLDWHGIDFLOLWLHV HTXLSPHQWLQDSSURSULDWHDUHDVZRXOGEH HWF GHVLUDEOHLQDWRZQVHWWLQJ$PHQLWLHVIRU WHHQDJHUVZRXOGEHRIEHQHILWWRWKHWRZQDOVR SPO 3: 7RLQYROYHFKLOGUHQDQG\RXQJSHRSOHLQ JUHHQLQJLQLWLDWLYHVDQGELRGLYHUVLW\ ,IH[LVWLQJVSRUWVSLWFKHVFRPPXQLW\DQG SURMHFWVKDYLQJUHJDUGWRWKHLUQHHGWR VFKRROKDOOVZHUHDOOPXOWLIXQFWLRQDOWKLV LQWHUDFWZLWKDQGEHHGXFDWHGE\QDWXUH H[SDQGVWKHLUSRWHQWLDODQGPRYLHVFUHHQLQJV PXVLFFRQFHUWVFRPHG\IHVWLYDOVHWFDUHDOO 8.7 Recreational Potential of the SRVVLEOH River Slaney &DUORZ&RXQW\&RXQFLOWKURXJKSROLFLHVDQG 7XOORZZLWKWKH5LYHU6ODQH\UXQQLQJWKURXJK REMHFWLYHVFRQWDLQHGZLWKLQWKLVGUDIWSODQDV WKHWRZQDIIRUGVWKHRSSRUWXQLW\WRLPSURYH ZHOODVWKURXJKWKH&RPPXQLW\6SRUWV WKHUHFUHDWLRQDODPHQLW\HFRORJLFDODQG 3DUWQHUVKLSDQGRWKHUUHFUHDWLRQDOJURXSVZLOO WRXULVPSRWHQWLDORIIHUHGE\WKHZDWHUWKURXJK FRQWLQXHWRVXSSRUWDQGHQKDQFHWKH WKHSURYLVLRQRIDPRUHYLEUDQWULYHUVLGH UHFUHDWLRQDODPHQLWLHVRI7XOORZ ODQGVFDSH7KH5LYHU6ODQH\KDV FRQVLGHUDEOHSRWHQWLDOERWKZDWHUVLGHDQG ODQGVLGHWREHXVHGDVDUHFUHDWLRQDODVVHWWR 7XOORZ7KLVFDQEHGRQHE\LPSURYLQJWKH YLVXDODPHQLW\DORQJWKHULYHUVLGHE\PRUH WUHHDQGIORZHUSODQWLQJUHJHQHUDWLRQRI YDFDQWEXLOGLQJVRUPDLQWDLQLQJDQGLPSURYLQJ IDFDGHV7KHUHDUHVRPHZHOOPDLQWDLQHG JUHHQVSDFHVDORQJVLGHWKHULYHUEXWWKLV QHHGVWREHFRQWLQXHGWKHH[WHQWRIWKHULYHU ZLWKLQWKH'UDIW3ODQDUHDVXEMHFWWR It is the policy of Carlow County Council to: FRQVXOWDWLRQZLWKWKH13:6WRHQVXUHWKDWDQ\ ZRUNVLPSURYHPHQWVFKHPHVZLOOPLQLPLVH SP 1: 7RPDLQWDLQDQGHQKDQFHH[LVWLQJ DQ\GLVWXUEDQFHWRWKH1DWXUDVLWHDQGLWV UHFUHDWLRQDOIDFLOLWLHV IORUDDQGIDXQD SP 2: 7RFRQWLQXHWRFRRSHUDWHZLWK 7KHULYHUDPHQLWLHVQHHGWREHXWLOLVHGWRWKHLU FRPPXQLW\DQGVSRUWVERGLHVLQWKH IXOOSRWHQWLDOLQRUGHUWREHVHHQDVDSXEOLF GHYHORSPHQWRIUHFUHDWLRQDODUHDVLQ JDLQVXFKDVWKHDUHDE\WKH.D\DN&OXE WKHWRZQ EHLQJDFHQWUDOSRLQWDURXQGZKLFKZDWHUVSRUW FOXEVFDQEXLOGDJDLQDOOVXEMHFWWRQRDGYHUVH SP 3: 7RSURKLELWWKHORVVRIH[LVWLQJSXEOLF HIIHFWVRQWKH1DWXUDVLWH DQGSULYDWHUHFUHDWLRQDORSHQVSDFH XQOHVVDOWHUQDWLYHUHFUHDWLRQDO IDFLOLWLHVDUHSURYLGHGDWDVXLWDEOH 0DLQWDLQLQJDGHTXDWHOLJKWLQJDQGVXUIDFHV ORFDWLRQ DORQJWKHULYHUDUHRSWLPXPLQWHUPVRI HQVXULQJSHGHVWULDQF\FOLVWVDIHW\DQGHQVXUH SP 4: 7RVHHNWKHSURYLVLRQRIFKLOGUHQ¶V 7XOORZ¶VULYHUVLGHLVDVDIHDUHDWRZDONF\FOH SOD\IDFLOLWLHVLQQHZUHVLGHQWLDO GHYHORSPHQWVZKHUHGHHPHG DSSURSULDWH SP 5: 7RVHHNWKDWDOOVSRUWVKDOOVDQG SLWFKHVFRPPXQLW\KDOOVDQGFHQWUHV DUHPXOWLIXQFWLRQDO Tullow Draft LAP 2016-2022 - 68 - It is the policy of Carlow County Council to: RC 1: 7RIDFLOLWDWHZKHUHSUDFWLFDEOHWKH SURYLVLRQRIF\FOHZD\VZDONZD\V DORQJWKH5LYHU6ODQH\LQFR RSHUDWLRQZLWKODQGRZQHUV :DWHUZD\V,UHODQGDQGJRYHUQPHQW GHSDUWPHQWV$Q\SURSRVHGF\FOLQJ RUZDONLQJURXWHVDORQJWKH5LYHUZLOO EHVXEMHFWWR$SSURSULDWH $VVHVVPHQWLQDFFRUGDQFHZLWKWKH +DELWDWV'LUHFWLYH RC 2: 7RVXSSRUWWKHFRQVHUYDWLRQRIORFDO DQJOLQJZDWHUVDQGLQYHVWLJDWHWKH IHDVLELOLW\RIGHYHORSLQJWKHVHZDWHUV DQGDVVRFLDWHGLQIUDVWUXFWXUH UHTXLUHGWRDGYDQFHWKHVSRUWLQWKH WRZQVXEMHFWWRWKHUHTXLUHPHQWVRI WKH+DELWDWV'LUHFWLYH RC 3: 7RFRQWLQXHWRFRRSHUDWHZLWK FRPPXQLW\DQGVSRUWVERGLHVLQWKH GHYHORSPHQWRIWKH5LYHU6ODQH\IRU UHFUHDWLRQDOXVHV3URMHFWVVKDOOKDYH UHJDUGWRWKHUHTXLUHPHQWIRU $SSURSULDWH$VVHVVPHQWLQ DFFRUGDQFHZLWKWKH+DELWDWV 'LUHFWLYH Tullow Draft LAP 2016-2022 - 69 - Tullow Draft LAP 2016-2022 - 70 - CHAPTER 9 UTILITIES INFRASTRUCTURE, CLIMATE CHANGE AND ENVIRONMENTAL MANAGEMENT 9.1 Introduction ORFDODUHDSODQLQFOXGLQJWKHDUHDVRIXUEDQ GHVLJQIORRGUHVLOLHQWFRQVWUXFWLRQPDWHULDOV 7KHIXWXUHGHYHORSPHQWDQGVXVWDLQDEOH DQGLQGLYLGXDOGHYHORSPHQWV,QWKLVPDWWHUWKH JURZWKRI7XOORZLVGHSHQGHQWRQWKH GUDIWORFDODUHDSODQKDVKDGUHJDUGWRWKH VDWLVIDFWRU\SURYLVLRQRILQIUDVWUXFWXUHLQFOXGLQJ 'HSDUWPHQWRIWKH(QYLURQPHQW+HULWDJHDQG ZDWHUZDVWHZDWHUXWLOLWLHVHQHUJ\DQGJRRG /RFDO*RYHUQPHQW*XLGHOLQHVIRU3ODQQLQJ TXDOLW\FRPPXQLFDWLRQQHWZRUNV$GHTXDWH $XWKRULWLHVRQ)ORRG5LVN0DQDJHPHQW FDSDFLW\LVQHFHVVDU\WRVXSSRUWIXWXUH *XLGHOLQHV $VXVWDLQDEOHDSSURDFKLV GHYHORSPHQWLQDPDQQHUWKDWLV UHTXLUHGLQUHODWLRQWRWKHPDQDJHPHQWRIWKH HQYLURQPHQWDOO\DQGHFRORJLFDOO\DSSURSULDWH HVVHQWLDOHQJLQHHULQJDQGZDWHUVHUYLFHVZLWK FRVWHIIHFWLYHDQGSURWHFWLYHRISXEOLFKHDOWK WKHHPSKDVLVRQFRQVHUYDWLRQDQGHIILFLHQW XVHRIUHVRXUFHV &DUORZ&RXQW\&RXQFLOLVFRPPLWWHGWR IDFLOLWDWLQJWKHSURYLVLRQDQGGHOLYHU\RI 9.3 Strategic Approach LQIUDVWUXFWXUDOVHUYLFHVZKLFKZLOOHQKDQFHWKH HQYLURQPHQWDQGIDFLOLWDWHVXVWDLQDEOH ,QIUDVWUXFWXUDOVHUYLFHVSROLFLHVDQGREMHFWLYHV HFRQRPLFGHYHORSPHQW7KHSROLFLHVDQG ZLOODGGUHVVWKHVHLVVXHVLQRUGHUWRDFKLHYHD REMHFWLYHVRI&DUORZ&RXQW\&RXQFLOVHHNWR FOHDQKHDOWK\WRZQZLWKLPSURYHPHQWVWRDLU SURYLGHKLJKTXDOLW\SXEOLFLQIUDVWUXFWXUHWR DQGZDWHUTXDOLW\ELRGLYHUVLW\YDOXHDQGWKH PLQLPLVHZDVWHPLWLJDWHZKHUHSRVVLEOHDQG XVHRIUHQHZDEOHHQHUJ\VRXUFHV7KH DGDSWWRWKHLPSDFWVRIFOLPDWHFKDQJHSURWHFW DSSURDFKLVWR DQGLPSURYHZDWHUUHVRXUFHVZDWHUGHSHQGDQW HFRV\VWHPVHQVXUHHIILFLHQWDQGHIIHFWLYH x &ROODERUDWHZLWKDQGVXSSRUW,ULVK ZDVWHZDWHUWUHDWPHQWDQGWRVXSSRUWWKH :DWHUDVOHDGDXWKRULW\LQWKH SURYLVLRQRIDJUHHQLQIUDVWUXFWXUHQHWZRUN SURYLVLRQRIZDWHUVHUYLFHVIRUWKH WRZQDQGLQSDUWLFXODUWRHQVXUH &HUWDLQLQIUDVWUXFWXUDOUHTXLUHPHQWVLQFOXGLQJ HQHUJ\VXSSO\WHOHFRPPXQLFDWLRQVWKH 7KHTXDOLW\DQGFDSDFLW\RIWKH SURGXFWLRQDQGGLVWULEXWLRQRISXEOLFGULQNLQJ ZDVWHZDWHUWUHDWPHQWSODQWLV ZDWHUVXSSO\DQGWKHFROOHFWLRQDQGWUHDWPHQW VXIILFLHQWWRFDWHUIRUVXVWDLQDEOH RIZDVWHZDWHUZKLOHQRWDGLUHFWUHPLWRI JURZWKLQWRWKHIXWXUH &DUORZ&RXQW\&RXQFLOKDYHLPSOLFDWLRQVIRU SODQQLQJDQGGHYHORSPHQW&DUORZ&RXQW\ 7KHSURYLVLRQRIDUHVLOLHQWVXSSO\ &RXQFLOZLOOFRQWLQXHWRVXSSRUWZKHUH RIZKROHVRPHDQGFOHDQGULQNLQJ DSSURSULDWHWKHGHOLYHU\RIVXFKLQIUDVWUXFWXUH ZDWHULQFRPSOLDQFHZLWK(8DQG ,ULVK1DWLRQDO/HJLVODWLRQ 'ULQNLQJ 9.2 Challenges :DWHU5HJXODWLRQVDQGIXWXUH DPHQGPHQWV 2QHFKDOOHQJHLVWRVHHNWKHSURYLVLRQRI DGHTXDWHZDVWHZDWHUWUHDWPHQWWRPHHWIXWXUH x 5HGXFHWKHWRZQ¶VUHOLDQFHRQ GHPDQGGXHWRHFRQRPLFGHYHORSPHQWDQG XQVXVWDLQDEOHHQHUJ\DQGIXHOVRXUFHV SRSXODWLRQJURZWK,PSURYLQJWKHHIILFLHQF\RI DQGLWVFRQWULEXWLRQWRFOLPDWHFKDQJH WKHH[LVWLQJQHWZRUNVDQGHQFRXUDJLQJZDWHU LQRUGHUWRVHFXUHDVXVWDLQDEOHORZ FRQVHUYDWLRQLVDOVRDNH\SULRULW\ FDUERQIXWXUH 7KHPDLQREMHFWLYHZLWKUHJDUGWRZDVWH x 3URWHFWDQGDFKLHYHWKHHIILFLHQWXVH PDQDJHPHQWLVWRIDFLOLWDWHWKHGHYHORSPHQWRI RIQDWXUDOUHVRXUFHVVXFKDVZDWHU UHF\FOLQJLQRUGHUWRPLQLPLVHWKHXVHRI ODQGILOO x (QFRXUDJHVXVWDLQDEOHSURGXFWLRQ GHOLYHU\DQGFRQVXPSWLRQRIGULQNLQJ 7KHLVVXHRIFOLPDWHFKDQJHDQGWKHLPSDFWRI ZDWHU LQFUHDVHGIORRGULVNGXHWRH[WUHPHVRI ZHDWKHUE\IORRGULVNPDQDJHPHQWLVDOVRD x 5HGXFHGHSHQGHQF\RQIRVVLOIXHOV NH\FKDOOHQJHIRUWKHIXWXUHGHYHORSPHQWRI DQGLPSURYHHQHUJ\HIILFLHQF\LQQHZ WKHWRZQ)ORRGULVNDVVHVVPHQWDQG DQGH[LVWLQJEXLOGLQJVDQGSURPRWHWKH PDQDJHPHQWLVUHTXLUHGIRUDOODVSHFWVRIWKH Tullow Draft LAP 2016-2022 - 71 - XVHRIUHQHZDEOHHQHUJ\LQWKHWRZQ¶V EXLOGLQJVWRFN x 0LQLPLVHZDVWHZLWKDQHPSKDVLVRQ PD[LPXPUHF\FOLQJ x 8WLOLVH)ORRG5LVN$VVHVVPHQW WHFKQLTXHVWKURXJKWKHLGHQWLILFDWLRQ DQGSURWHFWLRQRIH[LVWLQJDQG SURSRVHGIORRGGHIHQFHVDQGWKH GHOLYHU\RIIORRGUHVLOLHQWXUEDQDQG EXLOGLQJGHVLJQDQGFRQVWUXFWLRQ x 'HYHORSJUHDWHUFRRUGLQDWLRQZLWK RWKHUSODQQLQJDXWKRULWLHVWKH (QYLURQPHQWDO3URWHFWLRQ$JHQF\DQG XWLOLW\SURYLGHUVZLWKUHJDUGWR LQIUDVWUXFWXUDODQGFOLPDWHFKDQJH LVVXHV It is a policy of Carlow County Council: x ,PSURYHWKHWRZQ¶VUHVLOLHQFHDQG DELOLW\WRDGDSWWRFOLPDWHFKDQJH WSP 1 7RFRQWULEXWHWRZDUGVWKHSURWHFWLRQRI H[LVWLQJDQGSRWHQWLDOZDWHUUHVRXUFHVDQG WKHLUXVHE\KXPDQVDQGZLOGOLIHLQFOXGLQJ 9.4 Policies and Objectives ULYHUVVWUHDPVJURXQGZDWHUDQG DVVRFLDWHGKDELWDWVDQGVSHFLHVLQ 9.4.1 Water Supply and Quality DFFRUGDQFHZLWKWKHUHTXLUHPHQWVDQG JXLGDQFHLQWKH(8:DWHU)UDPHZRUN &DUORZ&RXQW\&RXQFLOVHHNVWRHQVXUHWKDW 'LUHFWLYH (& WKH WKHUHLVDGHTXDWHVHUYLFHVDQGLQIUDVWUXFWXUH (XURSHDQ8QLRQ :DWHU3ROLF\ 5HJXODWLRQV DVDPHQGHG WKH DVVRFLDWHGZLWKWKHZDWHUVXSSO\QHWZRUNIRU (XURSHDQ&RPPXQLWLHV(QYLURQPHQWDO FXUUHQWDQGIXWXUHGHYHORSPHQWLQFRRSHUDWLRQ 2EMHFWLYHV 6XUIDFH:DWHUV 5HJXODWLRQV ZLWK,ULVK:DWHU 6,1RRI WKH *URXQGZDWHU'LUHFWLYH(&DQG 7KH7XOORZWRZQQHWZRUNLVLQWHUFRQQHFWHGWR WKH(XURSHDQ&RPPXQLWLHV(QYLURQPHQWDO WKH1RUWK5HJLRQDO:DWHU6XSSO\6FKHPH 2EMHFWLYHV JURXQGZDWHU 5HJXODWLRQV ZKLFKLVWKHVXUIDFHZDWHUVRXUFHDW5DWKYLOO\ 6,1R RI DQGRWKHU :DWHU7UHDWPHQW3ODQW7KLVSODQWLVRSHUDWLQJ UHOHYDQW(8'LUHFWLYHVLQFOXGLQJ DVVRFLDWHGQDWLRQDOOHJLVODWLRQDQGSROLF\ EHORZLWVFDSDFLW\DQGKDVDGHTXDWHUHVHUYH JXLGDQFH LQFOXGLQJDQ\VXSHUVHGLQJ WRFDWHUIRUSUHGLFWHGIXWXUHJURZWKLQ7XOORZ YHUVLRQVRIVDPH 7RDOVRVXSSRUWWKH RYHUWKHOLIHWLPHRIWKLVSODQ7KHWRZQDOVR DSSOLFDWLRQDQGLPSOHPHQWDWLRQRID KDVLWVRZQZDWHUWUHDWPHQWSODQWZKLFKKDVD FDWFKPHQWSODQQLQJDQGPDQDJHPHQW FDSDFLW\RIFXELFPHWUHVRIZDWHUSHU DSSURDFKWRGHYHORSPHQWDQG GD\,WKDVDVXUIDFHZDWHUDEVWUDFWLRQIURP FRQVHUYDWLRQLQFOXGLQJWKHLPSOHPHQWDWLRQ WKH5LYHU6ODQH\DQGLVORFDWHGRQWKH RI6XVWDLQDEOH'UDLQDJH6\VWHP %DOO\PXUSK\5RDG7KLVSODQWLVFXUUHQWO\ WHFKQLTXHVIRUQHZGHYHORSPHQW RSHUDWLQJDWFDSDFLW\ WSP 2: 7RVXSSRUWWKHLPSOHPHQWDWLRQRIWKH UHOHYDQWUHFRPPHQGDWLRQVDQGPHDVXUHV :DWHUVXSSOLHGWRWKHWRZQLVWHVWHGUHJXODUO\ DVRXWOLQHGLQWKHUHOHYDQW5LYHU%DVLQ DQGLVFRQVLVWHQWO\RIWKHKLJKHVWTXDOLW\ 0DQDJHPHQW3ODQDQGDVVRFLDWHG 3URJUDPPHVRI0HDVXUHVRUDQ\VXFK SODQVWKDWPD\VXSHUVHGHVDPHGXULQJWKH OLIHWLPHRIWKHSODQDVZHOODVUHOHYDQW UHFRPPHQGDWLRQVFRQWDLQHGLQWKH:DWHU 4XDOLW\LQ,UHODQG± (3$ DQGDQ\XSGDWHGVXSHUVHGLQJGRFXPHQW 3URSRVDOVIRUGHYHORSPHQWZRXOGQRWKDYH DQXQDFFHSWDEOHLPSDFWRQWKHZDWHU HQYLURQPHQWLQFOXGLQJVXUIDFHZDWHUV JURXQGZDWHUTXDOLW\DQGTXDQWLW\ULYHU FRUULGRUVDQGDVVRFLDWHGZRRGODQGV$OVR Tullow Draft LAP 2016-2022 - 72 - WRKDYHFRJQLVDQFHRIZKHUHUHOHYDQWWKH /RZIOXVKDQGGXDOIOXVKWRLOHWV (8¶V&RPPRQ,PSOHPHQWDWLRQ6WUDWHJ\ /RZZDWHUXVHDSSOLDQFHV *XLGDQFH'RFXPHQW1RZKLFK 5DLQZDWHUKDUYHVWLQJ SURYLGHVJXLGDQFHRQH[HPSWLRQVWRWKH HQYLURQPHQWDOREMHFWLYHVRIWKH:DWHU WSO 4: 7RKDYHUHJDUGWRWKH(3$SXEOLFDWLRQ )UDPHZRUN'LUHFWLYH µ7KH3URYLVLRQDQG4XDOLW\RI'ULQNLQJ :DWHULQ,UHODQG±$5HSRUWIRUWKH\HDU WSP 3: 7RIDFLOLWDWH,ULVK:DWHULQSURYLGLQJZDWHU ¶ DQGDQ\VXEVHTXHQWXSGDWH LQWKH VXIILFLHQWLQTXDQWLW\DQGTXDOLW\WRVHUYH PDLQWHQDQFHRI7XOORZ¶VZDWHUVRXUFHLQ WKHQHHGVRIWKHH[LVWLQJDQGIXWXUH FRQMXQFWLRQZLWK,ULVK:DWHU SRSXODWLRQRI7XOORZDQGWRSURPRWHWKH VXVWDLQDEOHPDQDJHPHQWRIWKHWRZQ¶V WSO 5: 7RVHHNWKHLPSOHPHQWDWLRQRI ZDWHUVXSSO\ UHFRPPHQGDWLRQVPDGHE\WKH(3$ DULVLQJIURPDQ\IDLOXUHWRPHHWGULQNLQJ WSP 4 7RPD[LPLVHWKHSRWHQWLDOIRUEHQHILFLDOUH ZDWHUVWDQGDUGVDQGDQ\HQOLVWPHQWRQWKH XVHRIZDWHUWKURXJKUDLQZDWHUKDUYHVWLQJ (3$¶V5HPHGLDO$FWLRQ/LVWLQFRQMXQFWLRQ V\VWHPVDQGWRUHGXFHOHDNDJHWRWKH ZLWK,ULVK:DWHU PLQLPXPSRVVLEOHOHYHOLQWKHZDWHUVXSSO\ V\VWHPWKURXJKRSHUDWLRQDOOHDNGHWHFWLRQ WSO 6: 7RSURWHFWDQGVDIHJXDUGWKHLQWHJULW\RI PHDVXUHV ZDWHUVXSSO\IDFLOLWLHVLQVWDOODWLRQVDQG SLSHV WSP 5 7RHQVXUHWKDWLQWKHFDVHRIDOOQHZ GHYHORSPHQWVZKHUHSXEOLFPDLQVDUH WSO 7: 7RIDFLOLWDWHWKHLGHQWLILFDWLRQDQGVHFXULQJ DYDLODEOHRUOLNHO\WREHDYDLODEOHWKH RIVHUYLFHFRUULGRUVIRUDQ\IXWXUHQHZ GHYHORSPHQWZLOOEHUHTXLUHGWRFRQQHFW ZDWHUVXSSO\IRU7XOORZ LQWRWKHPVXEMHFWWRDQDJUHHPHQWZLWK ,ULVK:DWHU WSO 8: 7RHQVXUHWKDWDOOSURSRVDOVIRUWKH GHYHORSPHQWRIDQXSJUDGHWRWKHZDWHU WSP 6 7RHQVXUHWKDWGHYHORSPHQWSURSRVDOV VXSSO\V\VWHPZLOOEHVFUHHQHGIRU FRPSO\ZLWKWKHVWDQGDUGVDQG $SSURSULDWH$VVHVVPHQWLQDFFRUGDQFH UHTXLUHPHQWVRI,ULVK:DWHULQUHODWLRQWR ZLWK$UWLFOH RIWKH+DELWDWV'LUHFWLYH ZDWHUWRIDFLOLWDWHSURSRVHGGHYHORSPHQWV DQGZKHUHSRWHQWLDOLPSDFWVWRWKHLQWHJULW\ DQGWRHQFRXUDJHDOOGHYHORSHUVUHTXLULQJ RIWKH1DWXUDQHWZRUNDUHLGHQWLILHG DFRQQHFWLRQWRWKHSXEOLFZDWHUVXSSO\WR D1DWXUD,PSDFW6WDWHPHQWZLOOEH FRQWDFW,ULVK:DWHUSULRUWRVXEPLWWLQJD SUHSDUHG SODQQLQJDSSOLFDWLRQ WSO 9: 7RLPSOHPHQWWKH:DWHU6HUYLFHV WSP 7 7RSURWHFWVXUIDFHZDWHUDQGJURXQGZDWHU ,QYHVWPHQW3URJUDPPHDQG UHVRXUFHVDQGWKHLUDVVRFLDWHGKDELWDWV DOOVXEVHTXHQW:DWHU6HUYLFHV,QYHVWPHQW DQGVSHFLHVLQFOXGLQJILVKHULHVDQGLQ 3URJUDPPHV SDUWLFXODU$QQH[,,OLVWHGVSHFLHV 9.4.2 Wastewater It is an objective of Carlow County Council: 7KHGHYHORSPHQWRIWKHWRZQ¶VZDVWHZDWHU GUDLQDJHV\VWHPLVHVVHQWLDOWRIDFLOLWDWH WSO 1: 7RFROODERUDWHZLWK,ULVK:DWHULQ JURZWK7KHFXUUHQW7XOORZZDVWHZDWHU FRQWULEXWLQJWRZDUGVFRPSOLDQFHZLWKWKH WUHDWPHQWSODQWORFDWHGRQWKH%XQFORG\ (XURSHDQ&RPPXQLWLHV 'ULQNLQJ:DWHU 5RDGZDVRULJLQDOO\GHVLJQHGZLWKDWUHDWPHQW 5HJXODWLRQV 1R DQGHQVXUHWKDW FDSDFLW\RISRSXODWLRQHTXLYDOHQW 3( WKHZDWHUVXSSO\VHUYLQJ7XOORZFRPSOLHV ZLWKWKHSDUDPHWHUVLGHQWLILHGLQWKHVH 5HFHQWXSJUDGHVWRWKHSODQWLQFOXGLQJQHZ UHJXODWLRQV LQWDNHZRUNVQHZDHUDWLRQV\VWHPDQGWHUWLDU\ WUHDWPHQWKDYHDOORZHGIRUDQLQFUHDVHLQWKH WSO 2: 7RIDFLOLWDWHWKHLPSOHPHQWDWLRQRIZDWHU RUJDQLFWUHDWPHQWFDSDFLW\RIWKHSODQW7KH FRQVHUYDWLRQSURMHFWVZKLFKUHGXFH FXUUHQWORDGLQJRQWKHSODQWLVGHWHUPLQHGDW FRQVXPSWLRQDQGOHDNDJHLQH[LVWLQJZDWHU 3(HTXLYDOHQW,ULVK:DWHUKDYH GLVWULEXWLRQV\VWHPVLQFRRSHUDWLRQZLWK ,ULVK:DWHU DFNQRZOHGJHGWKDWWKHH[LVWLQJSODQWLV RYHUORDGHGDQGKDYHFRPPLWWHGWRLQFOXGLQJ WSO 3: 7RUHTXLUHWKHDGRSWLRQRIZDWHUVDYLQJ WKLVSODQWLQ,ULVK:DWHUV(PHUJLQJ,QYHVWPHQW PHDVXUHVLQQHZGHYHORSPHQWSURSRVDOV 3ODQIRULQFOXVLRQLQWKHQH[W&DSLWDO 6XFKPHDVXUHVPD\LQFOXGH ,QYHVWPHQW3ODQ3UHOLPLQDU\ZRUNVKDYH FRPPHQFHGUHJDUGLQJWKHGHVLJQSKDVHRIWKH :DWHUEXWWVWRFROOHFWUDLQZDWHU Tullow Draft LAP 2016-2022 - 73 - XSJUDGHZRUNVWRERWKWKHWUHDWPHQWSODQWDQG $SSURSULDWH$VVHVVPHQWLQDFFRUGDQFH WKHQHWZRUN ZLWK$UWLFOH DQG RIWKH(8 +DELWDWV'LUHFWLYH It is the policy of Carlow County Council: WWO 4: 7RHQVXUHWKDWDOOQHZGHYHORSPHQWV VKDOOEHSURYLGHGZLWKVHSDUDWHIRXO WW 1: 7RFROODERUDWHZLWK,ULVK:DWHUWRHQVXUH DQGVXUIDFHZDWHUQHWZRUNV,Q WKDWSXEOLFZDVWHZDWHUFROOHFWLRQDQG UHGHYHORSPHQWVFRPELQHGV\VWHPV WUHDWPHQWLQIUDVWUXFWXUHIXOO\FRPSOLHVZLWK VKDOOEHVHSDUDWHGZKHUHIHDVLEOH WKHUHTXLUHPHQWVRIWKH8UEDQ:DVWH :DWHU7UHDWPHQW5HJXODWLRQVDQG WKH:DVWH:DWHU'LVFKDUJH 9.4.3 Flooding 5HJXODWLRQVDQGWKH(&6XUIDFH :DWHU5HJXODWLRQV 7KH2IILFHRI3XEOLF:RUNVLVUHVSRQVLEOHDWD QDWLRQDOOHYHOWRPRQLWRUDQGDGGUHVV WW 2: 7RSURPRWHDVDSSURSULDWHVSHFLILF VLWXDWLRQVSHUWDLQLQJWRIORRGLQJDQGDORQJZLWK SURYLVLRQVIRUWKHLPSOHPHQWDWLRQRIWKH WKH'HSDUWPHQWRI(QYLURQPHQW&RPPXQLW\ UHOHYDQWUHFRPPHQGDWLRQVVHWRXWLQWKH DQG/RFDO*RYHUQPHQWKDVSXEOLVKHGD UHFHQW8UEDQ:DVWH:DWHU7UHDWPHQWLQ QDWLRQDOJXLGDQFHGRFXPHQWRQWKH 5HSRUW (3$ LQFRQMXQFWLRQ FRQVLGHUDWLRQRIIORRGULVNZLWKLQSODQQLQJDQG ZLWK,ULVK:DWHU GHYHORSPHQWPDQDJHPHQW WW 3: 7RHQVXUHWKHFKDQJHRYHUIURPVHSWLF WDQNVWRPDLQVFRQQHFWLRQVLQDOOFDVHV 7KHGHYHORSHUZLOOEHUHTXLUHGWRVKRZWKDWWKH ZKHUHWKLVLVIHDVLEOHDQGWKDWDOOQHZ IORRGULVNFDQEHPDQDJHGDWDQDFFHSWDEOH GHYHORSPHQWVXWLOLVHDQGFRQQHFWWRWKH OHYHOZLWKRXWLQFUHDVLQJIORRGULVNHOVHZKHUH H[LVWLQJZDVWHZDWHULQIUDVWUXFWXUH7KH DQGZKHUHSRVVLEOHVKRZDUHGXFWLRQLQWKH SURYLVLRQRILQGLYLGXDOVHSWLFWDQNVDQG RYHUDOOIORRGULVN WUHDWPHQWSODQWVZLWKLQWKH3ODQERXQGDU\ ZLOOEHVWURQJO\GLVFRXUDJHGWRPLQLPLVH CFRAM Programme WKHULVNRIJURXQGZDWHUSROOXWLRQ:KHUH VXFKIDFLOLWLHVDUHSHUPLWWHGIXOO FRPSOLDQFHZLWKWKH (3$&RGHRI 7KH&)5$0 &DWFKPHQW)ORRG5LVN 3UDFWLFH&RGHRI3UDFWLFH:DVWHZDWHU $VVHVVPHQWDQG0DQDJHPHQW 3URJUDPPHLV WUHDWPHQWDQG'LVSRVDO6\VWHPVVHUYLQJ DPHGLXPWRORQJWHUPVWUDWHJ\IRUWKH VLQJOHKRXVHV SH LVUHTXLUHG UHGXFWLRQDQGPDQDJHPHQWRIIORRGULVNLQ ,UHODQG7KH2IILFHRI3XEOLF:RUNVZRUNLQ WW 4: 7RIDFLOLWDWH,ULVK:DWHULQSURYLGLQJ FORVHSDUWQHUVKLSZLWK&DUORZ&RXQW\&RXQFLO DGGLWLRQDODQGLPSURYHGZDVWHZDWHU LQGHOLYHULQJWKHREMHFWLYHVRIWKH&)5$0 WUHDWPHQWFDSDFLW\E\WKHXSJUDGLQJRIWKH 3URJUDPPHLQ&RXQW\&DUORZ 7XOORZ7UHDWPHQW3ODQWDQGWRIDFLOLWDWHWKH SURYLVLRQDQGVDIHJXDUGLQJRI 7XOORZIDOOVZLWKLQWKH6RXWK(DVWHUQ&)5$0 LQIUDVWUXFWXUHFRUULGRUVUHTXLUHGWRIDFLOLWDWH 6WXG\DUHD7KHLQLWLDO)ORRG5LVN5HYLHZ WKHVXVWDLQDEOHGHYHORSPHQWRIWKHWRZQ )55 VWDJHRIWKH6RXWK(DVWHUQ&)5$0KDV EHHQFRPSOHWHGDQGWKLVLQFOXGHGDVLWHEDVHG UHYLHZRIWKH3)5$IORRGRXWOLQHVIRUWKHDUHD ZKLFKSURYLGHGIHHGEDFNRQIORRGULVNDQG It is an objective of Carlow County Council: SRWHQWLDOIRULQFOXVLRQDVDGHWDLOHG$UHDRI )XUWKHU$VVHVVPHQW WWO 1: 7RFRRSHUDWHZLWK,ULVK:DWHULQWKH SURYLVLRQRIDQLPSURYHGVHZHUDJH 7KH DUHD ZDV GHVLJQDWHG DV D SUREDEOH $)$ QHWZRUNDQGVHZDJHWUHDWPHQW $UHDIRU)XUWKHU$VVHVVPHQW 7KHDUHDZDV FDSDFLW\IRU7XOORZ VXEMHFW WR WKH IXOO DQDO\VLV XQGHU WKH 6RXWK (DVWHUQ&)5$07KLVLQFOXGHGDGHWDLOHG' WWO 2: 7RLQYHVWLJDWHWKHSRVVLEOHH[WHQVLRQRI 'K\GUDXOLFPRGHOWKHPRGHOUHSUHVHQWVWKH WKHSXEOLFVHZHUDJHV\VWHPWRDQ\XQ 7XOORZ$)$DQGHQFRPSDVVHVWKH5LYHU6ODQH\ VHUYLFHGDUHDVZLWKLQWKH/RFDO$UHD XSVWUHDP DQG GRZQVWUHDP RI LWV H[WHQW SOXV 3ODQ%RXQGDU\LQFRRSHUDWLRQZLWK ,ULVK:DWHU DVVRFLDWHG WULEXWDULHV 7KUHH WULEXWDULHV DUH LQFOXGHG LQ WKH PRGHO WKHVH DUH WKH 'HUUHHQ WWO 3: 7RHQVXUHWKDWDQ\SURSRVDOVIRUWKH 5LYHUDQGRQHRILWVWULEXWDULHVWKH&RSSHQDJK GHYHORSPHQWDQGRUXSJUDGHRIWKH VWUHDP WKH XUEDQ 7XOORZSKHOLP DQG 0RXQW 7XOORZZDVWHZDWHUWUHDWPHQWSODQWDQG :ROVHOH\VWUHDPVWKDWIORZWKURXJKWKHVWXG\ ZDVWHZDWHUQHWZRUNZLOOEHVXEMHFWWR DUHD 7KH &)5$0 PDSSLQJ UHSUHVHQWV D 6RXWK (DVWHUQ &)5$0 6WXG\ +$ +\GUDXOLFV 5HSRUW 7XOORZ 7XOORZSKHOLP 0RGHO$XJXVW Tullow Draft LAP 2016-2022 - 74 - VLJQLILFDQW LPSURYHPHQW FRPSDUHG WR WKH PHHWWKHREMHFWLYHVRISURSHUSODQQLQJDQG DFFXUDF\SURYLGHGE\WKH3)5$PDSSLQJDQG VXVWDLQDEOHGHYHORSPHQW WKH&)5$0PDSSLQJKDVEHHQYHULILHGE\DVLWH ZDONRYHU DQG FRQVXOWDWLRQ ZLWK WKH /RFDO FL 4: 7RHQVXUHWKDWDOOGHYHORSPHQWVKDYH UHJDUGWRWKHVXUIDFHZDWHUPDQDJHPHQW $XWKRULW\ FRQGLWLRQVFRQWDLQHGZLWKLQWKH6)5$DQG 7KHGUDIWUHFRPPHQGDWLRQIRUWKH7XOORZ$)$ DSSURSULDWHVHFWLRQRIWKH/RFDO$UHD3ODQ LVWKDWIORRGULVNFRQWLQXHVWREHPDQDJHGE\ &RXQW\'HYHORSPHQW3ODQ WKH)ORRG5HOLHI6FKHPH )56 DQGWKDWD IXUWKHUVLQJOHKRXVHFDQSRWHQWLDOO\EH GHIHQGHGXQGHUDPLQRUZRUNVSURSRVDO7KH It is an objective of Carlow County Council: 7XOORZ)56ZDVFRPSOHWHGLQDQGKDVD VWDQGDUGRISURWHFWLRQXSWRD$(3IORRG FLO 1 7RHQVXUHWKHLPSOHPHQWDWLRQRIWKH HYHQW,WLQFOXGHVDVHULHVRIZDOOV 'R(+/*23:SXEOLFDWLRQ7KH3ODQQLQJ HPEDQNPHQWVDQGVL[GHPRXQWDEOHIORRG 6\VWHPDQG)ORRG5LVN0DQDJHPHQW EDUULHUV,QDGGLWLRQWKHFKDQQHORIWKH5LYHU *XLGHOLQHVIRU3ODQQLQJ$XWKRULWLHV 6ODQH\KDVEHHQZLGHQHGGRZQVWUHDPRIWKH LQFOXGLQJLWVDFFRPSDQ\LQJ7HFKQLFDO EULGJH $SSHQGLFHV DQGLQFOXGLQJWKH'HSDUWPHQW RIWKH(QYLURQPHQW&RPPXQLW\DQG/RFDO 7KH&)5$03URJUDPPHKDVLQIRUPHGWKH *RYHUQPHQW¶V&LUFXODU3/ RUDQ\ 6WUDWHJLF)ORRG5LVN$VVHVVPHQWLQ$SSHQGL[ XSGDWHGVXSHUVHGLQJGRFXPHQW LQUHODWLRQ RIWKLV'UDIW/$3 WRIORRGULVNPDQDJHPHQWZLWKLQWKHSODQ DUHD It is a policy of Carlow County Council FLO 2 7RXQGHUWDNHDUHYLHZRIWKH6)5$ FL 1 : 7RVXSSRUWLQFRRSHUDWLRQZLWKWKH23: IROORZLQJDQ\VXEVHTXHQWDOWHUDWLRQRI WKHLPSOHPHQWDWLRQRIWKH(8)ORRG5LVN IORRGPDSSLQJSURGXFHGDVSDUWRIWKH 'LUHFWLYH (& WKH)ORRG5LVN &)5$0 5HJXODWLRQV 6,1RRI DQGWKH 'R(+/*23:SXEOLFDWLRQ7KH3ODQQLQJ FLO 3 7RHQVXUHWKDW)ORRG5LVN$VVHVVPHQWVDUH 6\VWHPDQG)ORRG5LVN0DQDJHPHQW FDUULHGRXWIRUDQ\GHYHORSPHQWSURSRVDO *XLGHOLQHVIRU3ODQQLQJ$XWKRULWLHV LQDFFRUGDQFHZLWKWKH³3ODQQLQJ6\VWHP DQG'HSDUWPHQWDO&LUFXODU3/ RU DQG)ORRG5LVN0DQDJHPHQW±*XLGHOLQHV DQ\XSGDWHGVXSHUVHGLQJOHJLVODWLRQRU IRU3ODQQLQJ$XWKRULWLHV 'R(&/*23: SROLF\JXLGDQFH &DUORZ&RXQW\&RXQFLO 7KLVDVVHVVPHQWVKDOOEH ZLOODOVRWDNHDFFRXQWRIWKH23: DSSURSULDWHWRWKHVFDOHDQGQDWXUHRIULVN &DWFKPHQW)ORRG5LVN0DQDJHPHQW3ODQV WRWKHSRWHQWLDOGHYHORSPHQW &)5$06 DVDSSURSULDWHWKH3UHOLPLQDU\ )ORRG5LVN$VVHVVPHQW 3)5$ DQGWKH FLO 4 7RSURWHFWZDWHUERGLHVDQGZDWHUFRXUVHV 6WUDWHJLF)ORRG5LVN$VVHVVPHQWIRU ZLWKLQWKHSODQDUHDIURPLQDSSURSULDWH &RXQW\&DUORZ± GHYHORSPHQWLQFOXGLQJWKHULYHUFDQDO VWUHDPVDVVRFLDWHGXQGHYHORSHGULSDULDQ FL 2: 7RKDYHUHJDUGWRWKHILQGLQJVDQG VWULSVZHWODQGVDQGQDWXUDOIORRGSODLQV$ UHFRPPHQGDWLRQVRIWKHFXUUHQW6WUDWHJLF PHWUHVWULSRQHLWKHUVLGHRIVXFK )ORRG5LVN$VVHVVPHQWFDUULHGRXWIRUWKH FKDQQHOZLOOEHUHWDLQHGZKHUHUHTXLUHGWR 7XOORZ/RFDO$UHD3ODQDUHD IDFLOLWDWHDFFHVVWKHUHWR,QDGGLWLRQ FL 3: 7RLPSOHPHQWWKHXVHRIWKHVHTXHQWLDO SURPRWHWKHVXVWDLQDEOHPDQDJHPHQWDQG XVHVRIZDWHUERGLHVDQGDYRLGFXOYHUWLQJ DSSURDFKDQGDSSOLFDWLRQRIWKH RUUHDOLJQPHQWRIWKHVHIHDWXUHV -XVWLILFDWLRQ7HVWVIRU'HYHORSPHQW 0DQDJHPHQWDQG'HYHORSPHQW3ODQV SUDs GXULQJWKHSHULRGRIWKLVSODQDVVHWRXWLQ WKH)ORRG5LVN0DQDJHPHQW*XLGHOLQHVDV 6XVWDLQDEOH8UEDQ'UDLQDJH6\VWHPV 68'V IROORZV $YRLGGHYHORSPHQWWKDWZLOOEH DUHDPHWKRGRIUHSOLFDWLQJWKHQDWXUDO DWULVNRIIORRGLQJRUWKDWZLOOLQFUHDVHWKH FKDUDFWHURIUDLQIDOOUXQRIIIURPDQ\VLWH7KH\ IORRGLQJULVNHOVHZKHUHZKHUHSRVVLEOH 6XEVWLWXWHOHVVYXOQHUDEOHXVHVZKHUH SURYLGHK\GUDXOLFZDWHUTXDOLW\DQG DYRLGDQFHLVQRWSRVVLEOH DQG -XVWLI\ HQYLURQPHQWDOEHQHILWV7KHRYHUDOOREMHFWLYH PLWLJDWHDQGPDQDJHWKHULVNZKHUH LVWRPLQLPLVHVWRUPZDWHUUXQRII7KHUHIRUH DYRLGDQFHDQGVXEVWLWXWLRQDUHQRW SHUPHDEOHVXUIDFLQJVKRXOGEHPD[LPLVHGLQ SRVVLEOH'HYHORSPHQWVKRXOGRQO\EH DOOQHZGHYHORSPHQWV SHUPLWWHGLQDUHDVDWULVNRIIORRGLQJZKHQ WKHUHDUHQRDOWHUQDWLYHUHDVRQDEOHVLWHV DYDLODEOHLQDUHDVDWORZHUULVNWKDWDOVR Tullow Draft LAP 2016-2022 - 75 - It is a policy of Carlow County Council $WDORFDOOHYHO&DUORZ&RXQW\&RXQFLOPXVW FRQWULEXWHWRWKHVWDELOLVDWLRQDQGUHGXFWLRQRI SW 1: 7RUHTXLUHWKHXVHRI6XVWDLQDEOH8UEDQ QDWLRQDOJUHHQKRXVHJDVHPLVVLRQVLQFOXGLQJ 'UDLQDJH6\VWHPVLQDOOQHZ FOLPDWHFKDQJHDGDSWDWLRQWKURXJKWKH GHYHORSPHQWVZKHUHDSSURSULDWH7KH IROORZLQJPHDVXUHVZLOODSSO\ SURPRWLRQRIUHQHZDEOHHQHUJ\VRXUFHVDQG 7KHLQILOWUDWLRQLQWRWKHJURXQGWKURXJKWKH HQHUJ\FRQVHUYDWLRQLQSROLFLHVDQGREMHFWLYHV GHYHORSPHQWRISRURXVSDYLQJVZDOHVDQG UHJDUGLQJWKHHQYLURQPHQWKRXVLQJDQG GHWHQWLRQEDVLQV LQIUDVWUXFWXUH7KHVHSROLFLHVDQGREMHFWLYHV 7KHKROGLQJRIZDWHULQVWRUDJHDUHDV ZLOOFRQWULEXWHWRWKHQDWLRQDOFRPPLWPHQWWR WKURXJKWKHFRQVWUXFWLRQRIJUHHQURRIV UDLQZDWHUKDUYHVWLQJGHWHQWLRQEDVLQV OLPLWWKHLPSDFWRIFOLPDWHFKDQJHDQGUHGXFH SRQGVDQGZHWODQGV HQHUJ\FRQVXPSWLRQDQGJUHHQKRXVHJDV 7KHVORZGRZQRIWKHPRYHPHQWRIZDWHU HPLVVLRQV7KLVLQFOXGHVVXSSRUWIRUPHDVXUHV DLPHGDWUHGXFLQJWUDYHOGHPDQGE\ LQWHJUDWLQJODQGXVHDQGWUDQVSRUWDWLRQ It is an objective of Carlow County Council: IDFLOLWDWLQJDQLQFUHDVHGPRGDOVKDUHRI SWO 1 7RLPSURYHDQGH[WHQGZKHUHWHFKQLFDOO\ VXVWDLQDEOHWUDYHOPRGHVHQFRXUDJLQJSDVVLYH IHDVLEOHDQGHFRQRPLFDOO\YLDEOHWKH VRODUGHVLJQDQGHQHUJ\HIILFLHQWEXLOGLQJV VXUIDFHZDWHUGLVSRVDOLQIUDVWUXFWXUHWR SURPRWLQJJUHDWHUXVHRIUHQHZDEOHHQHUJ\ VHUYHDOO]RQHGODQGLQRUGHUWRIDFLOLWDWH DQGHQHUJ\FRQVHUYDWLRQUHXVHRIH[LVWLQJ GHYHORSPHQW EXLOGLQJVWRFNSURPRWLQJZDVWHUHGXFWLRQDQG DGGUHVVLQJLQFUHDVHGIORRGLQJULVNVGXHWR FOLPDWHFKDQJH It is a policy of Carlow County Council: CCP 1 7RUHFRJQLVH(XURSHDQDQGQDWLRQDO 9.4.4 Climate Change REMHFWLYHVIRUFOLPDWHDGDSWDWLRQDQGZRUN ZLWKWKH(3$WKH6RXWKHUQ5HJLRQDO $VVHPEO\DQGQHLJKERXULQJSODQQLQJ &XUUHQWOHYHOVRIJUHHQKRXVHJDVHPLVVLRQV DXWKRULWLHVLQLPSOHPHQWLQJIXWXUH VXFKDVFDUERQGLR[LGHPHWKDQHDQGQLWURXV *XLGDQFHIRUFOLPDWHFKDQJHSURRILQJRI R[LGHDUHFKDQJLQJFOLPDWHV7KHLPSDFWVRI ODQGXVHSODQSURYLVLRQVDVLVIODJJHGLQWKH FOLPDWHFKDQJHSUHVHQWVHULRXVJOREDOULVNV 1DWLRQDO&OLPDWH&KDQJH$GDSWDWLRQ DQGWKUHDWHQWKHEDVLFFRPSRQHQWVRIOLIH )UDPHZRUN '(&/* LQFOXGLQJKHDOWKDFFHVVWRZDWHUIRRG CCP 2 7RVXSSRUW(8DQGQDWLRQDOOHJLVODWLRQDQG SURGXFWLRQDQGWKHXVHRIODQG:LWKFOLPDWH VWUDWHJLHVRQFOLPDWHFKDQJHLQLWVGHFLVLRQ FKDQJHWKHUHDUHLQFUHDVLQJWKUHDWVLQWHUPVRI PDNLQJLQRUGHUWRFRQWULEXWHWRD OLNHOLKRRGDQGVHYHULW\RIIORRGLQJDQGLPSDFWV UHGXFWLRQDQGDYRLGDQFHRIKXPDQ RQZDWHUUHVRXUFHVELRGLYHUVLW\QDWXUDO LQGXFHGFOLPDWHFKDQJHDQGWRDVVLVWLQ KDELWDWVDQGVSHFLHVGLVWULEXWLRQ,QFUHDVHG DFKLHYLQJWKHQDWLRQDOWDUJHWVVHWRXW IORRGLQJFDXVHGE\WKH5LYHU6ODQH\ZRXOGEH XQGHUWKH.\RWR3URWRFRO DVXSGDWHG WKHPRVWLPPHGLDWHWKUHDWWR7XOORZDVDUHVXOW CCP 3 7RVXSSRUWWKH1DWLRQDO&OLPDWH&KDQJH RIFOLPDWHFKDQJH $GDSWDWLRQ)UDPHZRUN LQFOXGLQJDQ\ 7KH&OLPDWH$FWLRQDQG/RZ&DUERQ VXSHUVHGLQJGRFXPHQW WKHDFWLRQV FRQWDLQHGWKHUHLQDQGDQ\IXWXUHORFDO 'HYHORSPHQW%LOOSXWVDIUDPHZRUNLQ DGDSWDWLRQSODQWKDWUHODWHVWRWKHGUDIW SODFHWRHQDEOH,UHODQGWRPDNHWKHWUDQVLWLRQ SODQDUHD WRDORZFDUERQHFRQRP\E\7KLVZLOOEH DFKLHYHGWKURXJKD1DWLRQDO0LWLJDWLRQ3ODQWR ORZHUWKHOHYHORIJUHHQKRXVHHPLVVLRQVDQGD It is an objective of Carlow County Council: 1DWLRQDO$GDSWDWLRQ)UDPHZRUNWRSURYLGHIRU UHVSRQVHVWRFKDQJHVFDXVHGE\FOLPDWH CCO 1 7RSURPRWHWKHLQWHJUDWLRQRIJUHHQ FKDQJH)XUWKHUPRUHWKHDIRUHPHQWLRQHG%LOO LQIUDVWUXFWXUHQHWZRUNV HJ WDUJHWVDUHGXFWLRQLQJUHHQKRXVHJDV LQWHUFRQQHFWHGQHWZRUNVRIJUHHQVSDFHV HPLVVLRQVRISHUFHQWRYHU OHYHOVE\ HFRV\VWHPV DQGRWKHUSK\VLFDOIHDWXUHV RQODQGLQWRQHZGHYHORSPHQWSURSRVDOVLQ RUGHUWRPLWLJDWHDQGDGDSWWRFOLPDWH FKDQJH Tullow Draft LAP 2016-2022 - 76 - 9.4.5 Waste Management :KHUHODUJHVFDOHGHYHORSPHQWWDNHVSODFH ODQGVKRXOGEHVHWDVLGHIRUWKHGXUDWLRQRIWKH 7KH0DQDJHPHQWRIZDVWHLQ7XOORZLV FRQVWUXFWLRQSHULRGWRIDFLOLWDWHWKHVRUWLQJDQG JRYHUQHGE\WKH6RXWKHUQ:DVWH0DQDJHPHQW VWRULQJRIZDVWHLQHUWPDWHULDO7KH&RXQFLOZLOO 3ODQ7KLVSODQVHWVRXWD SHUPLWWKHXVHRIDSSURSULDWHLQHUWDQGQRQ IUDPHZRUNIRUWKHPDQDJHPHQWRIZDVWHZLWKLQ KD]DUGRXVZDVWHVVXFKDVFRQVWUXFWLRQDQG WKH6RXWKHUQ5HJLRQDQGIROORZVWKHZDVWH GHPROLWLRQZDVWHIRUODQGVFDSLQJDFWLYLWLHV PDQDJHPHQWKLHUDUFK\ZKLFKSURPRWHVLQ 7KH&RXQFLOZLOOHQFRXUDJHWKHSURYLVLRQRI RUGHURISULRULW\WKHSUHYHQWLRQUHF\FOLQJDQG UHF\FOLQJV\VWHPVRIDQDSSURSULDWHVFDOHLQDOO VDIHGLVSRVDORIZDVWH7KH&RXQFLOZLOO QHZGHYHORSPHQWVDQGZLOOLQYHVWLJDWHKRZ FRQWLQXHWRSURPRWHZDVWHSUHYHQWLRQDQG EHVWWRDFKLHYHH[SDQVLRQWRWKHQHWZRUNRI PLQLPLVDWLRQLQLWLDWLYHVWRWDUJHWDOODVSHFWVRI SXEOLFUHF\FOLQJIDFLOLWLHVLQWKHH[LVWLQJEXLOWXS ZDVWHLQ7XOORZIRFXVLQJRQERWKFRPPHUFLDO DUHD$Q\UHVLGXDOZDVWHPDWHULDOWREH DQGGRPHVWLFZDVWHSURGXFHUV,WLV UHPRYHGIURPVLWHVPXVWEHFDUHIXOO\PDQDJHG FRQVLGHUHGWKDWUDLVLQJWKHDZDUHQHVVRI WRHQVXUHWKDWDQ\HQYLURQPHQWDOGDPDJHLV FLWL]HQVDQGEXVLQHVVHVZLWKUHJDUGWRWKHLU DYRLGHGDQGEHWUDQVSRUWHGDQG UHVSRQVLELOLW\DVJHQHUDWRUVLVHVVHQWLDO DFFRPPRGDWHGE\DXWKRULVHGRSHUDWRUV7KH &RXQFLOZLOOUHTXLUH:DVWH0DQDJHPHQW3ODQV WREHSUHSDUHGIRU&RQVWUXFWLRQDQG'HPROLWLRQ 3URMHFWVRIDSDUWLFXODUVFDOHLQDFFRUGDQFH ZLWK%HVW3UDFWLFH*XLGHOLQHVLVVXHGE\WKH 'HSDUWPHQWRI(QYLURQPHQW+HULWDJHDQG /RFDO*RYHUQPHQW-XO\ Litter Management :LWKUHJDUGWROLWWHUFRQWUROWKH&RXQFLO DGKHUHVWRWKH/LWWHU0DQDJHPHQW3ODQ 7KHPDLQREMHFWLYHRIWKLVSODQLVWR SUHYHQWDQGFRQWUROOLWWHUDQGLWVSHFLILHVWKH PHDVXUHVEHLQJXQGHUWDNHQWRHQFRXUDJH SXEOLFDZDUHQHVVRIWKHOLWWHUSUREOHPZLWK SDUWLFXODUHPSKDVLVRQHGXFDWLRQDODQG LQIRUPDWLRQVWUDWHJLHVDLPHGDW\RXQJSHRSOH ,WDOVRLQGLFDWHVWKHPHDVXUHVDQG Waste Disposal DUUDQJHPHQWVWKDWDUHWREHXQGHUWDNHQWR DFKLHYHWKHREMHFWLYHVRIWKHSODQ 5HIXVHFROOHFWLRQLQ7XOORZLVFXUUHQWO\FDUULHG RXWE\DQXPEHURISULYDWHFRQWUDFWRUVXVLQJ 7XOORZLVJHQHUDOO\FOHDQDQGZHOOSUHVHQWHG ZDVWHFROOHFWLRQSHUPLWVLVVXHGE\&DUORZ ZKLFKLVDVLJQRIJRRGFLYLFRUJDQLVDWLRQDQG &RXQW\&RXQFLO7KH&RXQW\¶VODQGILOOLV SULGH:KLOHWKH&RXQFLOSOD\VDYHU\ ORFDWHGDSSUR[LPDWHO\NPWRWKHVRXWKZHVW LPSRUWDQWUROHLQWHUPVRIERWKSUHYHQWLRQDQG RI7XOORZDW3RZHUVWRZQEHVLGHWKH0 UHGXFWLRQRIOLWWHULQWKHWRZQWKLVFDQRQO\EH LQWHUFKDQJHDW-XQFWLRQ DFKLHYHGE\WKHFRRSHUDWLRQRIWKHORFDO FRPPXQLW\JURXSVVXFKDVWKH7LG\7RZQV 7KH&RXQFLOKDVSURYLGHGEULQJEDQNVIRUWKH &RPPLWWHH5HVLGHQWV$VVRFLDWLRQV'HYHORS FROOHFWLRQRIJODVVDOXPLQLXPFDQV 7XOORZ$VVRFLDWLRQ/WGWKHEXVLQHVV QHZVSDSHUFDUGERDUGDQGWH[WLOHVDWDVLWHRQ FRPPXQLW\DQGWKHSXEOLFLQJHQHUDO WKH7KRPDV7UD\QRU5RDG7KHUHDUHDOVR VRPHEULQJFHQWUHVIRUWH[WLOHVDWYDULRXV It is a policy of Carlow County Council: ORFDWLRQVWKURXJKRXWWKHWRZQVXFKDV)O\QQ¶V *DUDJHWRWKHQRUWKRIWKHWRZQDQG6XSHUYDOX WMP 1 7RVXSSRUWWKHPLQLPLVDWLRQRIZDVWH FDUSDUNLQWKHFHQWUHRIWRZQ7KHFORVHVW&LYLF FUHDWLRQDQGWRSURPRWHDQGHQFRXUDJH $PHQLW\&HQWUHLVORFDWHGLQ3RZHUVWRZQ HGXFDWLRQDQGDZDUHQHVVRQDOOLVVXHV DVVRFLDWHGZLWKZDVWHSUHYHQWLRQ ZKLFKSURYLGHVIRUDZLGHUDQJHRIKRXVHKROG PLQLPLVDWLRQUHXVHUHF\FOLQJDQG UHF\FOLQJPDWHULDOV7KH&RXQFLOZLOOFRQWLQXH UHFRYHU\DWKRXVHKROGLQGXVWU\DQG WRHQFRXUDJHUHF\FOLQJDQGWKHPLQLPLVDWLRQRI FRPPXQLW\OHYHO ZDVWHWKURXJKLWVHQYLURQPHQWDOHGXFDWLRQ SURJUDPPHDQGWKH*UHHQ6FKRROV SURJUDPPH Tullow Draft LAP 2016-2022 - 77 - WMP 2 7RVDIHJXDUGWKHHQYLURQPHQWE\VHHNLQJ SURYLGHUV7KHDELOLW\WRGHOLYHUDVHFXUHDQG WRHQVXUHWKDWUHVLGXDOZDVWHLVGLVSRVHG XQLQWHUUXSWHGVXVWDLQDEOHHQHUJ\VXSSO\DWD RIDSSURSULDWHO\ FRPSHWLWLYHFRVWLVFULWLFDOIRU7XOORZWR FRQWLQXHWRDWWUDFWLQZDUGLQYHVWPHQWDQGWR WMP 3:7RVHHNWRHQVXUHWKDW7XOORZLVVHUYHGE\ DGHTXDWHUHF\FOLQJIDFLOLWLHVLQWKHIRUPRI SURYLGHDVXSSRUWLYHHQYLURQPHQWIRULQGXVWU\ NHUEVLGHFROOHFWLRQFLYLFVLWHDQGEULQJ EDQNUHF\FOLQJIDFLOLWLHVDQGWRDGHTXDWHO\ 7KHSODQDLPVWRVHHNDEDODQFHEHWZHHQWKH PDLQWDLQH[LVWLQJUHF\FOLQJIDFLOLWLHV QHHGWRPDLQWDLQDQGGHYHORSHQHUJ\DQG WHOHFRPPXQLFDWLRQVLQIUDVWUXFWXUHZKLOHKDYLQJ WMP 4 7RVXSSRUWWKHLPSOHPHQWDWLRQRIWKH UHJDUGWRDPHQLWLHVSURWHFWHGDUHDVDQG 6RXWKHUQ:DVWH0DQDJHPHQW3ODQ VHQVLWLYHODQGVFDSHV&DUORZ&RXQW\&RXQFLO &DUORZ&RXQW\&RXQFLO¶V/LWWHU ZLOOFRQWLQXHWRSURPRWHDQGLPSOHPHQWHQHUJ\ 0DQDJHPHQW3ODQWKH HIILFLHQF\DQGFRQVHUYDWLRQLQH[LVWLQJDQG 1DWLRQDO:DVWH3UHYHQWLRQ3URJUDPPH IXWXUHUHVLGHQWLDOFRPPHUFLDODQGLQGXVWULDO WKH(3$¶V1DWLRQDO+D]DUGRXV:DVWH 0DQDJHPHQW3ODQDQGDQ\ EXLOGLQJVZLWKLQ7XOORZ VXSHUVHGLQJYHUVLRQVRIWKHVHSODQVRYHU 5HQHZDEOHHQHUJ\LVLQFUHDVLQJO\VHHQDVD WKHOLIHWLPHRIWKLV/RFDO$UHD3ODQ PHDQVWRDGGUHVVFOLPDWHFKDQJHFKDOOHQJHV WMP 5 7RVHHNWRPDQDJHDQGGLVSRVHRI UHGXFHFDUERQGLR[LGHHPLVVLRQVDQGLQFUHDVH FRQVWUXFWLRQZDVWHLQDZD\WKDWHQVXUHV QDWLRQDOHQHUJ\VHFXULW\,UHODQG¶VQHHGWR WKHSURYLVLRQVRIWKH:DVWH0DQDJHPHQW VXSSRUWUHQHZDEOHHQHUJ\VWHPVIURPLWV(8 $FWVDQGQHZ6RXWKHUQ:DVWH FRPPLWPHQWVQDPHO\WKH(8'LUHFWLYH 0DQDJHPHQW3ODQ (&RQWKH3URPRWLRQRI5HQHZDEOH &RQVWUXFWLRQ:DVWH0DQDJHPHQW3ODQV (QHUJ\6RXUFHV&DUORZ&RXQW\&RXQFLO ZLOOEHLPSOHPHQWHGZKHUHUHOHYDQWWR PLQLPLVHZDVWHDQGHQVXUHFRUUHFW UHFRJQLVHVWKHLPSRUWDQFHRIGHYHORSLQJ KDQGOLQJDQGGLVSRVDORIFRQVWUXFWLRQ UHQHZDEOHHQHUJ\UHVRXUFHVLQWKHLQWHUHVWRI ZDVWHVWUHDPVLQDFFRUGDQFHZLWKWKH%HVW GHOLYHULQJRQWKH1DWLRQDO&OLPDWH&KDQJH 3UDFWLFH*XLGHOLQHVRQWKH3UHSDUDWLRQRI $GDSWDWLRQ)UDPHZRUN :DVWH0DQDJHPHQW3ODQVIRU&RQVWUXFWLRQ DQG'HPROLWLRQ3URMHFWV'HSDUWPHQWRI 7KH3ODQQLQJDQG'HYHORSPHQW5HJXODWLRQV WKH(QYLURQPHQW-XO\ DQGSURYLGHVRPHH[HPSWLRQVIURP SODQQLQJSHUPLVVLRQIRUVRODUSDQHOKHDW SXPSVZLQGWXUELQHVDQGZRRGSHOOHWEXUQHUV It is an objective of Carlow County Council: VXEMHFWWRFHUWDLQFRQGLWLRQVDQGOLPLWDWLRQV +RZHYHUWKHUHVWULFWLRQVRQH[HPSWHG WMO 1 7RHOLPLQDWHDOOXQDXWKRULVHGIO\WLSSLQJ GHYHORSPHQWDVVHWRXWLQ$UWLFOH RIWKH DQGWRUHJXODWHDQGFRQWUROWKHGLVSRVDORI 3ODQQLQJDQG'HYHORSPHQW5HJXODWLRQV DOOEXLOGHUVVSRLODQGUXEEOH DVDPHQGHG DOVRVWLOODSSO\:KHUHDQ LQGLYLGXDOZLVKHVWRLQVWDOODQ\FODVVRIPLFUR WMO 2 7RDVVHVVWKHIHDVLELOLW\RIDGGLWLRQDO UHF\FOLQJLQFOXGLQJFRPSRVWLQJIDFLOLWLHVLQ UHQHZDEOHWHFKQRORJ\WKDWGRHVQRWIDOOZLWKLQ WKHWRZQRUHQYLURQVDWDORFDWLRQ V WKDW WKHH[HPSWLRQVWKH\DUHUHTXLUHGWRDSSO\IRU ZLOOQRWDGYHUVHO\DIIHFWUHVLGHQWLDODPHQLW\ SODQQLQJSHUPLVVLRQ RUHQYLURQPHQWDOTXDOLW\ WMO 3 7RSURPRWHDQGIDFLOLWDWHFRPPXQLWLHVWR EHFRPHLQYROYHGLQHQYLURQPHQWDO It is the policy of Carlow County Council: DZDUHQHVVDFWLYLWLHVDQGFRPPXQLW\EDVHG UHF\FOLQJLQLWLDWLYHVRUHQYLURQPHQWDO ECP 1 7RVXSSRUWWKHSURYLVLRQRIDGHTXDWH PDQDJHPHQWLQLWLDWLYHVWKDWZLOOOHDGWR HQHUJ\DQGFRPPXQLFDWLRQVLQIUDVWUXFWXUH ORFDOVXVWDLQDEOHZDVWHPDQDJHPHQW WRVHUYLFHGHYHORSPHQWVLQFOXGLQJJDV SUDFWLFHV HOHFWULFLW\EURDGEDQGDQGWHOHSKRQH VHUYLFHV,QSDUWLFXODUWKH&RXQFLO 9.4.6 Energy and Communications VXSSRUWVWKHLQFUHDVHGXVHRIUHQHZDEOH HQHUJ\DQGWKHDLPVRIVXVWDLQDEOHHQHUJ\ $OOGHYHORSPHQWVUHTXLUHDGHTXDWHSRZHU XVHDQGFRQVHUYDWLRQLQEXLOGLQJGHVLJQ HQHUJ\DQGWHOHFRPPXQLFDWLRQVVHUYLFHV DQGFRQVWUXFWLRQ LQFOXGLQJHOHFWULFLW\JDVVXSSO\WHOHSKRQH VHUYLFHVDQGEURDGEDQGZKLFKDUHSURYLGHGLQ 7XOORZE\DQXPEHURIGLIIHUHQWVHUYLFH Tullow Draft LAP 2016-2022 - 78 - It is an objective of Carlow County Council: DUHDVE\PHDVXUHVVXFKDVOD\RXWGHVLJQ DQGRUDWWHQXDWLRQPHFKDQLVPV7KHFRVWRI ECO 1: 7RIDFLOLWDWHWKHSURYLVLRQRIDQDGHTXDWH VXFKPHDVXUHVVKDOOEHERUQHE\WKH WHOHFRPPXQLFDWLRQVLQIUDVWUXFWXUHZLWKLQ GHYHORSHU WKHSODQDUHDLQFOXGLQJWHOHSKRQHDQG EURDGEDQGVHUYLFHVWRWKHUHTXLUHPHQWVRI 7KH&RXQFLOZLOOUHTXLUHWKHVXEPLVVLRQRI WKHUHOHYDQWVHUYLFHSURYLGHUVDQGLQ DFFRUGDQFHZLWKWKHSULQFLSOHVRISURSHU 1RLVH,PSDFW$VVHVVPHQWVZKHUHLWLV SODQQLQJDQGVXVWDLQDEOHGHYHORSPHQW SURSRVHGWRLQWURGXFHQRLVHFUHDWLQJXVHVLQ SUR[LPLW\WRQRLVHVHQVLWLYHXVHVVXFKDV ECO 2 7RIDFLOLWDWHWKHSURYLVLRQRIDQDGHTXDWH UHVLGHQWLDODUHDVDQGLISHUPLVVLRQLVEHLQJ VXSSO\RIHOHFWULFLW\DQGJDVWR JUDQWHGPD\LPSRVHFRQGLWLRQVPLWLJDWLQJ GHYHORSPHQWVLQWKHSODQDUHDWRWKH LPSDFW6LPLODUO\ZKHUHQRLVHVHQVLWLYHXVHV UHTXLUHPHQWVRIWKHUHOHYDQWVHUYLFH DUHSURSRVHGZLWKLQSUR[LPLW\WRDQRLVH SURYLGHUDQGLQDFFRUGDQFHZLWKWKH VRXUFHVXFKDVEXV\URDGVUDLOOLQHVHWF SULQFLSOHVRISURSHUSODQQLQJDQG SURSRVDOVVKDOOLQFOXGHQRLVHDQGRUYLEUDWLRQ VXVWDLQDEOHGHYHORSPHQW DWWHQXDWLRQPHDVXUHVLQDQ\SODQQLQJ DSSOLFDWLRQ ECO 3 7RUHTXLUHQHZEXLOGLQJVWREHVXVWDLQDEOH LQWKHLUVLWLQJRULHQWDWLRQGHVLJQDQG Air FRQVWUXFWLRQ3DVVLYHVRODUGHVLJQ WHFKQLTXHVKLJKHQHUJ\HIILFLHQF\ORZ LPSDFWFRQVWUXFWLRQPHWKRGVDQGWKHXVH $LUSROOXWLRQFDQDIIHFWWKHKHDOWKDQGZHOO RIORFDOEXLOGLQJPDWHULDOVVKDOOEH EHLQJRIVHQVLWLYHSRSXODWLRQJURXSVDQG HQFRXUDJHGWRHQVXUHWKDWQHZ HFRV\VWHPV7KHPRVWVHQVLWLYHDUHDVLQ GHYHORSPHQWVPLQLPLVHWKHHQYLURQPHQWDO UHODWLRQWRDLUTXDOLW\DUHEXLOWXSXUEDQDUHDV LPSDFWVDQGORQJWHUPFRVWV DQGPDMRUWUDQVSRUWGHYHORSPHQWV&DUORZ &RXQW\&RXQFLOVXSSRUWVWKH3ROOXWHU3D\V ECO 4 7RSURPRWHDQGIDFLOLWDWHWKHGHYHORSPHQW 3ULQFLSOHDQGZLOOKDYHUHJDUGWRWKH(8 RIUHQHZDEOHVRXUFHVRIHQHUJ\ZLWKLQWKH )UDPHZRUN'LUHFWLYHRQ$LU4XDOLW\ SODQDUHDDQGHQFRXUDJHWKHLQWHJUDWLRQRI $VVHVVPHQWUHODWLQJWRDLUTXDOLW\VWDQGDUGV PLFURUHQHZDEOHHQHUJ\VRXUFHVLQWRWKH GHVLJQDQGFRQVWUXFWLRQRIQHZ Light GHYHORSPHQWVDVDSSURSULDWH ECO 5 7RVHHNWRSURYLGHPRUHSXEOLFZLIL]RQHV &DUORZ&RXQW\&RXQFLOZLOOFRQVLGHUSRWHQWLDO LQ7XOORZ LPSDFWVDULVLQJIURPOLJKWSROOXWLRQUHODWLQJWR QHZGHYHORSPHQWDQGWKHLQWHQVLILFDWLRQRU ECO 6: 7ROLDLVHZLWKWKH(6%WRLQYHVWLJDWHDQG DOWHUDWLRQRIH[LVWLQJGHYHORSPHQWV7KH HQFRXUDJHZKHUHSRVVLEOHWKHGXFWLQJDQG FRQWURORIOLJKWSROOXWLRQLVDSSURSULDWHLQWKH XQGHUJURXQGURXWLQJRIRYHUKHDG LQWHUHVWVRIQDWXUHFRQVHUYDWLRQUHVLGHQWLDO SRZHUOLQHVLQ7XOORZLQWDQGHPZLWKRWKHU DPHQLW\DQGHQHUJ\HIILFLHQF\ ZRUNSURJUDPPHVVXFKDVURDG UHVXUIDFLQJDQGIRRWSDWKFRQVWUXFWLRQ ZRUNV It is the policy of Carlow County Council: 9.4.7 Noise / Air / Light Pollution P 1 7RSURPRWHWKHSUHVHUYDWLRQRIEHVWDPELHQW 7KHLPSRUWDQFHRIDFOHDQHQYLURQPHQWIRUWKH DLUTXDOLW\FRPSDWLEOHZLWKVXVWDLQDEOH HFRQRPLFDQGVRFLDOOLIHRI7XOORZLV GHYHORSPHQWLQDFFRUGDQFHZLWKWKH(8 UHFRJQLVHG,QWKLVUHJDUGFRQWLQXRXVHIIHFWLYH $PELHQW$LU4XDOLW\DQG&OHDQHU$LUIRU(XURSH PRQLWRULQJDQGHQIRUFHPHQWLQUHODWLRQWR &$)( 'LUHFWLYH (& DQGHQVXUH SROOXWLRQFRQWUROPHDVXUHVLVLPSHUDWLYHDQG WKDWDOODLUHPLVVLRQVDVVRFLDWHGZLWKQHZ ZLOOFRQWLQXHRYHUWKHSHULRGRIWKLV3ODQ GHYHORSPHQWVDUHZLWKLQ(QYLURQPHQWDO 4XDOLW\6WDQGDUGVDVVHWRXWLQWKH$LU4XDOLW\ Noise 6WDQGDUGV5HJXODWLRQV 6,1RRI RUDQ\XSGDWHGVXSHUVHGLQJ 1RLVHSROOXWLRQKDVEHFRPHDQLQFUHDVLQJO\ GRFXPHQWV LPSRUWDQWLVVXHDVLWDIIHFWVWKHTXDOLW\RIOLIH P2: 7RVHHNWRSUHVHUYHDQGPDLQWDLQJRRGDLUDQG DQGDOVRKDVKHDOWKLPSDFWV&DUORZ&RXQW\ QRLVHTXDOLW\VWDQGDUGVLQ7XOORZLQ &RXQFLOZLOOVHHNWRFRQWUROQRLVHDQGRU DFFRUGDQFHZLWKEHVWSUDFWLFHDQGUHOHYDQW YLEUDWLRQOHYHOVDWVLWHERXQGDULHVRUZLWKLQ OHJLVODWLRQ DGMDFHQWVHQVLWLYHDUHDVHVSHFLDOO\UHVLGHQWLDO Tullow Draft LAP 2016-2022 - 79 - P3 7RSURPRWHWKHSUHVHUYDWLRQRIEHVWDPELHQW DLUTXDOLW\FRPSDWLEOHZLWKVXVWDLQDEOH GHYHORSPHQW P4 7RVHHNWKHFRQWURORIOLJKWLQJRIGHYHORSPHQW LQSDUWLFXODUVHQVLWLYHORFDWLRQV P 5 7RHQVXUHWKDWDGHTXDWHVRLOSURWHFWLRQ PHDVXUHVDUHXQGHUWDNHQZKHUHDSSURSULDWH $SSURSULDWHLQYHVWLJDWLRQVVKDOOEHFDUULHGRXW LQWRWKHQDWXUHRIDQ\VRLODQGJURXQGZDWHU FRQWDPLQDWLRQDQGWKHULVNVDVVRFLDWHGZLWK VLWHGHYHORSPHQWZRUNV It is an objective of Carlow County Council: PO 1: 7RDVVHVVSURSRVDOVIRUGHYHORSPHQWLQ WHUPVRILQWHUDOLDSRWHQWLDOLPSDFWRQ H[LVWLQJDGMDFHQWGHYHORSPHQWVH[LVWLQJ ODQGXVHVDQGRUWKHVXUURXQGLQJ ODQGVFDSH:KHUHSURSRVHGGHYHORSPHQWV ZRXOGEHOLNHO\WRKDYHDVLJQLILFDQW DGYHUVHHIIHFWRQWKHDPHQLWLHVRIWKHDUHD WKURXJKSROOXWLRQE\QRLVHIXPHVRGRXUV GXVWJULWRUYLEUDWLRQRUFDXVHSROOXWLRQRI DLUZDWHUDQGRUVRLOWKH&RXQFLOVKDOO HQVXUHWKHLQWURGXFWLRQRIPLWLJDWLRQ PHDVXUHVLQRUGHUWRHOLPLQDWHDGYHUVH HQYLURQPHQWDOLPSDFWVRUUHGXFHWKHPWR DQDFFHSWDEOHRSHUDWLQJOHYHO PO 2: 7RHQVXUHWKHLPSOHPHQWDWLRQRIWKH VSHFLILFJXLGDQFHRQUDGRQSUHYHQWLRQ PHDVXUHVIRUQHZKRPHVDVFRQWDLQHG ZLWKLQWKHH[LVWLQJ%XLOGLQJ5HJXODWLRQV LQFOXGLQJDQ\XSGDWHGVXSHUVHGLQJ UHJXODWLRQVWKDWPD\EHSXEOLVKHGZLWKLQ WKHOLIHWLPHRIWKLV3ODQ Tullow Draft LAP 2016-2022 - 80 - CHAPTER 10 BUILT AND NATURAL HERITAGE 10.1 Introduction 10.2 Challenges 7XOORZLVRQHRIILYHVHWWOHPHQWVLQ&DUORZ 7KHNH\FKDOOHQJHLQWHUPVRIWKHEXLOWKHULWDJH RULJLQDWLQJIURP$QJOR1RUPDQ7LPHVDQG LQ7XOORZLVWREDODQFHWKHDUFKDHRORJLFDODQG DORQJZLWK/HLJKOLQEULGJHDQG&DUORZ7RZQLW DUFKLWHFWXUDOKHULWDJHRIWKHWRZQZLWKLWVIXWXUH KDVVXUYLYHGDVDSRSXODWLRQFHQWUHVLQFHWKDW JURZWK$QLPSRUWDQWPHFKDQLVPWRDFKLHYH WLPH7KHWRZQGHFOLQHGLQVL]HGXULQJWKH WKLVLVWRIRUPXODWHDSSURSULDWHREMHFWLYHVIRU ODWHU0LGGOH$JHVEXWZLWKWKHUHYLYDORI WKHSURWHFWLRQHQKDQFHPHQWDQGPDQDJHPHQW (QJOLVKLQIOXHQFHLQ,UHODQGGXULQJWKH RIWKHEXLOWKHULWDJHZKLOHHQFRXUDJLQJ VL[WHHQWKDQGVHYHQWHHQWKFHQWXULHVWKHWRZQ UHJHQHUDWLRQDQGFKDQJH,WLVHTXDOO\ WRRNRQDQHZSURVSHULW\DQGPXFKRILWV LPSRUWDQWWRLQFUHDVHSXEOLFDZDUHQHVVRIWKH SUHVHQWOD\RXWSDUWLFXODUO\DURXQG0DUNHW LPSRUWDQFHRIFRQVHUYLQJLPSRUWDQW 6TXDUHRULJLQDWHGIURPWKDWWLPH DUFKLWHFWXUDOIHDWXUHVDQGVWUHHWVFDSHV 7KH/$3DUHDDGMRLQVWKH5LYHU6ODQH\D 7KHWRXULVPLQGXVWU\LVDQDUHDZKHUHWKLV GHVLJQDWHG6SHFLDO$UHDRI&RQVHUYDWLRQ WRZQFDQJURZVLJQLILFDQWO\LQWRWKHIXWXUHDQG 5HIHUVHFWLRQ ,WLVDUHTXLUHPHQWXQGHU WKLVUHOLHVODUJHO\RQWKHDWWUDFWLYHQHVVRIWKH WKH(8+DELWDWVDQG%LUGV'LUHFWLYHVWRSURWHFW WRZQVKRZLQJRIILWVKHULWDJHDQGGHYHORSLQJ (8'HVLJQDWHG6LWHV7XOORZKDVDKLJK IDFLOLWLHVDFFRUGLQJO\8QORFNLQJWKHWRXULVP DPHQLW\DQGDWWUDFWLYHJUHHQVHWWLQJHVSHFLDOO\ SRWHQWLDORIWKHWRZQFHQWUHDQGHVSHFLDOO\ WRWKHVRXWKHDVWRIWKHEULGJHZLWKDUHDVRI DORQJWKHULYHULVDNH\FKDOOHQJHRIWKLV/RFDO LPSRUWDQWQDWXUDOKHULWDJHHQFRPSDVVLQJ $UHD3ODQ(QOLYHQLQJVWUHHWVDQGSXEOLF ZHWODQGVJUDVVHGDUHDVDQGZLOGOLIHFRUULGRUV VSDFHVZLWKPDUNHWVDQGHQWHUWDLQPHQW JUHHQLQJDQGFUHDWLQJSHGHVWULDQIULHQGO\ 7KHHQYLURQPHQWLVDYDOXDEOHEXWYXOQHUDEOH URXWHVZLOOEHUHTXLUHGWRUHJHQHUDWH7XOORZ UHVRXUFH7KHTXDOLW\DQGLQWHJULW\RIWKH DQGFUHDWHDQDWWUDFWLYHDQGDFWLYHFHQWUH QDWXUDODQGEXLOWHQYLURQPHQWLVUHWDLQHGZKHQ 'HYHORSLQJJUHHQZD\VLQDVHQVLWLYHPDQQHU LWLVPDQDJHGSURWHFWHGDQGZKHUHQHFHVVDU\ DORQJWKHULYHURUHQKDQFLQJWKHZDONLQJURXWHV HQKDQFHG3ROLFLHVDQGREMHFWLYHVDUHRXWOLQHG DORQJWKHULYHURXWRIWRZQWRZDUGVSODFHVOLNH WRVHHNWREDODQFHWKHQHHGWRIDFLOLWDWH $OWDPRQW*DUGHQVZRXOGEHRIKXJHEHQHILWWR VXVWDLQDEOHGHYHORSPHQWZKLOHSURWHFWLQJWKH WKHWRZQLWVHFRQRP\DQGXOWLPDWHO\LWV HQYLURQPHQW7KH/$3DOVRSURPRWHVWKH VXVWDLQDEOHJURZWK,QWKHWRZQFHQWUHKRZ GHYHORSPHQWRIDJUHHQLQIUDVWUXFWXUHQHWZRUN EXLOGLQJVDGMRLQLQJWKHULYHUUHODWHWRDQG IRU7XOORZDQGLWVHQYLURQVZKHUHZDONLQJ YLVXDOO\HQKDQFHWKHLUSURPLQHQWORFDWLRQRQ F\FOLQJUHFUHDWLRQDQGQDWXUHELRGLYHUVLW\DUH WKH5LYHU6ODQH\PXVWEHJLYHQKLJK LQWHJUDWHGDQGFDQFRPSOHPHQWWKHIXWXUH FRQVLGHUDWLRQ VXVWDLQDEOHGHYHORSPHQWRIWKHDUHD ,WLVDOVRLPSRUWDQWWKDWSHRSOHDUHHQFRXUDJHG WROLYHDERYHVKRSVDQGEXVLQHVVHVLQWKH WRZQFRUH7KHFKDOOHQJHIRUWKHIXWXUHLVWR SURWHFWWKHXQLTXHFKDUDFWHURI7XOORZDVD KLVWRULFPDUNHWWRZQZLWKVHQVLWLYHLQILOO SURMHFWVDQGFRPSOHPHQWDU\EXLOGLQJVZKLFK PXWXDOO\UHVSHFWWKHLUVXUURXQGLQJV )DFLOLWDWLQJGHYHORSPHQWDQGPDLQWDLQLQJWKH LQWHJULW\RIWKHQDWXUDOHQYLURQPHQWLVDOVRD NH\FKDOOHQJH(QKDQFLQJDQGLPSURYLQJ SXEOLFRSHQVSDFHDQGSURYLGLQJRSSRUWXQLWLHV IRUSDVVLYHDQGDFWLYHUHFUHDWLRQDUHUHTXLUHG 7KHVHFDQEHDFKLHYHGE\ x5HHYDOXDWLQJWKHH[LVWLQJSXEOLFRSHQ VSDFHKLHUDUFK\IRUWKHIXWXUH Tullow Draft LAP 2016-2022 - 81 - x5HFRJQLVLQJWKHSRWHQWLDORIH[LVWLQJRSHQ 10.4.1 Record of Protected Structures VSDFHVIRULPSURYHPHQWDQGWKHFUHDWLRQRI OLQNDJHVEHWZHHQDUHDVRIRSHQVSDFH 7KHFXUUHQW&DUORZ&RXQW\'HYHORSPHQW3ODQ LQFRUSRUDWHVWKH5HFRUGRI3URWHFWHG x%DODQFLQJPHDVXUHVWRVXSSRUWDQG 6WUXFWXUHVZKLFKSURWHFWVVWUXFWXUHVZKLFKDUH HQKDQFHELRGLYHUVLW\DJDLQVWUHFUHDWLRQDO FRQVLGHUHGWREHRIVSHFLDODUFKLWHFWXUDO QHHGV KLVWRULFDODUFKDHRORJLFDODUWLVWLFFXOWXUDO VFLHQWLILFVRFLDOWHFKQLFDOLQWHUHVWRUYDOXH$ x3URPRWLQJRISK\VLFDODFWLYLW\DQGKHDOWK\ VWDWXWRU\IUDPHZRUNIRUSURWHFWLQJPDQDJLQJ OLIHVW\OHV DQGHQKDQFLQJKLVWRULFWRZQVLVVHWRXWLQWKH 3ODQQLQJDQG'HYHORSPHQW$FW DV x3URYLGLQJDQGPDLQWDLQLQJSOD\VSDFHVDQG DPHQGHG 7KHLQFOXVLRQRIDVWUXFWXUHRQWKH VSRUWVIDFLOLWLHVDWQHLJKERXUKRRGOHYHO 536GRHVQRWSUHFOXGHDSSURSULDWHXVHRU GHYHORSPHQW 10.3 Strategic Approach 7KHUHDUHSURWHFWHGVWUXFWXUHVORFDWHG ZLWKLQ7XOORZGUDIWSODQDUHDH[DPSOHVLQFOXGH &DUORZ&RXQW\&RXQFLOZLOOWDNHWKHIROORZLQJ 7XOORZ0RQDVWHU\1DWLRQDO6FKRRO6W DSSURDFKWRSURWHFWLQJDQGHQKDQFLQJ7XOORZ¶V &ROXPED¶V1DWLRQDO6FKRROWKH%ULGJH+RXVH EXLOWDQGQDWXUDOKHULWDJH WKH&RDFKKRXVHRQWKH'XEOLQ5RDGWKH &RXUWKRXVHDQGWKH0XVHXP3ODQQLQJ x (PSKDVLVLQJWKHUHJHQHUDWLRQRIWKH SHUPLVVLRQPXVWEHREWDLQHGEHIRUHVLJQLILFDQW KLVWRULFPDUNHWWRZQFRUHWRLWVIRUPHU ZRUNVZKLFKZRXOGPDWHULDOO\DOWHUWKH FXOWXUDODQGKLVWRULFLPSRUWDQFHVRDVWR FKDUDFWHURIDSURWHFWHGVWUXFWXUHFDQEH OHYHUDJHHFRQRPLFDQGVRFLDOEHQHILWVIRU FDUULHGRXW$IXOOOLVWRIWKH5HFRUGRI WKHWRZQ 3URWHFWHG6WUXFWXUHVZLWKLQWKH3ODQDUHDLV FRQWDLQHGLQ7DEOHDQG0DS DQGRI x 3URWHFWLQJDQGHPEUDFLQJWKHEXLOW WKLVGUDIWSODQ KHULWDJHDVDILQLWHUHVRXUFH 6WUXFWXUHVRIORFDOLQWHUHVWLQ7XOORZDUH x 3URPRWLQJDUHDVRQDEOHEDODQFHEHWZHHQ EXLOGLQJVRIVLJQLILFDQFHWKDWUHWDLQWUDGLWLRQDO FRQVHUYDWLRQPHDVXUHVDQGGHYHORSPHQW IHDWXUHVDQGWKDWFRQWULEXWHWRORFDO REMHFWLYHVLQWKHLQWHUHVWRISURPRWLQJWKH GLVWLQFWLYHQHVVZKLOHVKDULQJIRUPVDQGVW\OHV RUGHUO\GHYHORSPHQWRIWKHWRZQ WKDWDUHXQLTXHWR,UHODQG&DUORZ&RXQW\ &RXQFLOUHFRJQLVHVWKHLPSRUWDQFHRI x 3URWHFWLQJQDWLRQDOLPSRUWDQWVLWHV VWUXFWXUHVRIORFDOLQWHUHVWDQGWKHLPSRUWDQW LQFOXGLQJWKH6SHFLDO$UHDRI FRQWULEXWLRQWKH\PDNHWRWKHKHULWDJH &RQVHUYDWLRQ 5LYHU6ODQH\ DWWULEXWHVRIWKHWRZQ x 3URPRWHKDELWDWHQKDQFHPHQWDVDQ LQWHJUDOSDUWRIDQ\GHYHORSPHQW x &UHDWLQJVXVWDLQDEOHFRQQHFWLYLW\EHWZHHQ JUHHQDUHDV x 3URYLGLQJIRUWKHUHFUHDWLRQDODQGDPHQLW\ QHHGVRIWKHFRPPXQLW\ 10.4 Architectural Heritage $UFKLWHFWXUDOKHULWDJHLVDQLQWULQVLFSDUWRIRXU KHULWDJHDQGUHIHUVWRDOOPDQPDGHIHDWXUHVLQ WKHHQYLURQPHQWLQFOXGLQJEXLOGLQJVDQGRWKHU VWUXFWXUHVVXFKDVEULGJHVZHOOVZDOOVDQG VWUHHWIXUQLWXUH7KHVWUXFWXUHVZKLFKIRUPWKH DUFKLWHFWXUDOKHULWDJHRIWKHWRZQSOD\DQ LQWHJUDOSDUWLQWKHOLIHRIWKHWRZQ Tullow Draft LAP 2016-2022 - 82 - 10.4.2 Archaeological Heritage &:&:&: &:RU&: 7KHDUFKDHRORJLFDOKHULWDJHRIDQDUHD LQFOXGHVVWUXFWXUHVFRQVWUXFWLRQVJURXSVRI EXLOGLQJVGHYHORSHGVLWHVPRYHDEOHREMHFWV It is a policy of Carlow County Council: PRQXPHQWVRIRWKHUNLQGVDVZHOODVWKHLU FRQWH[WZKHWKHUVLWXDWHGRQODQGRUXQGHU HR 1:7RFRQWULEXWHDVDSSURSULDWHWRZDUGVWKH ZDWHU SURWHFWLRQDQGV\PSDWKHWLFHQKDQFHPHQWRI DUFKDHRORJLFDOKHULWDJHLQSDUWLFXODUE\ LPSOHPHQWLQJWKHUHOHYDQWSURYLVLRQVRIWKH 7KHUHDUHGHVLJQDWHGDUHDVRI 3ODQQLQJDQG'HYHORSPHQW$FW DV DUFKDHRORJLFDOSRWHQWLDOZLWKLQ7XOORZ¶V]RQLQJ DPHQGHG DQGWKH1DWLRQDO0RQXPHQWV$FW ERXQGDU\UHFRUGHGRQWKH23:¶V6LWHVDQG DVDPHQGHG 0RQXPHQWV5HFRUG SOHDVHUHIHUWR0DS HR 2: 7RFRQWULEXWHDVDSSURSULDWHWRZDUGVWKH 7KHVHDUHDVIROORZV SURWHFWLRQRIDUFKDHRORJLFDOVLWHVDQG PRQXPHQWVDQGWKHLUVHWWLQJV x &:7XOORZSKHOLP±$+RO\ DUFKDHRORJLFDOREMHFWVDQGXQGHUZDWHU DUFKDHRORJLFDOVLWHVWKDWDUHOLVWHGLQWKH :HOO 5HFRUGRI0RQXPHQWVDQG3ODFHVLQWKH x &:±7XOORZSKHOLP± RZQHUVKLSJXDUGLDQVKLSRIWKH6WDWHRUWKDW 7XPXOXV6LWH DUHVXEMHFWRI3UHVHUYDWLRQ2UGHUVRUKDYH x &:±7XOORZEHJ EHHQUHJLVWHUHG LQWKH5HJLVWHURI+LVWRULF 7HPSOHRZHQ7XOORZSKHOLP±7RZQ 0RQXPHQWV&RQWULEXWHDVDSSURSULDWH x &:±0RXQW:ROVHOH\RU WRZDUGVWKHSURWHFWLRQDQGSUHVHUYDWLRQRI &URVVORZ±0RXQG DUFKDHRORJLFDOVLWHVZKLFKKDYHEHHQ LGHQWLILHGVXEVHTXHQWWRWKHSXEOLFDWLRQRI x &:±7XOORZSKHOLP± WKH5HFRUGRI0RQXPHQWVDQG3ODFHV (QFORVXUH x &:±7XOORZEHJ± HR 3: 7RHQVXUHWKHLPSOHPHQWDWLRQRIWKH 5HOLJLRXV+RXVH$XJXVWLQLDQ%URWKHUV OHJLVODWLYHVWDWXWRU\DQGSROLF\SURYLVLRQV x &:±7XOORZSKHOLP± UHOHYDQWWRWKHFRQVHUYDWLRQRIWKHEXLOW &DVWOH0RWWH KHULWDJHLQFOXGLQJWKHIROORZLQJ DQGDQ\ x &:±7XOORZSKHOLP± XSGDWHGVXSHUVHGLQJGRFXPHQWV &DVWOH $QJOR1RUPDQ0DVRQU\ &DVWOH /HJLVODWLYHSURYLVLRQVLQWKH3ODQQLQJDQG x &:±7XOORZEHJ± 'HYHORSPHQW$FW DVDPHQGHG DQG WKH1DWLRQDO0RQXPHQWV$FW DV *UDYH\DUG DPHQGHG x &:±7XOORZSKHOLP± &KXUFK 6WDWXWRU\SURYLVLRQVLQWKH&DUORZ&RXQW\ x &: ±7XOORZEHJ±5LWXDO 'HYHORSPHQW3ODQLQFOXGLQJWKH5HFRUGRI 6LWHKRO\ZHOO 3URWHFWHG6WUXFWXUHV x &:±7XOORZEHJ±&URVV KLJKFURVV 3ROLF\JXLGDQFHLQ*RYHUQPHQW3ROLF\RQ x &:±7XOORZSKHOLP± $UFKLWHFWXUH WKH$UFKLWHFWXUDO )RQW +HULWDJH3URWHFWLRQ*XLGHOLQHV WKH$UFKDHRORJ\DQG'HYHORSPHQW x &:±7XOORZSKHOLP± *XLGHOLQHVIRU*RRG3UDFWLFHIRU'HYHORSHUV &URVV x &:±7XOORZSKHOLP± HR 4:7RDFNQRZOHGJHDQGSURPRWHDZDUHQHVVRI *UDYH\DUG WKHRULJLQVKLVWRULFDOGHYHORSPHQWDQG x &:±7XOORZEHJ±&URVV FXOWXUDOKHULWDJHRIWKHWRZQDQGWRJHQHUDOO\ x &:±7XOORZSKHOLP± VXSSRUWKLJKTXDOLW\GHYHORSPHQWVWKDWUHODWH *UDYHVODE WRORFDOKHULWDJHDQGWRHQVXUHWKDWQHZ x &:±7XOORZSKHOLP± GHYHORSPHQWUHVSHFWVDQGLVUHVSRQVLYHWR VDPH *UDYHVODE x &:±7XOORZSKHOLP± HR 5:7RUHTXLUHDQDSSURSULDWHDUFKDHRORJLFDO *UDYHVODE DQG DVVHVVPHQWWREHFDUULHGRXWE\OLFHQFHG x &:±0RXQW:ROVHOH\RU DUFKDHRORJLVWLQUHVSHFWRIDQ\SURSRVHG &URVVORZ±&URVV GHYHORSPHQWOLNHO\WRKDYHDQLPSDFWRQD UHFRUGHGPRQXPHQWRULWVVHWWLQJDQGWR ,QWHUPVRIWKHQDPHGDERYHVLWHVRQWKH FRQVXOWZLWKWKH1DWLRQDO0RQXPHQWV6HUYLFH JURXQGWKHUHLVQRYLVLEOHHYLGHQFHRI&: RIWKH'HSDUWPHQWRI$UWV+HULWDJHDQGWKH Tullow Draft LAP 2016-2022 - 83 - *DHOWDFKWLQUHODWLRQWRSURSRVHG EXLOGLQJVWHOOWKHSHRSOHWKDWOLYHLQWKHPDQG GHYHORSPHQWVDGMRLQLQJDUFKDHRORJLFDOVLWHV WKHRSSRUWXQLWLHVWRHQJDJHZLWKDVSHFWVRI WUDGLWLRQDOFXOWXUHJHQHUDWHDVWURQJDSSHDOWR 10.4.3 Cultural Heritage YLVLWRUVDQGWKLVPD\EHDNH\DUHDWREH LQYHVWLJDWHGIXUWKHULQWRWKHIXWXUH 7KHFXOWXUDOKHULWDJHRIDQDUHDLVDJHQHUDO WHUPWKDWLQFOXGHVFXOWXUDOVHUYLFHVVXFKDV It is a policy of Carlow County Council: SXEOLFEXLOGLQJV HJOLEUDULHVDQGPXVHXPV DQGDOVRHQFRPSDVVHVDUDQJHRI HR 6: 7RVXSSRUWDQGSURPRWHWKHGHYHORSPHQW FKDUDFWHULVWLFVWKDWKHOSWRGHILQHDQDUHDDQG RIFXOWXUDOIDFLOLWLHVLQWKHWRZQ LWVSRSXODWLRQLQFOXGLQJORFDOFXVWRPVDQG WUDGLWLRQVODQJXDJHDQGOLWHUDWXUH,WLV 10.5 Natural Heritage LPSRUWDQWWRDFNQRZOHGJHWKHKLVWRULFDQG FXOWXUDOLGHQWLW\WKDWDWRZQOLNH7XOORZGLVSOD\V 1DWXUDOKHULWDJHLQFOXGHVWKHYDULHW\RIOLIHZH DQGHQVXUHWKDWQHZGHYHORSPHQWVXSSRUWV VHHDURXQGXVHYHU\GD\DQGDOVRLQFOXGHVWKH DQGFRPSOHPHQWVVDPH ODQGVFDSHDQGLWVJHRORJLFDOIRXQGDWLRQ7KH YDULHW\RIOLIHLVRIWHQUHIHUUHGWRDVELRORJLFDO 7KHUHLVDZHDOWKRISURWHFWHGEXLOGLQJVVXFK GLYHUVLW\RUELRGLYHUVLW\%LRGLYHUVLW\LVDZRUG DVWKH&RXUWKRXVHWKH0XVHXPERWK XVHGWRGHVFULEHWKHQDWXUDOZRUOGWKDW FKXUFKHVLQWKHWRZQDQG6W$XVWLQ¶V$EEH\ LQFOXGHVSHRSOHDQLPDOVSODQWVPLFUREHVDV ZKLFKDUHDWWULEXWHVWKDWFDQEHGHYHORSHG ZHOODVWKHSODFHVWKH\OLYHZKLFKDUHFDOOHG IXUWKHULQWRWKHIXWXUHHJFUHDWHDWUDLOWKURXJK KDELWDWV1DWXUDOKHULWDJHLQFOXGHVDZLGH WKHWRZQVKRZLQJWKHKLVWRULFEXLOGLQJVDQG UDQJHRIQDWXUDOIHDWXUHVDQGSURFHVVHVWKDW KRZWKH\UHODWHWRWKHWRZQVKLVWRU\$Q PDNHDQHVVHQWLDOFRQWULEXWLRQWRWKH KLVWRULFVWXG\RI7XOORZVKRXOGILUVWO\EH HQYLURQPHQWDOTXDOLW\HFRORJLFDOELRGLYHUVLW\ XQGHUWDNHQWRVHHKRZDOOWKHVHKLVWRULF ODQGVFDSHFKDUDFWHUYLVXDODPHQLW\ EXLOGLQJVUHODWHWRHDFKRWKHUDQGHYHQWKRXJK UHFUHDWLRQDODFWLYLWLHVSXEOLFKHDOWKDQG 7XOORZ&DVWOH EXLOWLQ LVQRORQJHULQ LQYHVWPHQWSRWHQWLDORIWKHWRZQDQGLWV H[LVWHQFHLWLVVRPHWKLQJWKDWFRXOGEH HQYLURQV UHIHUHQFHGLQDQ\KLVWRULFWUDLOWKURXJKWKH WRZQ $+DELWDW6XUYH\DQG%LRGLYHUVLW\5HSRUWZDV FRPPLVVLRQHGE\WKH7XOORZ7LG\7RZQV &RPPLWWHHDQGWKH'HYHORS7XOORZ $VVRFLDWLRQ/WGIRU7XOORZDQGFRPSOHWHGLQ $XJXVW7KLVLVDKXJHO\EHQHILFLDO GRFXPHQWDQGJLYHVJUHDWLQVLJKWLQWRWKH %LRGLYHUVLW\DQG+DELWDWVRIWKHWRZQ 10.5.1 European Directives, Natura 2000 Network and Biodiversity $WD(XURSHDQOHYHOWKH+DELWDWV'LUHFWLYH ((& DQGWKH%LUGV'LUHFWLYH (& PDQGDWHWKHLGHQWLILFDWLRQDQG SURWHFWLRQRI6SHFLDO$UHDVRI&RQVHUYDWLRQ 6$&V DQG6SHFLDO3URWHFWLRQ$UHDV 63$V ZKLFKWRJHWKHUFUHDWHDQHWZRUNRISURWHFWHG ZLOGOLIHDUHDVNQRZQDVWKH1DWXUD Fig 13 : Tullow Castle QHWZRUNDFURVVWKH(XURSHDQ8QLRQ7KH GHVLJQDWLRQRIWKHVHVLWHVIRUPVSDUWRID 5HFHQWUHVHDUFKKDVVKRZQWKDWFXOWXUDO UDQJHRIPHDVXUHVDLPHGDWFRQVHUYLQJ WRXULVPFRQVWLWXWHVRQHRIWKHFHQWUDOSODQNVRI LPSRUWDQWRUWKUHDWHQHGKDELWDWVDQGVSHFLHV WKH,ULVKWRXULVPLQGXVWU\DQGLWLVDOVRRQHRI 7KHUHLVDOHJDOUHTXLUHPHQWWKDWDOOODQGXVH WKHIDVWHVWJURZLQJDUHDVRIWRXULVP SODQVFRPSO\ZLWKWKH%LUGVDQG+DELWDWV LQWHUQDWLRQDOO\5HVHDUFKDOVRVKRZVWKDW 'LUHFWLYHVLQSDUWLFXODUWKURXJKWKHSUHSDUDWLRQ KLVWRULFWRZQVFRQVWLWXWHDVLJQLILFDQWSDUWRI RID+DELWDWV'LUHFWLYH$VVHVVPHQW7KH WKHDWWUDFWLRQIRUFXOWXUHDQGKHULWDJHVHHNHUV 6WUDWHJLF(QYLURQPHQWDO$VVHVVPHQW'LUHFWLYH 7KHXQLTXHFKDUDFWHULVWLFVRIWRZQVVXFKDV (& DOVRUHTXLUHVWKDWDOOODQGXVH 7XOORZDPDUNHWWRZQZLWKDQH[WHQVLYH SODQVOHJDOO\FRPSO\ZLWKWKH6WUDWHJLF ZHDOWKRIKLVWRU\WKHVWRULHVWKHKLVWRULF (QYLURQPHQWDO$VVHVVPHQW'LUHFWLYHLQFOXGLQJ Tullow Draft LAP 2016-2022 - 84 - WKHSUHSDUDWLRQRID6WUDWHJLF(QYLURQPHQWDO 7KUHVKROG'HYHORSPHQW*XLGHOLQHV $VVHVVPHQWZKHUHQHFHVVDU\)XUWKHUGHWDLOV 6WUDWHJLF(QYLURQPHQWDO$VVHVVPHQW*XLGHOLQHV DQGWKH$SSURSULDWH$VVHVVPHQW UHJDUGLQJWKH+DELWDWV'LUHFWLYH$VVHVVPHQW *XLGDQFH DQGWKH6WUDWHJLF(QYLURQPHQWDO$VVHVVPHQW &DWFKPHQWDQGZDWHUUHVRXUFHPDQDJHPHQW DUHDYDLODEOHDV$SSHQGLFHVWRWKLVGUDIWSODQ 3ODQVLQFOXGLQJWKHUHOHYDQW5LYHU%DVLQ 7XOORZKDVRQH6SHFLDO$UHDRI&RQVHUYDWLRQ 0DQDJHPHQW3ODQ %LRGLYHUVLW\3ODQVDQGJXLGHOLQHVLQFOXGLQJ 6$& WKDWWUDYHUVHVWKHGUDIWSODQDUHD $FWLRQVIRU%LRGLYHUVLW\ ,UHODQG¶VQG QDPHO\WKH5LYHU6ODQH\ 1DWLRQDO%LRGLYHUVLW\3ODQ LQFOXGLQJDQ\ VXSHUVHGLQJYHUVLRQRIVDPH 7KH:DWHU)UDPHZRUN'LUHFWLYH5HJLVWHURI )UHVKZDWHU3HDUO0XVVHO5HJXODWLRQV 6, RI LQFOXGLQJDQ\DVVRFLDWHGGHVLJQDWHG 3URWHFWHG$UHDVDVUHTXLUHGXQGHUWKH DUHDVRUPDQDJHPHQWSODQV 'LUHFWLYHDOVRFRQWDLQVDQLQYHQWRU\RI ,UHODQG¶V(QYLURQPHQW (3$ SURWHFWHGDUHDVLWHVUHSUHVHQWLQJDUHD LQFOXGLQJDQ\VXSHUVHGLQJYHUVLRQVRIVDPH FDWHJRULHVWRLQFOXGHDUHDVGHVLJQDWHGIRUWKH DQGWRPDNHSURYLVLRQZKHUHDSSURSULDWHWR DGGUHVVWKHUHSRUW¶VJRDOVDQGFKDOOHQJHV SURWHFWLRQRIKDELWDWDQGVSHFLHV HR 9: 7KDWDOOSURMHFWVDQGSODQVDULVLQJIURPWKLV It is a policy of Carlow County Council: SODQ1 LQFOXGLQJDQ\DVVRFLDWHG LPSURYHPHQWZRUNVRUDVVRFLDWHG HR 7:7RFRQWULEXWHDVDSSURSULDWHWRZDUGVWKH LQIUDVWUXFWXUH ZLOOEHVFUHHQHGIRUWKH SURWHFWLRQRIGHVLJQDWHGHFRORJLFDOVLWHV QHHGWRXQGHUWDNH$SSURSULDWH LQFOXGLQJFDQGLGDWH6SHFLDO$UHDVRI $VVHVVPHQWXQGHU$UWLFOHRIWKH+DELWDWV &RQVHUYDWLRQ F6$&V DQG6SHFLDO 'LUHFWLYH$SODQRUSURMHFWZLOORQO\EH 3URWHFWLRQ$UHDV 63$V :LOGOLIH6LWHV DXWKRULVHGDIWHUWKHFRPSHWHQWDXWKRULW\ LQFOXGLQJSURSRVHG1DWXUDO+HULWDJH$UHDV KDVDVFHUWDLQHGEDVHGRQVFLHQWLILF DQG)ORUD3URWHFWLRQ2UGHUVLWHV HYLGHQFH6FUHHQLQJIRU$SSURSULDWH $VVHVVPHQWDQGD6WDJH$SSURSULDWH HR 8: 7RFRQWULEXWHWRZDUGVFRPSOLDQFHZLWK $VVHVVPHQWZKHUHQHFHVVDU\WKDW UHOHYDQW(8(QYLURQPHQWDO'LUHFWLYHVDQG DSSOLFDEOH1DWLRQDO/HJLVODWLRQ3ROLFLHV (a)The Plan or project will not give rise to significant 3ODQVDQG*XLGHOLQHVLQFOXGLQJWKHIROORZLQJ adverse direct, indirect or secondary effects on the DQGDQ\XSGDWHGVXSHUVHGLQJGRFXPHQWV integrity of any European site (either individually or in combination with other plans or projects); or (8'LUHFWLYHVLQFOXGLQJWKH+DELWDWV'LUHFWLYH (b)The Plan or project will have significant adverse effects ((&DVDPHQGHG >@WKH%LUGV'LUHFWLYH on the integrity of any European site (that does not host a (& >@WKH(QYLURQPHQWDO/LDELOLW\ priority natural habitat type/and or a priority species) but 'LUHFWLYH (& >@WKH(QYLURQPHQWDO there are no alternative solutions and the plan or project ,PSDFW$VVHVVPHQW'LUHFWLYH ((&DV must nevertheless be carried out for imperative reasons of DPHQGHG WKH:DWHU)UDPHZRUN'LUHFWLYH overriding public interest, including those of a social or (& DQGWKH6WUDWHJLF(QYLURQPHQWDO economic nature. In this case, it will be a requirement to $VVHVVPHQW'LUHFWLYH (& follow procedures set out in legislation and agree and 1DWLRQDOOHJLVODWLRQLQFOXGLQJWKH:LOGOLIH$FW undertake all compensatory measures necessary to >@WKH(XURSHDQ&RPPXQLWLHV ensure the protection of the overall coherence of Natura (QYLURQPHQWDO,PSDFW$VVHVVPHQW 2000; or ©The Plan or project will have a significant 5HJXODWLRQV 6,1R RI DV adverse effect on the integrity of any European site (that DPHQGHG WKH:LOGOLIH $PHQGPHQW $FW hosts a natural habitat type and/or a priority species) but WKH(XURSHDQ8QLRQ :DWHU3ROLF\ 5HJXODWLRQV there are no alternative solutions and the plan or project DVDPHQGHG WKH3ODQQLQJDQG must nevertheless be carried out for imperative reasons 'HYHORSPHQW$FW DVDPHQGHG WKH for overriding public interest, restricted to reasons of (XURSHDQ&RPPXQLWLHV %LUGVDQG1DWXUDO human health or public safety, to beneficial consequences +DELWDWV 5HJXODWLRQV 6,1RRI of primary importance for the environment or, further to an DQGWKH(XURSHDQ&RPPXQLWLHV opinion from the Commission, to other imperative reasons (QYLURQPHQWDO/LDELOLW\ 5HJXODWLRQV of overriding public interest. In this case, it will be a >@ requirement to follow procedures set out in legislation and agree and undertake all compensatory measures 1DWLRQDOSROLF\JXLGHOLQHV LQFOXGLQJDQ\ necessary to ensure the protection of the overall FODULI\LQJ&LUFXODUVRUVXSHUVHGLQJYHUVLRQVRI coherence of Natura 2000. VDPH LQFOXGLQJWKH/DQGVFDSHDQG/DQGVFDSH $VVHVVPHQW'UDIW*XLGHOLQHVWKH (QYLURQPHQWDO,PSDFW$VVHVVPHQW6XE [1] Including Annex I habitats, Annex II species and their habitats 1 Such projects include but are not limited to those relating to: and Annex IV species and their breeding sites and resting places agriculture; amenity and recreation; contaminated sites; (wherever they occur). electricity transmission; flood alleviation and prevention; [2] Including Annex I species and other regularly occurring forestry; mineral extraction; renewable energy projects; roads; migratory species, and their habitats (wherever they occur). telecommunications; tourism; wastewater and discharges; and [3] Including protected species and natural habitats. water supply and abstraction. [4] Including species of flora and fauna and their key habitats. [5] Including protected species and natural habitats. Tullow Draft LAP 2016-2022 - 85 - HR 10: D 1RWWRSHUPLWSURMHFWVJLYLQJULVHWR LQVWUXPHQWVWKRVHOLVWHGLQ$QQH[,9RIWKH VLJQLILFDQWFXPXODWLYHGLUHFWLQGLUHFWRU +DELWDWV'LUHFWLYHDQGWKRVHOLVWHGLQ$QQH[, VHFRQGDU\LPSDFWVRQ1DWXUDVLWHV RIWKH%LUGV'LUHFWLYH DULVLQJIURPWKHLUVL]HRUVFDOHODQGWDNH SUR[LPLW\UHVRXUFHUHTXLUHPHQWV It is a policy of Carlow County Council: HPLVVLRQV GLVSRVDOWRODQGZDWHURUDLU WUDQVSRUWDWLRQUHTXLUHPHQWVGXUDWLRQRI FRQVWUXFWLRQRSHUDWLRQGHFRPPLVVLRQLQJ HR 13: 7RHQVXUHWKDWGHYHORSPHQWGRHVQRWKDYH RUIURPDQ\RWKHURQWKHEDVLVRIWKLVSODQ DVLJQLILFDQWDGYHUVHLPSDFWRQSODQW HLWKHULQGLYLGXDOO\RULQFRPELQDWLRQZLWK VSHFLHVDQLPDOVDQGELUGVOLVWHGLQWKH RWKHUSODQVRUSURMHFWV>@ )ORUD3URWHFWLRQ2UGHU:LOGOLIH$FW DVDPHQGHGWKRVHOLVWHGLQ$QQH[,9RI WKH+DELWDWV'LUHFWLYHDQGWKRVHOLVWHGLQ E 7RUHTXLUHDSSOLFDWLRQVIRUGHYHORSPHQW $QQH[,RIWKH%LUGV'LUHFWLYH ZLWKLQWKHFRQVWUDLQHGODQGXVH]RQLQJ REMHFWLYHIRUWKH1DWXUDVLWH 0DS WRXQGHUJR$SSURSULDWH$VVHVVPHQWDQG 10.5.3 Green Infrastructure GHPRQVWUDWHWKDWWKHSURSRVDOZLOOQRWJLYH ULVHWRDQ\HIIHFWRQWKH1DWXUDVLWHLQ *UHHQLQIUDVWUXFWXUHFDQEHGHILQHGDV YLHZRILWVTXDOLILFDWLRQIHDWXUHVDQG QHWZRUNVRIJUHHQDUHDVWKDWSURYLGHPXOWLSOH FRQVHUYDWLRQREMHFWLYHV HQYLURQPHQWDOVRFLDOHGXFDWLRQDODQG HFRQRPLFEHQHILWVWRVRFLHW\DQGFDQLQFOXGH HR 11: 7RIDFLOLWDWHWKHFRQVHUYDWLRQSURWHFWLRQ RSHQVSDFHVZRRGODQGVSDUNVIDUPODQGDQG DQGHQKDQFHPHQWRIWKH5LYHU6ODQH\ SULYDWHJDUGHQV7KHHQYLURQPHQWDOEHQHILWVRI LQFOXGLQJWKHDGMDFHQWZHWODQGVDQG DVVRFLDWHGKDELWDWVDQGWRHQVXUHWKDW LGHQWLI\LQJDJUHHQLQIUDVWUXFWXUHQHWZRUN GHYHORSPHQWGRHVQRWVLJQLILFDQWO\ FDQQRWEHXQGHUHVWLPDWHGDVWKHSURWHFWLRQRI DGYHUVHO\DIIHFWFRQVHUYDWLRQYDOXHV QDWXUDOIHDWXUHVOLNHIORRGSODLQVZHWODQGV ZRRGODQGVDQGKHGJHURZVSURYLGHIDU HR 12: 7RVHHNWKHVXEPLVVLRQRIDQ(FRORJLFDO UHDFKLQJEHQHILWVHJLQFOLPDWHFKDQJH ,PSDFW$VVHVVPHQWIRUDOOGHYHORSPHQW DGDSWDWLRQ'HYHORSLQJDJUHHQLQIUDVWUXFWXUH ZKLFKPD\KDYHDVLJQLILFDQWLPSDFWRQWKH DSSURDFKFDQDVVLVWZLWKWKHORVVRI ULYHUDQGULSDULDQKDELWDWV7KLV ELRGLYHUVLW\ZKLOHHQKDQFLQJDQHQYLURQPHQWLQ DVVHVVPHQWVKRXOGZKHUHDSSURSULDWH ZKLFKZHOLYHDQGWKHUHE\FUHDWLQJDKLJK VXJJHVWDPLQLPXPEXIIHURIXQGLVWXUEHG TXDOLW\HQYLURQPHQW&RPKDU6XVWDLQDEOH YHJHWDWLRQWREHUHWDLQHGWRPLWLJDWH DJDLQVWSROOXWLRQULVNVUHGXFHIORRGLQJ 'HYHORSPHQW&RXQFLOSXEOLFDWLRQ SRWHQWLDOPDLQWDLQKDELWDWVDQGSURYLGHDQ µ&UHDWLQJ*UHHQ,QIUDVWUXFWXUHIRU,UHODQG HFRORJLFDOFRUULGRU7KHEXIIHU]RQHVKDOO (QKDQFLQJ1DWXUDO&DSLWDOIRU+XPDQ ZKHUHSRVVLEOHEHPDLQWDLQHGIUHHRI :HOOEHLQJ¶VHWVRXWKRZDQHWZRUNRIJUHHQ GHYHORSPHQWDQGKDUGVXUIDFHV7KH VSDFHVFDQEHGHYHORSHGWREHQHILWQDWXUDO DVVHVVPHQWVKDOODGGUHVVSURWHFWHG KHULWDJHDQGELRGLYHUVLW\DVZHOODVWKHJUHDWHU VSHFLHVLHEDWVRWWHUVLQFOXGLQJWKH HFRQRP\DQGVRFLHW\7KHSURYLVLRQRIJUHHQ UHTXLUHPHQWIRUGHURJDWLRQOLFHQFHV LQIUDVWUXFWXUHLVDQHVVHQWLDOHOHPHQWLQ WRJHWKHUZLWKWKHFXPXODWLYHLPSDFWRIWKH GHOLYHULQJDKLJKTXDOLW\RIOLIHIRUERWKH[LVWLQJ SURSRVHGGHYHORSPHQW DQGQHZFRPPXQLWLHV,WFDQFUHDWHD GLVWLQFWLYHORFDOEXLOWHQYLURQPHQW µVHQVHRI SODFH¶ DQGLPSURYHWKHH[LVWLQJEXLOW HQYLURQPHQW 10.5.2 European and National Designated Protected Species ,QGHYHORSLQJJUHHQLQIUDVWUXFWXUHVWUDWHJLHV WKHUHLVDQRSSRUWXQLW\WRFUHDWHSODFHVWKDW &HUWDLQSODQWDQLPDODQGELUGVSHFLHVDUHDOVR QRWRQO\IXQFWLRQVXVWDLQDEO\EXWDOVRDUHYHU\ SURWHFWHGE\ODZ7KLVSURWHFWLRQDSSOLHV DWWUDFWLYHSODFHVWROLYHDQGZRUNDQGIRVWHUD ZKHUHYHUWKHSODQWDQLPDORUELUGVSHFLHVDUH VWURQJVHQVHRIFRPPXQLW\,QWKLVUHJDUGWKH IRXQGDQGLVQRWFRQILQHGWRVLWHVGHVLJQDWHG GUDIWSODQZLOOIRFXVRQSURWHFWLQJHQKDQFLQJ E\ODZDQGWKHLUKDELWDWV7KLVLQFOXGHVSODQW FUHDWLQJDQGFRQQHFWLQJJUHHQLQIUDVWUXFWXUH VSHFLHVOLVWHGLQWKH)ORUD3URWHFWLRQ2UGHU UHVRXUFHVDQGHQVXULQJWKDWGHYHORSPHQWLV DQGDQLPDOVDQGELUGVOLVWHGLQWKH SODQQHGDQGPDQDJHGVRWKDWLWGRHVQRW :LOGOLIH$FW DQGVXEVHTXHQWVWDWXWRU\ UHVXOWLQXQGXHGDPDJHWRWKHVXUURXQGLQJ >@([FHSWDVSURYLGHGIRULQ6HFWLRQ RIWKH+DELWDWV E LPSHUDWLYHUHDVRQVRIRYHUULGLQJSXEOLFLQWHUHVWIRUWKH 'LUHFWLYHYL]7KHUHPXVWEH SURMHFWWRSURFHHG DQG D QRDOWHUQDWLYHVROXWLRQDYDLODEOH F $GHTXDWHFRPSHQVDWRU\PHDVXUHVLQSODFH Tullow Draft LAP 2016-2022 - 86 - HQYLURQPHQWDQGQDWXUDODVVHWV:LOGOLIHDQG &RQVLGHUFUHDWLQJD:LOGOLIH6DQFWXDU\RQ QDWXUDOHFRORJLFDOSURFHVVHVDUHPRUHOLNHO\WR RQHRIWKHPDQPDGHLVODQGVLQWKH5LYHU EHPDLQWDLQHGLQODQGVFDSHVWKDWFRPSULVHDQ 6ODQH\SRVVLEO\QHDUWKHWRZQSDUN LQWHUFRQQHFWHGV\VWHPRIKDELWDWV It is the policy of Carlow County Council: HR 14: 7RHQFRXUDJHDQGIDFLOLWDWHLQFRQVXOWDWLRQ ZLWKUHOHYDQWVWDNHKROGHUVWKH GHYHORSPHQWRIJUHHQLQIUDVWUXFWXUHWKDW UHFRJQLVHVWKHV\QHUJLHVWKDWFDQEH DFKLHYHGZLWKUHJDUGWRWKHIROORZLQJ 3URYLVLRQRIRSHQVSDFHDPHQLWLHV 6XVWDLQDEOHPDQDJHPHQWRIZDWHU 3URWHFWLRQDQGPDQDJHPHQWRIELRGLYHUVLW\ 3URWHFWLRQRIFXOWXUDOKHULWDJH 3URWHFWLRQRISURWHFWHGODQGVFDSHVHQVLWLYLWLHV HR 15 7RVHHNWRFRQWULEXWHWRZDUGVWKH SURWHFWLRQDQGHQKDQFHPHQWRIELRGLYHUVLW\ DQGHFRORJLFDOFRQQHFWLYLW\LQFOXGLQJ *UHHQ,QIUDVWUXFWXUH *, VKRXOGDVIDUDV WUHHVKHGJHURZVULYHUVVWUHDPVRWKHU SRVVLEOHSURYLGHDQLQWHJUDWHGLQIUDVWUXFWXUH ODQGVFDSHIHDWXUHVDQGDVVRFLDWHGZLOGOLIH ZKHUHWKHVHIRUPSDUWRIWKHHFRORJLFDO IRUPXOWLIXQFWLRQDOXVHVLHZLOGOLIHOHLVXUH QHWZRUNDQGRUPD\EHFRQVLGHUHGDV DQGFXOWXUDOH[SHULHQFHDQGGHOLYHU HFRORJLFDOFRUULGRUVRUVWHSSLQJVWRQHVLQ HQYLURQPHQWDOVHUYLFHVVXFKDVVXVWDLQDEOH WKHFRQWH[WRI$UWLFOHRIWKH+DELWDWV ZDWHUGUDLQDJHDQGIORRGSURWHFWLRQWKDW 'LUHFWLYH RSHUDWHVDWDOOVSDWLDOVFDOHVIURPWKHXUEDQ QHLJKERXUKRRGWRWKHRSHQFRXQWU\VLGH,Q HR 16: 7RH[SORUHWKHIHDVLELOLW\VXEMHFWWRWKH XUEDQDUHDVVXFKDV7XOORZJUHHQ UHTXLUHPHQWVRIWKH+DELWDWV'LUHFWLYHRI LQIUDVWUXFWXUHLVDERXWSXWWLQJWKHHQYLURQPHQW GHYHORSLQJDOLQHDUSDUNDORQJWKHULYHU DWWKHFHQWUHRIWKHSODQQLQJSURFHVVDQG 6ODQH\OLQNLQJWRDUHDVRIRSHQVSDFHDQG SURGXFLQJDQHWZRUNRIVSDFHVZKLFKEHQHILW DPHQLW\:KHUHODQGVDUHLQSULYDWH RZQHUVKLSLWVKDOOEHSROLF\LQDQ\ ERWKSHRSOHDQGZLOGOLIH7KHVSDWLDOFRQFHSWV GHYHORSPHQWSURSRVDOWRVHFXUHSXEOLF DURXQGZKLFKWKHJUHHQLQIUDVWUXFWXUHDQG DFFHVVDORQJWKHZDWHUZD\ ODQGVFDSHVWUDWHJ\DUHDVIROORZV HP 17: 7RFRRUGLQDWHEHWZHHQRSHQVSDFH 7KHRSHQVSDFHQHWZRUNZLWKLQWKHSODQ ELRGLYHUVLW\DQGIORRGPDQDJHPHQWLQ ODQGVLVGHVLJQHGLQDVHULHVRILQWHUFRQQHFWHG SURJUHVVLQJDJUHHQLQIUDVWUXFWXUHQHWZRUN ]RQHVWRPDQDJHWKHQDWXUDOFKDUDFWHUDQG UHVRXUFHVRIWKHDUHDDQGWRSURYLGHIRUWKH 10.5.4 Trees, Hedgerows, Woodlands QHHGVRIELRGLYHUVLW\DQGWKHQHZFRPPXQLW\ and Non-Designated Habitats and Species $OLQHDUSDUNDORQJWKH5LYHU6ODQH\WR SURYLGHSDVVLYHDQGDFWLYHZDONVDQGF\FOH 7UHHVDQGKHGJHURZVFRQVWLWXWHDQLPSRUWDQW URXWHVDORQJWKLVPDQPDGHKDELWDW QDWXUDODQGKLVWRULFUHVRXUFHJLYHQWKHLU FRQWULEXWLRQWRODQGVFDSHTXDOLW\WKHLU 3RFNHWSDUNVLQDOOQHZUHVLGHQWLDODQGPL[HG HFRORJLFDOLPSRUWDQFHDVZLOGOLIHKDELWDWVDQG XVHGHYHORSPHQWVWRHQVXUHDOOGZHOOLQJVDUH KLVWRULFDOVLJQLILFDQFHDVWRZQODQGDQGILHOG ZLWKLQDVKRUW P ZDONRIXVDEOHRSHQ ERXQGDULHV,QXUEDQVHWWLQJVWUHHVDQGJURXSV VSDFH RIWUHHVFDQFRQWULEXWHVLJQLILFDQWO\WRWKHORFDO ODQGVFDSHWRZQVFDSHDQGLQWKHVXFFHVVIXO $ZHOOLQWHJUDWHGQHWZRUNRIJUHHQURXWHVWKDW LQWHJUDWLRQRIQHZEXLOGLQJVLQWRWKHODQGVFDSH SURPRWHVZDONLQJDQGF\FOLQJIRUHYHU\GD\ QHHGVDQGUHFUHDWLRQ7KHVHZLOOLQFOXGH It is the policy of Carlow County Council: ZKHUHDSSURSULDWHURXWHVDORQJWKH5LYHU HR 18:7RSURPRWHWKHSURWHFWLRQRIWUHHVLQ $FLYLFSXEOLFVSDFHZLWKLQWKHWRZQFHQWUH SDUWLFXODUQDWLYHDQGEURDGOHDIVSHFLHV ZKLFKDUHRIFRQVHUYDWLRQDQGRUDPHQLW\ YDOXH'HYHORSPHQWWKDWUHTXLUHVWKH IHOOLQJRIPDWXUHWUHHVRIVSHFLDOLQWHUHVW ZLOOEHGLVFRXUDJHG Tullow Draft LAP 2016-2022 - 87 - HP 19: 7RSURPRWHWKHSURWHFWLRQDQG DVSDUWRIDQ\SXEOLFODQGVFDSLQJSURMHFWV SUHVHUYDWLRQRIH[LVWLQJKHGJHURZVZKHUH RUSODQWLQJDVVRFLDWHGZLWKGHYHORSPHQWV DSSURSULDWHDQGHQFRXUDJHSODQWLQJRI QDWLYHKHGJHURZVSHFLHV HO 4: 7RSURPRWHHGXFDWLRQDODQGOHLVXUH DFWLYLWLHVVXFKDVELUGZDWFKLQJJXLGHG HP 20: 7RFRQWULEXWHWRZDUGVWKHSURWHFWLRQRI ZLOGOLIHZDONVSKRWRJUDSK\DUWHWFZKLFK QRQGHVLJQDWHGKDELWDWVDQGVSHFLHV LQFUHDVHDZDUHQHVVDQGDSSUHFLDWLRQRI ZKLFKDUHRIORFDOELRGLYHUVLW\VLJQLILFDQFH WKH6ODQH\5LYHU9DOOH\EXWZKLFKZLOOQRW UHVXOWLQVLJQLILFDQWGLVWXUEDQFHWRZLOGIRZO DQGZDGHUVDQGZLOOQRWKDYHDQHJDWLYH LPSDFWRQZDWHUTXDOLW\RURQWKHFRQGLWLRQ 10.5.5 Invasive and Non-Native Species RIWKHSURWHFWHGKDELWDWVDQGVSHFLHV 1RQQDWLYHVSHFLHVERWKDQLPDODQGSODQWVFDQ HO 5: 7RGHYHORSDQHWZRUNRIJUHHQFRUULGRUV UHSUHVHQWDPDMRUWKUHDWWRORFDOUHJLRQDODQG WKURXJKRXWWKHWRZQLQWHUFRQQHFWLQJRSHQ VSDFHDQGH[WHQGLQJRXWWRWKHZLGHU JOREDOELRGLYHUVLW\7HUUHVWULDODQGDTXDWLF KLQWHUODQG KDELWDWVFDQEHQHJDWLYHO\DIIHFWHGUHVXOWLQJLQ VLJQLILFDQWGDPDJHWRFRQVHUYDWLRQDQG HO 6: 7RDVVHVVWKHSRVVLELOLW\RIORRSHG HFRQRPLFLQWHUHVWVVXFKDVDJULFXOWXUH SHGHVWULDQDQGF\FOHURXWHVDORQJWKH IRUHVWU\DQGFLYLOLQIUDVWUXFWXUH7KH7KLUG ULYHUWKHWRZQFHQWUHDQGVLWHVIDFLOLWLHV 6FKHGXOHRIWKH(XURSHDQ&RPPXQLWLHV %LUGV RILQWHUHVWLQWKHWRZQDQGLWVHQYLURQV DQG1DWXUDO+DELWDWV 5HJXODWLRQVOLVWV UHVWULFWHGQRQQDWLYHVSHFLHVDQG5HJXODWLRQ 1R DQG1RVSHFLILFDOO\UHODWHWRQRQ QDWLYHVSHFLHV'HYHORSPHQWSURSRVDOVPXVW HQVXUHWKDWWKHSUHVHQFHRUDEVHQFHRI LQYDVLYHDOLHQVSHFLHVKDVEHHQDGGUHVVHGLQ DFFRUGDQFHZLWKWKHQHZ(XURSHDQ 5HJXODWLRQVIRUWKHSUHYHQWLRQDQG PDQDJHPHQWRIWKHLQWURGXFWLRQDQGVSUHDGRI ,QYDVLYH$OLHQ6SHFLHV VW-DQ DQGWKH (& %LUGVDQG+DELWDWV 5HJXODWLRQV :KHUHLQYDVLYHDOLHQVSHFLHVDUHSUHVHQWRQD GHYHORSPHQWVLWHDQLQYDVLYHDOLHQVSHFLHV PDQDJHPHQWSODQZLOOEHUHTXLUHG It is a policy of Carlow County Council: HR 21: 7RVXSSRUWDVDSSURSULDWHWKH1DWLRQDO 3DUNVDQG:LOGOLIH6HUYLFH¶VHIIRUWVWRVHHN WRFRQWUROWKHVSUHDGRIQRQQDWLYHVSHFLHV RQODQGDQGZDWHUDQGZKHUHDSSURSULDWH VHHNWKHVXEPLVVLRQRIDQLQYDVLYH VSHFLHVPDQDJHPHQWSODQ 10.6 Built and Natural Heritage Objectives It is an objective of Carlow County Council: HO 1:7RVDIHJXDUGDQGHQKDQFHDOOEXLOGLQJVRI LQWULQVLFKHULWDJHYDOXHZLWKLQ7XOORZDQG LWVHQYLURQVDQGWRSURWHFWDOOH[LVWLQJ 3URWHFWHG6WUXFWXUHVDVVHWRXWLQWKH 5HFRUGRI3URWHFWHG6WUXFWXUHV HO 2:7RHQFRXUDJHWKHIDFLOLWDWLRQDQGDFWLYHDQG DSSURSULDWHUHXVHRIYDFDQWVWUXFWXUHV ZLWKLQWKHGUDIWSODQDUHD HO 3: 7RSURPRWHWKHSODQWLQJRIWUHHVSHFLHV ZKLFKDUHVXLWHGWRWKH6ODQH\ODQGVFDSH Tullow Draft LAP 2016-2022 - 88 - Table 11 : Record of Protected Structures in Tullow RPS NO. NIAH Address Town Land Composition Rating Importance &: *DWH/RGJH 7XOORZEHJ 7KHJDWHORGJHWR6W$XVWLQ¶V$EEH\GDWHVIURPFLUFDDQGZDVGHVLJQHGE\ 5 $$UW 6W$XVWLQV$EEH\ 'HDQHDQG 7XOORZ :RRGZDUG,WLVEXLOWRIODUJHVTXDUHGEORFNVRIJUDQLWHSODFHGDWUDQGRP,WKDV DVLQJOHVWRUH\RIWKUHHED\VZLWKDQHQFORVHGSRUFKDQGDQH[FHSWLRQDOO\KLJK SLWFKHGURRIRIQDWXUDOVODWHZLWKJUDQLWHEUDFNHWVXQGHUWKHHDYHVJUDQLWH GRUPHUZLQGRZVZLWKKLJKSLWFKHGURRIVDQGH[FHSWLRQDOO\WDOOJUDQLWHVWDFNV 7KHJURXQGIORRUZLQGRZVKDYHVLQJOHJUDQLWHPXOOLRQVX39&ZLQGRZVKDYH EHHQLQVHUWHGUHFHQWO\7KHEXLOGLQJLVLQD)UHQFKJRWKLFUHYLYDOVW\OHYHU\VLPLODU WR6W$QQ¶V6FKRROVLQ0ROHVZRUWK6WUHHW'XEOLQZKLFKZHUHGHPROLVKHGLQWKH V &: 7KH&RWWDJH 7XOORZSKHOLP $GHWDFKHGVLQJOHVWRUH\KRXVHZLWKDQ/SODQDWWKHIURQWDQGZLQJVIODQNLQJ 5 $ 'XEOLQ5RDG WKHFHQWUHRIWKHKRXVHDWWKHUHUHPDNLQJLWD8SODQDWWKHUHUH,WKDV 7XOORZ ZKLWHZDVKHGZDOOVDQGZLGHZLQGRZVDQGDVODWHGVSURFNHWHGURRIZLWKZLGH HDYHVZKLFKDUHVXSSRUWHGRQVOHQGHUSLHUV7KHZLQJVDWWKHUHDUDUHRIWZR VWRUH\V7KHKRXVHDSSHDUVWRGDWHIURPFLUFDDQGUHQRYDWHGLQWKHPLG WKFHQWXU\DVWKHFROXPQVZHUHUHSODFHGDQGDQLURQIUDPHZRUNDWWDFKHGWRWKH ZDOOVWRDOORZFUHHSLQJSODQWVWRJURZDJDLQVWWKHZDOOV7KHSURILOHRIWKHKRXVH DQGWKHJHQHUDOUXVWLFFKDUDFWHUPDNHLWLPSRUWDQW &: 6ODQH\5LYHU%ULGJH 7XOORZSKHOLP )RXUDUFKURDGEULGJHRYHUULYHUFZLWKWULDQJXODUFXWZDWHUV 5 $7F$UW 7XOORZ 7XOORZEHJ &: 7KH&RDFKKRXVH 7XOORZSKHOLP $YHU\ILQHDUFKLWHFWGHVLJQHGVWDEOHEORFNRIFLUFDIDFLQJWKH5DWKYLOO\ 5 $ 'XEOLQ5RDG 7XOORZURDG,WKDVD8SODQDQGLVEXLOWRIFRXUVHGUXEEOHJUDQLWHZLWKJDEOHG 7XOORZ ZLQJVZKLFKKDYHEODQNVHJPHQWDOKHDGHGFDUULDJHDUFKHVZLWKEULFNGUHVVLQJV WRWKHKHDGVRIWKHDUFKHV2YHUWKHDUFKHVDUHVPDOOEULFNGUHVVHGZLQGRZV ZKLOHWKHJDEOHVKDYHILQHO\GUHVVHGJUDQLWHFRSLQJ7KHURRIRIWKHVWDEOHVLV QRZLQYHU\SRRUUHSDLU Tullow Draft LAP 2016-2022 - 89 - &: :DWHU%DOOLI¶V+XW 7XOORZSKHOLP $VTXDUHSODQZDWFKKXWRIFRXUVHGUXEEOHJUDQLWHZLWKRSHQZLQGRZVDQGGRRU 5 $85 7XOORZ DQGVWHSVWRWKHURRI7KHKXWGDWHVIURPFLUFDDQGLVDQXQXVXDOVWUXFWXUH &: 7XOORZ0HWKRGLVW 7XOORZSKHOLP $VLPSOHWKUHHED\JDEOHHQGHGVLQJOHFHOOFRQYHQWLFOHURIFLUFDEXLOWRI 5 $6 &KXUFK0XVXHP FRXUVHGUXEEOHJUDQLWHZLWKDKLJKEDVHPHQW7KHSRLQWHGGRRUFDVHKDVDJUDQLWH %ULGJH6WUHHW DUFKLWUDYHDQGLVDSSURDFKHGXSDWDOOIOLJKWRIVWHSVZKLFKGLYLGHDWWKHERWWRP 7XOORZ 7KHVLGHZLQGRZVDOOKDYHEULFNGUHVVLQJVDUHSRLQWHGIRUWKHKDOODQGVTXDUH KHDGHGLQWKHEDVHPHQW7KHURRIKDVZLGHHDYHVDQGLVFRYHUHGZLWKQDWXUDO VODWHV &: *DWH/RGJH 0RXQW:ROVHOH\RU 7KHJDWHORGJHLVRIWKUHHED\VDQGDVLQJOHVWRUH\ZLWKDSHGLPHQWHGSRUFKZLWK 5 $$UW 0RXQW:ROVHOH\ &URVVORZ DWDOODUFKDQGVHJPHQWDOKHDGHGZLQGRZVZLWKSODLQDUFKLWUDYHV7KHURRILV 7XOORZ KLSSHGZLWKQDWXUDOVODWHV7KHHQWUDQFHJDWHVDQGSLHUVDUHRIFDVWLURQZLWK KHUDOGLFRUQDPHQW7KHORGJHDQGJDWHVGDWHIURPFLUFD &: 0RXQW:ROVHOH\ 0RXQW:ROVHOH\RU $WKUHHED\WZRVWRUH\,WDOLDQDWHKRXVHGHVLJQHGE\WKHILUPRI6LU-RKQ/DQ\RQ 5 $$UW 7XOORZ &URVVORZ DERXW,WKDVSDLQWHGOLQHGDQGUHQGHUHGZDOOVDEDVHPHQWUDLVHGFRLJQV VWULQJFRXUVHVDQHQFORVHGSRUFKZLWKDVHJPHQWDOKHDGHGGRRUFDVHDQGVLGH OLJKWVZLQGRZVZLWKDUFKLWUDYHVZLGHEUDFNHWHGHDYHVDQGDKLSSHGURRIZLWKD SDLURIVWDFNV7KHVDVKZLQGRZVKDYHODUJHSDQHVRIJODVV2QWKHOHIWKDQGVLGH LVDVHUYLFHZLQJ7KHKRXVHLVZHOOPDLQWDLQHGDQGLQXVHDVDKRWHO &: 6W$XVWLQV$EEH\ 7XOORZEHJ 7KHKRXVHZDVGHVLJQHGE\WKHSDUWQHUVKLSRI'HDQHDQG:RRGZDUGFLUFD 1 $6 7XOORZ DQGEXUQWLQ ,WLV9HQHWLDQJRWKLFLQVW\OHDQGEXLOWRIVTXDUHGEORFNVRI UDQGRPO\VHWJUDQLWHDVKODU,WLVLQFUHDVLQJO\EHLQJFRYHUHGZLWKLY\ZKLFKLV REVFXULQJWKHILQHO\FDUYHGJUDQLWHGHWDLOVLQFOXGLQJDEDOFRQ\SRLQWHGZLQGRZV DQGWKHUHPDLQVRIDJUDQLWHVWDLUFDVH7KRXJKDUXLQWKLVLVDYHU\LPSRUWDQW DUFKLWHFWXUDOVLWH &: 7KH%ULGJH+RXVH 7XOORZEHJ $WKUHHED\WZRVWRUH\KRXVHRIFLUFDZLWKDKDOIKLSSHGURRISDLQWHGDQG 5 $ 7XOORZ UHQGHUHGZDOOVZLWKUDLVHGFRLJQVDQGDURXQGKHDGHGGRRUFDVHZKLFKKDVD VLPSOHDUFKLWUDYHDQGDVFUROONH\VWRQH7KHURRIKDVQDWXUDOVODWHVDQGZLGH HDYHVEXWERWKFKLPQH\VWDFNVKDYHEHHQUHPRYHG7KHZLQGRZVKDYHPLG WK FHQWXU\DUFKLWUDYHVDQGKDYHKDGX39&JOD]LQJLQVHUWHG$PRGHUQSXEIURQWKDV EHHQLQVHUWHGRQWKHJURXQGIORRU7KHQDPH%ULGJH+RXVHKDVEHHQWKHUHIRU PDQ\\HDUVWKHW\SHRIOHWWHULQJXVHGDQGVL]HRIOHWWHULQJDGGWRWKHFKDUDFWHURI WKHEXLOGLQJ7KHSODFLQJRIWKHKRXVHLVLPSRUWDQWDVLWIDFHVXSWKH &DVWOHGHUPRWURDG Tullow Draft LAP 2016-2022 - 90 - &: )RUPHU6WDEOH%ORFN 7XOORZEHJ 7KHVWDEOHVDUHDWWKHUHDURIWKHPDLQKRXVHDQGIRUPDQ/SODQ7KH\DUHEXLOW 5 $6 6W$XVWLQ¶V$EEH\ RIDPL[WXUHRI\HOORZEULFN VXFKDV'ROSKLQ¶V%DUQEULFN ZLWKJUDQLWHEDQGLQJ 7XOORZ 7KHUHDUHFDQWHGFDUULDJHDUFKHVDQGZLQGRZVRIYDU\LQJVL]HV$WWKHEDFN WKHUHLVDYHU\VRSKLVWLFDWHGSOD\RIGLIIHUHQWZDOOVXUIDFHV EULFNUXEEOHVWRQH DQGDVKODU ZLWKWLQ\WUHIRLOZLQGRZVLQWKHZLQJZKLFKRQFHKRXVHVWKHKRUVHV 7KHVODWHGURRIKDVWZRWDOOEULFNVWDFNVZLWKJUDQLWHFDSV &: 6KHG 7XOORZEHJ $VPDOOGHUHOLFWEXLOGLQJDWWKHEDFNRIWKHKRXVHZKLFKLVEXLOWRIUDQGRPEORFNV 5 $ 6W$XVWLQ¶V$EEH\ RIJUDQLWHDVKODU,WLVUHFWDQJXODULQSODQZLWKWZRZLGHVTXDUHKHDGHGRSHQLQJV 7XOORZ RSSRVLWHHDFKRWKHU7KHKLJKSLWFKHGVODWHGURRILVS\UDPLGDOLQVKDSHDQG VXSSRUWHGRQJUDQLWHEUDFNHWV &: 1R 0DUNHW6TXDUH 7XOORZSKHOLP $ILYHED\WZRVWRUH\JDEOHHQGHGKRXVHRIFLUFDQRZGLYLGHGLQWRWZR 5 $ 7XOORZ SDUWV,WKDVDSLWFKHGVODWHGURRIZLWKHQGVWDFNVDQGUHQGHUHGZDOOV$WWKH JDEOHHQGWKHUHLVDURXQGKHDGHGGRRUFDVHZLWKSDQHOOHGGUHVVLQJVDQGD NH\VWRQH7KHIDoDGHKDVDODWH WKFHQWXU\FRUQLFHDQGWKHVKRSIURQWVDUH UHFHQW &: % '6ROLFLWRUV 7XOORZSKHOLP $QHDUO\ WKFHQWXU\WKUHHED\WZRVWRUH\KRXVHZLWKDSLWFKHGURRIURXJKFDVW 5 $ %DUUDFNV6WUHHW ZDOOVDQGVDVKZLQGRZVZLWKDURXQGKHDGHGLQVHW'RULFGRRUFDVHZLWKOHDGHG 7XOORZ IDQOLJKWRIXQXVXDOVHLJQLQWHQGHGWRFRQWDLQDODQWHUQ7KHFROXPQVDUHXQXVXDO KDYLQJPRXOGHGEDVHVZKLFKDUHFODVVLFDOO\LQFRUUHFW7KHUHDUHEDUVRQWKH JURXQGIORRUZLQGRZV &: 6H[WRQV+RXVH 7XOORZSKHOLP 7KLVLVDIUDJPHQWRIDVLQJOHVWRUH\HDUO\ WKFHQWXU\FRWWDJH7KHIUDJPHQW / $ 7KH&RXUVH ZKLFKLVOLWWOHPRUHWKDQDFRUQHURIDZDOOLVEXLOWRIFRXUVHGUXEEOHJUDQLWHZLWK 7XOORZ WKHUHPDLQVRIDVLQJOHZLQGRZZKLFKKDVDGULSODEHODQGDVLOODQGKDVEHHQ ILOOHGLQZLWKFRXUVHGUXEEOHJUDQLWH &: &KXUFKRIWKH0RVW+RO\ 7XOORZSKHOLP 7KHFKXUFKKDVEHHQPXFKDOWHUHGEXWDSSHDUVRULJLQDOO\WRKDYHKDGDVL[ED\ 5 $6,QW 5RVDU\ VLQJOHFHOOQDYH7KLVZDVZLGHQHGLQWKHODWH WKFHQWXU\XVLQJWKHVDPHW\SHRI 7XOORZ SRLQWHGZLQGRZVDQGZLWKDQDUFDGHLQVHUWHGEHWZHHQWKHRULJLQDOQDYHDQGWKH DLVOHV7KHWRZHUZDVDGGHGDERXW7KHLQWHULRUZDVWKRURXJKO\UHQRYDWHG DERXW ZKHQGRUPHUZLQGRZVZHUHLQVHUWHG7KHWRZHUDQGVSLUHDUHRI JUDQLWHDVKODULQDJRWKLFUHYLYDOVW\OH &: 7KH*ULOO 7XOORZSKHOLP $IRXUED\WZRVWRUH\KRXVHRIFLUFDZLWKDYHU\ILQHVHJPHQWDOKHDGHG 5 $ 0LOO6W JUDQLWHFDUULDJHDUFKDWWKHVRXWKHQG7KHEXLOGLQJKDVEHHQPXFKDOWHUHGLQ 7XOORZ UHFHQW\HDUVZLWKIDQF\SODVWHUVXUIDFHVZLQGRZVZLGHQHGDQGPRGHUQ VKRSIURQWDGGHG Tullow Draft LAP 2016-2022 - 91 - &: )%',QVXUDQFH 7XOORZSKHOLP $ILYHED\WKUHHVWRUH\JDEOHHQGHGKRXVHGDWLQJIURPWKHPLGWRODWHWK 5 $85 0LOO6WUHHW FHQWXU\,WKDVDKLJKSLWFKHGURRIZLWKQDWXUDOVODWHVDQGSDLQWHGDQGUHQGHUHG 7XOORZ ZDOOVZKLFKKDYHDVOLJKWEDWWHU7KHUK\WKPRIWKHIHQHVWUDWLRQLV3DOODGLDQLQ RULJLQZLWKDVOLJKWO\ODUJHUOHQJWKRIZDOOEHWZHHQWKHFHQWUDOZLQGRZVDQGWKH QH[WZLQGRZVWKDQEHWZHHQWKRVHZLQGRZVDQGWKHRXWHUZLQGRZV7KHJURXQG IORRUZDVUHEXLOWLQWKHPLG WKFHQWXU\ZLWKDVTXDUHKHDGHG'RULFGRRUFDVH DQGPDWFKLQJVKRSIURQWVRQHLWKHUVLGH7KHVKRSIURQWLVDUDUHVXUYLYDODQGDQ XQXVXDOGHVLJQ7KHZLQGRZVLQWKHKRXVHDQGLQWKHVKRSIURQWKDYHX39& JOD]LQJLQVHUWHG &: 'DQG$/DXQGUHWWH 7XOORZSKHOLP $IRXUED\WZRVWRUH\WHUUDFHGKRXVHGDWLQJIURPWKHODWHWKFHQWXU\DQG 5 $+ 0LOO6WUHHW SDUWLDOO\UHFRQVWUXFWHGLQWKH V,WUHWDLQVDYHU\ILQHURXQGKHDGHGEORFN 7XOORZ DQGVWDUWJUDQLWHFDUULDJHDUFKZLWKFRUQLFHVDWWKHLPSRVWV2QWKHZDOOLVD SODTXHUHFRUGLQJWKHIRXQGLQJRIDUHOLJLRXVRUGHU &: 7KH*LIW*DOOHU\ 7XOORZSKHOLP $WKUHHED\WZRVWRUH\WHUUDFHGKRXVHRIFLUFDZLWKDQDWXUDOVODWHURRI 5 $ 0LOO6WUHHW OLQHGVPRRWKUHQGHUHGDQGSDLQWHGZDOOVVLPSOHVKRSIURQWRIFLUFDZLWK 7XOORZ RULJLQDOPXOOLRQVVLPSOHGRRUFDVHDQGDVLQJOHJURXQGIORRUZLQGRZZLWKVWULS PRXOGLQJDQGNH\VWRQH$OOZLQGRZVQRZFRQWDLQX39&JOD]LQJEDUV &: 'R\OHV'U\&OHDQHUV 7XOORZSKHOLP $IRXUED\WZRVWRUH\JDEOHHQGHGKRXVHRIFLUFDZLWKQDWXUDOVODWHVRQ 5 $ %ULGJH6W WKHURRISDLQWHGOLQHGDQGUHQGHUHGZDOOVVPDOOZLQGRZVZLWKDUFKLWUDYHVDQGD 7XOORZ VHJPHQWDOKHDGHGDUFKLWUDYHGGRRUFDVHZLWKDQLQVHWGRRU7KHGRRULVRULJLQDO DQGKDVUDLVHGDQGILHOGHGSDQHOV$WUDGLWLRQDOWLPEHUVKRSIURQWZLWKFRUQLFH IDVFLDERDUGDQGVWULSSLODVWHUVZDVLQVHUWHGLQWKHODWH WKFHQWXU\7KHRULJLQDO SHUSHQGLFXODUJOD]LQJEDUVVXUYLYHLQWKHRSHQLQJRYHUWKHGRRU7KHFKLPQH\ VWDFNVKDYHEHHQUHPRYHG &: 0DF'HUPRWW 7XOORZSKHOLP $WKUHHED\WKUHHVWRUH\ODWH WKFHQWXU\KRXVHZLWKDQRUQDWHUHQGHUHG 5 $ %ULGJH6WUHHW IDoDGHRYHUWKHJURXQGIORRUZKLFKKDVDUFKLWUDYHVDQGEUDFNHWHGSHGLPHQWV 7XOORZ RYHUWKHILUVWIORRUZLQGRZVVWULSDUFKLWUDYHVDQGEUDFNHWHGFRUQLFHVRYHUWKH VHFRQGIORRUZLQGRZVDVWULQJFRXUVHRQWKHVHFRQGIORRUVLOOOHYHODQGUDLVHG FRLJQV7KHURRIKDVUHSODFHPHQWDVEHVWRVVODWHVWHUUDFRWWDULGJHWLOHVDQGD EULFNVWDFN7KHJURXQGIORRUZDVUHSODFHGZLWKJUDQLWHSLHUVFLUFD 7KH ZLQGRZVKDYHX39&JOD]LQJ &: )LW]SDWULFNV 7XOORZSKHOLP $WZRED\WKUHHVWRUH\KRXVHRIFLUFDZLWKDIDoDGHRIURXJKFDVWDVWULQJ 5 $ %ULGJH6WUUHW FRXUVHRQWKHVHFRQGIORRUVLOOOHYHODUDLVHGVWULSLQSODFHRIFRLJQVVHJPHQWDO 7XOORZ KHDGHGZLQGRZVZLWKDUFKLWUDYHVODWH WKFHQWXU\VDVKHVDWLPEHUVKRSIURQW ZLWKVLPSOHEUDFNHWVDQGDQDWXUDOVODWHURRIZLWKHDYHVDQGDEULFNVWDFN Tullow Draft LAP 2016-2022 - 92 - &: 7KH&RXUWKRXVH 7XOORZSKHOLP 7KHFRXUWKRXVHLVDYHU\XQXVXDOGHVLJQDQGGDWHVIURPFLUFD,WLVEXLOWRI 5 $,QW %DUUDFNV6WUHHW FRXUVHGUXEEOHJUDQLWHZLWKDWKUHHED\WZRVWRUH\IDoDGHZKLFKKDVDSDLURI 7XOORZ DUFKLWUDYHGGRRUFDVHVZLWKFRUQLFHRQWKHJURXQGIORRUDVWULQJFRXUVHRQZKLFK UHVWWKUHHDUFKLWUDYHGKDOIPRRQZLQGRZVZLWKNH\VWRQHVDQGWLPEHUUDGLDWLQJ JOD]LQJEDUV7KHIDoDGHLVIODQNHGE\PDVVLYHVWULSSLODVWHUVDQGWRSSHGE\D FRUQLFHDQGEORFNLQJFRXUVH7KHQRUWKHUQIDoDGHKDVDODUJHVHJPHQWDO KHDGHGZLQGRZZLWKRULJLQDOJOD]LQJEDUV7KHUHDUHIHDWXUHVRIWKHFRXUWKRXVH VXFKDVWKHGRRUFDVHVDQGWKHWUHDWPHQWRIWKHZLQGRZVZKLFKDUHVLPLODUWRWKH FRXUWKRXVHLQ&DVWOHFRPHU &: 7XOORZ0RQDVWHU\1DWLRQDO 7XOORZSKHOLP $ILYHED\VLQJOHVWRUH\VFKRROGDWHG DQGEXLOWRIFRXUVHGUXEEOHJUDQLWH,W 5 $6 6FKRRO KDVD8SODQZLWKDQRSHQYHUDQGDLQWKHFHQWUHDKDOIWLPEHUHGJDEOHRYHUWKH 7KH&RXUVH HQWUDQFHDQGIODQNLQJZLQJVZKLFKDUHJDEOHGDQGKDYHWULSDUWLWHZLQGRZVZLWK 7XOORZ JUDQLWHPXOOLRQV7KHVFKRROLVYHU\ZHOOGHWDLOHGZLWKQDWXUDOVODWHVRQWKHURRI LURQFUHVWLQJLQWKHFHQWUHKHDY\EDUJHERDUGLQJDYHQWLODWRURQWKHULGJHDQGD XQLTXHIRUPRIZLQGRZGHVLJQZKLFKLVH[HFXWHGLQEHHFK &: 6ODQH\+RXVH 7XOORZSKHOLP %XLOWDVDUHFWRU\LQDERXWWKHKRXVHLVGHWDFKHGDQGJDEOHHQGHGZLWKD 5 $,QW %DUUDFNV6WUHHW SLWFKHGURRIRIQDWXUDOVODWHVDQGHQGVWDFNV7KHIDoDGHLVRIILYHED\VDQGWZR 7XOORZ VWRUH\VZLWKLWVRULJLQDOOLPHUHQGHULQJZKLFKUHPDLQVXQSDLQWHGDQGDVLPSOH VTXDUHKHDGHGJUDQLWHGRRUFDVHQRZHQFORVHGLQDJOD]HGSRUFK7KHZLQGRZV RQWKHILUVWIORRUUHWDLQWKHLURULJLQDOVDVKHVZLWKVL[SDQHVLQHDFKVDVK7KH JURXQGIORRUZLQGRZVZHUHDOWHUHGLQWKHODWH WKFHQWXU\ZLWKDVLQJOHZLGH ZLQGRZUHSODFLQJWKHWZRZLQGRZVRQHDFKVLGHRIWKHIURQWGRRU 7KHUHLVDVLQJOHED\WZRVWRUH\ZLQJUHFHVVHGRQWKHOHIWKDQGVLGHDQGD VHUYLFHZLQJDWWKHUHDU &: &KXUFK2I,UHODQG6FKRRO 7XOORZSKHOLP $YHU\KDQGVRPH8SODQVFKRROEXLOGLQJRIFLUFDEXLOWRIFRXUVHGEORFNVRI 5 $ 'XEOLQ5RDG URXJKFXWJUDQLWHRIILYHED\VDQGWZRVWRUH\VZLWKODUJHZLGHZLQGRZVRQWKH 7XOORZ JURXQGIORRUDQGORZZLGHZLQGRZVRQWKHILUVWIORRUDOOZLWKJUDQLWHGULSODEHOV 7KHGRRUFDVHKDVDVLPSOHJUDQLWHGUHVVLQJDQGDQHOOLSWLFDOKHDGHGIDQOLJKW WKDWLVPXFKZLGHUWKDQWKHGRRU WKHLPSUHVVLRQLVWKDWRULJLQDOO\WKHGRRUZDV PXFKZLGHU 7KHURRILVORZSLWFKHGFRYHUHGZLWKQDWXUDOVODWHVKDVWZRJUDQLWH VWDFNVDQGZLGHHDYHVZLWKSDLUHGEUDFNHWV7KHUHDUHIXUWKHUJUDQLWHZDOOHG DGGLWLRQVDWWKHUHUH7KHZLQGRZVKDYHKDGX39&JOD]LQJEDUVLQVHUWHGDQG WKHUHKDYHEHHQPRGHUQH[WHQVLRQVWRWKHVFKRROLQUHFHQW\HDUV &: 6W&ROXPED¶V 7XOORZSKHOLP 7KHFKXUFKGDWHVIURPFLUFDDQGKDVDIRXUED\VLQJOHFHOOQDYHRI 5 $ &KXUFKRI,UHODQG&KXUFK FRXUVHGUXEEOHJUDQLWHDKDOIKH[DJRQDSVHEXWWUHVVHVDQGSRLQWHGZLQGRZV 7XOORZ ZLWKGULSODEHOV7KHVTXDUHSODQWRZHUKDVDQRFWDJRQDOEHOIU\VXSSRUWHGE\ H[FHSWLRQDOO\WDOOSLQQDFOHVZLWKIO\LQJEXWWUHVVHVDQGFURZQHGE\FUHQHOODWLRQV DQGSLQQDFOHV7KHLQWHULRUKDVDQLQWHUHVWLQJRSHQWUXVVFDVWLURQURRIVWUXFWXUH DQGVHYHUDOZDOOPRQXPHQWVLQFOXGLQJWKHLPSRUWDQW1HYLOOHPRQXPHQWRI 7KHFKXUFKZDVGHVLJQHGE\7KRPDV®HQDQGWKHGHVLJQRIWKHWRZHU HFKRHVWKDWRIWKH&DWKROLFFKXUFKLQ+DFNHWVWRZQ7KHFKXUFKLVVXUURXQGHGE\ Tullow Draft LAP 2016-2022 - 93 - DJUDYH\DUGDQGDUHWDLQLQJZDOOZLWKUDLOLQJVRQWRS7KLVZDOOLVDQH[FHSWLRQDOO\ ILQHOHQJWKRIVWRQHZRUN 7KHHQWUDQFHLVWKURXJKDJUDQLWHDUFKDQGSDYHGSDWKZLWKVLGHZDOOV &: /HWWHU%R[ 7XOORZSKHOLP :DOOPRXQWHGFDVWLURQOHWWHUER[ZLWKD95LQVLJQLD 5 685 'XEOLQ5RDG 7XOORZ &: +RO\:HOO 7XOORZSKHOLP $VPDOOHQFORVXUHZKLFKFRQVLVWVRIWZRVWLOHVLQDORZZDOOEHVLGHWKHURDGD 5 6 %DUUDFN6WUHHW ZDOOHGSDWKGRZQWRDORZHUOHYHODQGDKRRGHGQLFKHZLWKDSRLQWHGDUFKZKLFK 7XOORZ FRQWDLQVWKHZHOO2QWKHKRRGDUHDFURVVDQGWKHZRUGVµ2XU4XHHQDQG2XU 0RWKHU¶7KHZDOOVDQGWKHQLFKHDUHZKLWHZDVKHGZLWKEOXHWULPPLQJ &: 7KH'LQHU 7XOORZSKHOLP 7KLVLVDWZRED\WKUHHVWRUH\JDEOHHQGHGODWHWKFHQWXU\KRXVHZLWKSDLQWHG 5 $ 0DUNHW6TXDUH UHQGHULQJVODWHGURRIZLWKHDYHVHQGVWDFNVDQGDILQHURXQGKHDGHG 7XOORZ DUFKLWUDYHGGRRUFDVHZLWKDVFUROONH\VWRQHDQGWLPEHUUDGLDOIDQOLJKW7KH ZLQGRZVKDYHPRGHUQJOD]LQJEDUVDQGWKHUHLVDPRGHUQVKRSIURQW7KLV SURWHFWLRQUHODWHVWRWKHIDoDGHRQO\ &: 5LSOH\¶V 7XOORZSKHOLP $WKUHHED\WKUHHVWRUH\KRXVHZLWKDKLJKSLWFKHGURRIZKLFKPDLQWDLQVWKH 5 $ 7KH6TXDUH VDPHOLQHDVWKH)%'EXLOGLQJSDLQWHGDQGUHQGHUHGZDOOVDQGODWHWKFHQWXU\ 7XOORZ URXQGKHDGHGDUFKLWUDYHGGRRUFDVHZLWKDOHDGHGIDQOLJKW7KHURRIKDV DVEHVWRVVODWHVWKRXJKDUHQGHUHGFKLPQH\VWDFNDQGWKHZLQGRZVKDYHX39& JOD]LQJEDUV &: /HWWHU%R[ 7XOORZSKHOLP :DOOPRXQWHGFDVWLURQ9LFWRULDQOHWWHUER[ZLWKWKHLQVLJQLD957KHOHWWHUER[LV 5 7F 1HZ&KDSHO/DQH LQWKHZDOORIDKRXVHRQWKHQRUWKVLGHRI1HZ&KDSHO/DQH 7XOORZ &: 3-'XII\ 7XOORZSKHOLP 3-'XII\KDVDWKUHHED\WKUHHVWRUH\ODWH WKFHQWXU\KRXVHIDFLQJ0LOO6WUHHW 5 $ 0LOO6WUHHW ZLWKDILYHED\WKUHHVWRUH\IDoDGHIDFLQJDODQH,WLVEXLOWRIODUJHEORFNVRI 7XOORZ FRXUVHGUXEEOHJUDQLWH ULEERQSRLQWHG ZLWKEULFNGUHVVLQJVWRWKHZLQGRZVD SDLQWHGDQGUHQGHUHGJURXQGIORRUZLWKWZRVKRSIURQWVERWKZLWKVOHQGHUSLHUV ODUJHSODWHJODVVZLQGRZVDQGVOHQGHUEUDFNHWV7KHHQWUDQFHWRWKHVKRSIDFHV 0LOO6WUHHWDQGKDVDWZROHDIGRRU7KHZLQGRZVKDYHVDVKZLQGRZVDQGWKHURRI KDVQDWXUDOVODWHVDQGEULFNVWDFNV Rating 5 5HJLRQDO Importance $ $UFKLWHFWXUDO $UW $UWLVWLF , ,QGXVWULDO 7U 7UDQVSRUW 5 5DULW\ 8 8QLTXH / /RFDO 6 6RFLDO ( (QJLQHHULQJ + +LVWRULFDO 7F 7HFKQLFDO 6F 6FLHQWLILF Tullow Draft LAP 2016-2022 - 94 - Map 9: Protected Structures in Tullow LAP Area Tullow Draft LAP 2016-2022 - 95 - Map 10 : Protected Structures in Tullow Town Centre Area Tullow Draft LAP 2016-2022 - 96 - Map 11 : Recorded Sites and Monuments in Tullow LAP area Tullow Draft LAP 2016-2022 - 97 - Tullow Draft LAP 2016-2022 - 98 - CHAPTER 11 TOURISM 11.1 Introduction 7KHUHDUHPDQ\EHDXWLIXOJDUGHQVLQDQG DURXQG7XOORZLQFOXGLQJ$OWDPRQW*DUGHQVD 7RXULVPPDNHVDQLPSRUWDQWFRQWULEXWLRQWR URPDQWLFJDUGHQZKLFKLVEHLQJFRQWLQXRXVO\ WKHHFRQRP\ZLWKLQFRPHGHULYHGIURPWRXULVW UHVWRUHGDQGDGGHGWR7KHQHDUE\5DWKZRRG DFWLYLW\EHLQJGLVWULEXWHGDFURVVDZLGHUDQJH +RPH*LIWDQG*DUGHQ:RUOGFRPSULVHVDQ RIHFRQRPLFVHFWRUVDVZHOODVEHLQJDFDWDO\VW H[WHQVLYHJDUGHQFHQWUHZLWKJLIWFHQWUHD IRUDFRQVLGHUDEOHDPRXQWRIFRPPHUFLDO PD]HRI,UHODQGDQGDQH[WHQVLYHIRUHVWZDON DFWLYLW\LQWKHWRZQ 7KHVHFKDUDFWHULVWLFVDQGDPHQLWLHVDFWDV 7XOORZ¶VPDLQWRXULVWDWWUDFWLRQLV0RXQW YDOXDEOHUHFUHDWLRQDODQGWRXULVPDVVHWVIRU :ROVHOH\+RWHO6SDDQG*ROI5HVRUWRQWKH WKHWRZQDQGJUHDWO\HQKDQFHLWVRYHUDOO HDVWHUQSHULPHWHURIWKHSODQDUHD+RZHYHU DSSHDO WKHWRZQKDVDORWWRRIIHULQWHUPVRILWV SLFWXUHVTXHORFDWLRQEHVLGHWKH5LYHU6ODQH\ 7KH7XOORZ6KRZLVDOVRDJUHDWDWWUDFWLRQ 7XOORZDOVRUHIOHFWVDQHQGXULQJKLVWRULFDO HDFK\HDUDWWUDFWLQJORFDOQDWLRQDODQG FXOWXUHZLWKPDQ\LWHPVRIDQWLTXLW\LQFOXGLQJ LQWHUQDWLRQDOYLVLWRUVHDFK\HDU WKH5DWKJDOO6WRQH)RUW&ORFKD3KRLOODQ DQFLHQWKROHGVWRQHMXVWRXWVLGH7XOORZD $OVRWKH1DWLRQDO3ORXJKLQJ&KDPSLRQVKLS SUHKLVWRULFEXULDOSODFH %DZQRJH DQG KDVEHHQKHOGRXWVLGHRI7XOORZLQUHFHQW +DUROGVWRZQ'ROPHQ(DFKDWHVWDPHQWWRWKLV \HDUVZLWKWKHFRPSHWLWLRQH[SHFWHGWRUHWXUQ DUHDVDQFLHQWSDVW DJDLQLQWKHFRPLQJ\HDUV ,QWKHFHQWUHRIWKHWRZQLVDVWDWXHRI)U-RKQ &KDOOHQJHV 0XUSK\D:H[IRUGSULHVWLQYROYHGLQWKH 5LVLQJZKRZDVH[HFXWHGLQ7XOORZ¶VPDUNHW 7XOORZKDVEHHQFRPSHWLQJZLWKODUJHUWRZQV VTXDUHLQ-XO\ VXFKDVQHDUE\.LONHQQ\DQG&DUORZIRU WRXULVPGHYHORSPHQWDQGDVDUHVXOWWRXULVP QXPEHUVDQGIDFLOLWLHVDUHODFNLQJLQWKHWRZQ ,QRUGHUIRUWKHWRZQWRDLGWRXULVPJURZWK 7XOORZ¶VUROHZLWKLQWKHFRXQW\DQGVRXWKHDVW UHJLRQQHHGVWREHHQKDQFHGE\VXSSRUWLQJ WKHJURZWKRIWKHWRZQDQGWRXULVPIDFLOLWLHVLQ RUGHUWRDFKLHYHWKHQHFHVVDU\FULWLFDOPDVVWR FRPSHWHIRUIXWXUHWRXULVPDQGHFRQRPLF JURZWK :KLOVW7XOORZVXIIHUHGLQWKHHFRQRPLF GRZQWXUQLWKDVQRZVHHQDVORZWXUQDURXQG ZLWKPRUHXQLWVLQWKHWRZQFHQWUHEHLQJ RFFXSLHGWKDQLQUHFHQW\HDUVZLWKWKHPDMRU LQGXVWULHVDQGEXVLQHVVHVSXOOLQJWKURXJKWKLV WRXJKSHULRG 3URPRWLQJWRXULVWDWWUDFWLRQVWKURXJKRXWWKH WRZQDQGLWVHQYLURQVLVDFKDOOHQJH 2SSRUWXQLWLHVVKRXOGEHVRXJKWWRZRUNLQ FROODERUDWLRQZLWK&DUORZ7RXULVPDQG)iLOWH ,UHODQGWRSURYLGHZD\VRIPDUNHWLQJWKHWRZQ ZKHWKHULWEHVWUDWHJLFDOO\ORFDWHGWRXULVW LQIRUPDWLRQERDUGVWKHXVHRIJUDQLWH IODJVWRQHVWRLGHQWLI\DUHDVRILQWHUHVWGRWWHG WKURXJKRXWWKHWRZQRUDWRXULVWFHQWUH Tullow Draft LAP 2016-2022 - 99 - 11.3 Strategic Approach x 7RPDLQWDLQWKHDWWUDFWLRQVWKDWWKH WRZQKDVWRRIIHULQFOXGLQJQDWXUDO ,QUHVSRQGLQJWRWKHFKDOOHQJHVIDFLQJ7XOORZ EXLOWDQGFXOWXUDOKHULWDJHDQGVFHQLF WKLVGUDIW/$3ZLOOSXUVXHWKHIROORZLQJ ZDONZD\VDORQJWKH5LYHU6ODQH\ DSSURDFK x 7RSURPRWHWKHGHYHORSPHQWRI ,PSURYHWKHJHQHUDODWWUDFWLYHQHVV SUHPLHUWRXULVWSURGXFWVDQGDYLEUDQW RI7XOORZIRUYLVLWRUVDQGLQYHVWRUV WRZQFHQWUH$GGLWLRQDODWWUDFWLRQVDQG DVDNH\SDUWRILQFUHDVLQJ IDFLOLWLHVZLOOEHSURPRWHGLQRUGHUWR FRPSHWLWLYHQHVVDQGFUHDWLQJD HQFRXUDJHWRXULVWVWRH[WHQGWKHLUVWD\ YLEUDQWLQWHUHVWLQJDQGZHOFRPLQJ DQGJHQHUDWHWRXULVPJHQHUDWHG WRZQIRUSHRSOHWRYLVLW H[SHQGLWXUHLQWKHWRZQ 5HDOLVHWKHSRWHQWLDORIWRXULVW x 7RSURPRWHDQGVXSSRUWUDSLGO\ DWWUDFWLRQVZLWKLQWKHVXUURXQGLQJ JURZLQJHFRWRXULVPLQWKHWRZQDQG UHJLRQDQGKDUQHVVLQJWKH LWVKLQWHUODQGV SRWHQWLDORI7XOORZ¶VEXLOWDQG QDWXUDOKHULWDJH x 7RSURPRWHDQGLPSURYHWRXULVP 6WUHQJWKHQDQGFRQVROLGDWHWKH LQIUDVWUXFWXUHLQWKHWRZQDQGLWV WRZQFRUHDUHDWRFUHDWHDPL[HG HQYLURQVLQFOXGLQJWRXULVW XVHOLYHO\DQGYLEUDQWWRZQFHQWUH DFFRPPRGDWLRQDPHQLWLHVDFFHVV VLJQSRVWLQJFDUDQGELF\FOHIDFLOLWLHV /RRNDWPHDQVWRFUHDWHDYLEUDQW ULYHUVLGHHQYLURQPHQWLQWKHWRZQ FHQWUH 11.5 Natural Amenities &ROODERUDWHZLWKERWKORFDOJURXSV DQGDJHQFLHVLQWKHWRZQDORQJ 7KH5LYHU6ODQH\FRQVWLWXWHVWKHPRVW ZLWK&DUORZ7RXULVPWRGHYHORS LPSRUWDQWQDWXUDODPHQLW\LQWKHWRZQDQGLV DQGSURPRWHWKHWRZQWRLWVIXOO RQHRIWKHPRVWVLJQLILFDQWQDWXUDODPHQLWLHV SRWHQWLDODVDWRXULVWGHVWLQDWLRQ DFWLQJDVDPDMRUWRXULVPUHVRXUFH 11.4 Sustainable Tourism 7KH5LYHU6ODQH\KDVDZHDOWKRIDWWUDFWLRQV IRUWKHYLVLWRUDORQJWKHEDQNVVXFKDVILVKLQJ FDQRHLQJELUGZDWFKLQJHWF:DONLQJDQG 7KH&RXQFLOUHFRJQLVHVWKHLPSRUWDQFHRI F\FOLQJIDFLOLWLHVKRZHYHUDUHPLQLPDODQG VXVWDLQDEOHWRXULVPDVXQPDQDJHGWRXULVP VXEMHFWWRDOOHQYLURQPHQWDOFRQVLGHUDWLRQVWKLV KDVSRWHQWLDOWRHURGHWKHTXDOLW\RIWKHWRXULVP QHHGVWRDGGUHVVHGVRDVWRPDNHWKH SURGXFWDQGWKHHQYLURQPHQWDOTXDOLW\RIWKH ULYHUVLGHPRUHDSSHDOLQJWRERWKORFDOVDQG DUHD YLVLWRUVDOLNH 6XVWDLQDEOHWRXULVPPXVWGHYHORSDWDSDFH 11.6 Cultural Tourism DQGVFDOHZKLFKHQVXUHVWKDWWKHWRZQV¶ WRXULVPDVVHWVDUHQRWGLPLQLVKHGLQWKHORQJ ,QWHUPVRI&XOWXUDOWRXULVP7XOORZKDVD WHUP7KHSULQFLSDODLPVWRDFKLHYHD PXOWLWXGHRIVLWHVIRUWKHYLVLWRU7KHVHZRXOG VXVWDLQDEOHWRXULVPVHFWRULQ7XOORZDUH LQFOXGHWKHFRXUWKRXVHWKH0XVHXPWKH $EEH\UHPQDQWVDQGDVVRFLDWHGJUDYH\DUG 7RPD[LPLVHWKHSRWHQWLDORIWRXULVP x DQGWKHWRZQ¶VFKXUFKHV DVDµSLOODURIHFRQRPLFJURZWK¶ZKLFK ZLOOFRQWULEXWHWREDODQFHGHFRQRPLF 6W3DWULFN¶V7UDLO1DPHGDIWHU6W3DWULFNZKR GHYHORSPHQWDQGWKHWRXULVPLQGXVWU\ LVUHSXWHGWRKDYHEDSWLVHGWKH.LQJRI /HLQVWHULQQRUWK&DUORZWDNHVLQ7XOORZ7KH x 7RSURWHFWWKHWRZQ¶VWRXULVPDVVHWV WRZQKDVDULFKHFFOHVLDVWLFDOWUDGLWLRQDQG DQGFDSLWDOLVHRQWKHGLVWLQFWWRXULVP DORQJZLWK&DUORZWRZQZDVLQWKHIRUHIURQWRI RSSRUWXQLWLHVZLWKLQWKHWRZQDQG WKHQLQHWHHQWKFHQWXU\UHYLYDORI&DWKROLF HQYLURQV SODFHVRIZRUVKLSDQGHGXFDWLRQ Tullow Draft LAP 2016-2022 - 100 - 0DS 6W3DWULFN¶V7UDLO 7KH*RUGHQ%HQQHWW5DOO\DOVRWDNHVLQ7XOORZ DORQJLWVURXWHHYHU\VXPPHUZLWKWKHFDUVRQ 11.6.1 Indigenous Food, Drink and Crafts GLVSOD\LQ5DWKZRRGIRUDQDIWHUQRRQDOVR )RRG7RXULVPLVLQFUHDVLQJO\UHFRJQLVHGDVDQ LPSRUWDQWSDUWRIWKHFXOWXUDOWRXULVPPDUNHW ZLWKWRXULVWVVHHNLQJDXWKHQWLFDQGXQLTXH H[SHULHQFHV)RRGWRXULVPSUHVHQWV RSSRUWXQLWLHVIRUWKHWRZQLQWKHIXWXUHDVD ORFDWLRQIRUKLJKTXDOLW\LQGLJHQRXVIRRG :LWKWKHFXUUHQWJURZWKLQIDUPHUVDQGFRXQWU\ PDUNHWVRUJDQLFIRRGSURGXFWLRQDQGKHDOWK\ OLIHVW\OHV7XOORZKDVWKHSRWHQWLDOWRGHYHORS IRRGWRXULVPDVDQLFKHWRXULVWSURGXFWWKURXJK WKHSDUWLFLSDWLRQLQORFDOIRRGWUDLOVRUWKH GHYHORSPHQWRID*RRG)RRG&LUFOH7UDLO &RRODWWLQ&KHGGDU7KH&KRFRODWH*DUGHQRI ,UHODQG%XWOHUV2UJDQLFV/WGDUHDOOLQWKH KLQWHUODQGRI7XOORZDQGDOOIHDWXUHLQWKH &DUORZ)RRG7UDLO 7XOORZDQGLWVVXUURXQGLQJKLQWHUODQGKDVDQ DEXQGDQFHRIRULJLQDOWUDGLWLRQDOKDQGPDGH FUDIWVLQFOXGLQJZRRGWXUQLQJSRWWHU\ FHUDPLFVLURQZRUNVDQGWH[WLOHVWKDWKDYH 0DS $UHDFRYHUHGE\*RUGHQ%HQQHWW5DOO\ REYLRXVDSSHDOWRWKHYLVLWRU+RZHYHU7XOORZ Tullow Draft LAP 2016-2022 - 101 - ODFNVDFHQWUDOYHQXHIRUYLVLWRUVWRYLHZDQG 73 7RSURPRWHDQGIRVWHUDJURZLQJVHQVHRI SXUFKDVHORFDOFUDIWIURPERWKWKHWRZQDQGLWV LQQRYDWLRQDQGHQWUHSUHQHXUVKLSLQWKH KLQWHUODQG3RSXSW\SHVKRSVWRGLVSOD\DUWV WRXULVPVHFWRU DQGFUDIWVZRXOGDOVREHZRUWK\RI 73 7RHQFRXUDJHDQGVXSSRUWLQFUHDVHGFR FRQVLGHUDWLRQLQWKHWRZQFHQWUH RUGLQDWLRQFRKHVLRQDQGOLQNDJHVEHWZHHQ DJHQFLHVVXFKDV)DLOWH,UHODQG&DUORZ 11.7 Recreational Amenities 7RXULVP:DWHUZD\V,UHODQGWKH6RXWKHUQ 5HJLRQDO$VVHPEO\DQG7UDQVSRUW 7KH5LYHU6ODQH\LVDKXJHUHFUHDWLRQDO ,QIUDVWUXFWXUH,UHODQG DPHQLW\UXQQLQJWKURXJK7XOORZDQGWKLVLVDQ XQGHUXWLOLVHGDPHQLW\ZLWKQRGHVLJQDWHG 73 7RSURWHFWWKHQDWXUDOUHVRXUFHVXSRQ ZDONLQJWUDLOVDORQJVLGHWKHULYHU/LQNLQJ ZKLFKWRXULVPLVEDVHGWKURXJKUHOHYDQW ZDONLQJURXWHVWRRWKHUQHDUE\DWWUDFWLRQVVXFK SROLF\LQUHODWLRQWRUHVRXUFHSURWHFWLRQ DV$OWDPRQWDOVRDGMRLQLQJWKH5LYHU6ODQH\ VXFKDVODQGVFDSHFKDUDFWHUDVVHVVPHQW ZRXOGSURYLGHDVFHQLFURXWHDQGDWWUDFWPRUH ZDWHUTXDOLW\DQGELRGLYHUVLW\ ZDONLQJKROLGD\VWRWKHDUHD+RZHYHUWKHULYHU 73 7RHQFRXUDJHVXSSRUWIDFLOLWDWHDQG LVFRQVWDQWO\XVHGIRUILVKLQJDQGWKHUHLVD SURPRWHWKHGHYHORSPHQWDQGH[SDQVLRQ ND\DNLQJFOXESUHVHQWLQWKHWRZQ RIHFRWRXULVPJHRDQGJUHHQWRXULVP LQGXVWULDOWRXULVPVLWHVDQGVLPLODU 0RXQW:ROVHOH\RIIHUVYLVLWRUVJROILQJDQGD GHYHORSPHQWVLQWKHWRZQVXEMHFWWRQR KHDOWKDQGOHLVXUHFHQWUHEXWWKLVLVWKHVROH QHJDWLYHLPSDFWVRQWKHHQYLURQPHQW OHLVXUHFHQWUHDYDLODEOHLQWKHWRZQ$KHDOWK DQGOHLVXUHFHQWUHHOVHZKHUHLQWKHWRZQZRXOG 73 7RFDSLWDOLVHRQSRWHQWLDOWRXULVWLQFRPHE\ KDYHKXJHEHQHILWVFRQVLGHULQJWKHVL]HRIWKH VHHNLQJWR WRZQDQGLWVKLQWHUODQG ,PSURYHWKHSXEOLFUHDOPFUHDWLQJDFDIp FXOWXUHVXSSRUWLQJFUDIWDQGDUWLVDQGHOL 7XOORZ7HQQLV&OXELVDQRWKHUUHFUHDWLRQDO VW\OHUHWDLOLQJLQWKHWRZQFRUHDQGDORQJ DPHQLW\LQWKHWRZQZKLFKLVKRSLQJWRH[SDQG WKHULYHUEDQNDUHD LWVIDFLOLWLHVLQWKHFRPLQJ\HDUVWRRIIHUPRUH LQGRRUIDFLOLWLHVVXFKDVDJ\PDQGLQGRRU 3URPRWHDFFRPPRGDWLRQFKRLFHVLQWKH PXOWLIXQFWLRQDOFRXUWV WRZQ 7KH*$$ILHOGRQWKH%DOO\PXUSK\5RDGKDV 3URPRWHDQGFDSLWDOLVHRQWKHWRZQ¶V VHYHUDOSLWFKHVDQGKDVGHYHORSHGDZDONLQJ SRVLWLRQRQWKH5LYHU6ODQH\DQGLWV URXWHDURXQGWKHSLWFKZKLFKRIIHUVDVDIH HQYLURQVIRUORQJGLVWDQFHZDONLQJURXWHV ZHOOOLWHQYLURQPHQWIRUWKRVHZLVKLQJWRZDON 73 7RVHHNWRPDQDJHDQ\LQFUHDVHLQYLVLWRU RUUXQ QXPEHUVWRDYRLGVLJQLILFDQWHIIHFWV LQFOXGLQJORVVRIKDELWDWDQGGLVWXUEDQFH 7KHWRZQKDOOLQ7XOORZ&DSWDLQ0XUSK\ DQ\SURMHFWVDUHDVXLWDEOHGLVWDQFHIURP 0HPRULDO+DOOZRXOGEHQHILWKXJHO\LILW WKHZDWHU¶VHGJHDQGOHJLVODWLRQUHODWLQJWR H[SDQGHGLWVXVHWRRIIHUPRUHUHFUHDWLRQDO KDELWDWVVSHFLHVFRQQHFWLYLW\DQG IDFLOLWLHVVXFKDVFLQHPDQLJKWVH[SDQGLQJLWV GHVLJQDWHGVLWHVLVFRPSOLHGZLWK UDQJHRIUHFUHDWLRQDOFODVVHVRSHQWRERWK ORFDOVDQGWRXULVWV It is an objective of the Council: 11.8 Tourism Policies and Objectives 72 7RSURYLGHZKHUHIHDVLEOHDQGVXSSRUWWKH SURYLVLRQRIWRXULVPLQIUDVWUXFWXUHDQG It is the policy of the Council: VHUYLFHVVXEMHFWWRWKHUHTXLUHPHQWVRIWKH 73 7RVHHNWRSURPRWHWKHVWDWXVRI7XOORZDV +DELWDWV'LUHFWLYHLQFOXGLQJZDONLQJ DSRSXODUSODFHWROLYHDQGYLVLWE\VWULYLQJ F\FOLQJDQGZDWHUEDVHGLQIUDVWUXFWXUHDQG WRSUHVHUYHWKHDWWULEXWHVDQGDVVHWVRIWKH VKRUWWHUPJXHVWDFFRPPRGDWLRQIDFLOLWLHV WRZQWKDWPDNHLWXQLTXHDQGE\ WKURXJKRXWWKHVHWWOHPHQWLQDSSURSULDWH HQGHDYRXULQJWRHQULFKWKH ORFDWLRQV LQKDELWDQWYLVLWRUH[SHULHQFHE\ 72 7RHQFRXUDJHDQGDVVLVWWKHVXVWDLQDEOH FRQWULEXWLQJSRVLWLYHO\WRZDUGVHQKDQFLQJ GHYHORSPHQWRIWKHWRXULVPSRWHQWLDORI WKHRYHUDOODPHQLW\DPELHQFHDQG 7XOORZLQDPDQQHUWKDWUHVSHFWVEXLOGV DHVWKHWLFRIWKHWRZQ RQSURWHFWVDQGHQKDQFHVWKHFXOWXUDO EXLOWDQGQDWXUDOKHULWDJHRIWKHWRZQDQG WKHORFDODPHQLWLHVZLWKLQWKHSODQDUHD Tullow Draft LAP 2016-2022 - 102 - 72 7RZRUNZLWKERGLHVVXFKDV7UDQVSRUW ,QIUDVWUXFWXUH,UHODQG)DLOWH,UHODQGDQG &DUORZ7RXULVPWRLPSURYHVLJQDJHERWKWR WKHWRZQLWVHOIIURPDOODSSURDFKURXWHV DQGWKURXJKRXWWKHWRZQVRWKDWDOODUHDV RILQWHUHVWDUHFOHDUO\LQGLFDWHGDQG DFFHVVLEOH 72 7RVXSSRUWWKHSURYLVLRQDQG DXJPHQWDWLRQRIVSRUWLQJND\DNLQJ FDQRHLQJDQGDQJOLQJIDFLOLWLHVSRQ\ WUHNNLQJURXWHVDGYHQWXUHFHQWUHVDQG DVVRFLDWHGDQFLOODU\XVHVLQDSSURSULDWH ORFDWLRQVVXEMHFWWRWKHUHTXLUHPHQWVRI WKH+DELWDWV'LUHFWLYH 72 7RHQFRXUDJHWKHSURSRUWLRQDWH GHYHORSPHQWRILQGLYLGXDODQGPXOWLSOH KROLGD\KRPHGHYHORSPHQWVFKHPHVZLWKLQ H[LVWLQJDGHTXDWHO\VHUYLFHGVLWHVODQGVLQ WKHWRZQ 72 7RFUHDWHDV\QHUJ\EHWZHHQ7XOORZDQG WKHVXUURXQGLQJWRXULVWDWWUDFWLRQV Tullow Draft LAP 2016-2022 - 103 - Tullow Draft LAP 2016-2022 - 104 - CHAPTER 12 LANDUSE ZONING OBJECTIVES 12 IMPLEMENTATION 12.1 Land Use Zoning K 7KHSUHVHQWDQGIXWXUHVLWXDWLRQ Objectives UHJDUGLQJWKHSURYLVLRQRIHVVHQWLDO SK\VLFDOLQIUDVWUXFWXUH±HVSHFLDOO\ $NH\PHWKRGRILPSOHPHQWLQJWKLV/$3LV ZDWHUZDVWHZDWHUDQGURDGV WKURXJKWKHLGHQWLILFDWLRQRIODQGXVH ]RQLQJVDQGREMHFWLYHVIRUVSHFLILFVLWHVLQ L 7KHWRXULVPSRWHQWLDORIWKHWRZQDQG 7XOORZ7KHVHDUHVKRZQRQ0DS WKHKLQWHUODQGDUHDDQGWKHQHHGWR DWWDFKHGZLWKWHUPVDQGLQGLFDWLYHODQG IDFLOLWDWHWKHSURYLVLRQRIDQ XVHVVHWRXWEHORZ7KHSXUSRVHRIODQG DSSURSULDWHWRXULVWRIIHU XVH]RQLQJLVWRLQGLFDWHWRSURSHUW\ RZQHUVDQGWRWKHJHQHUDOSXEOLFWKH M 7KHIROORZLQJVSHFLILFSODQQLQJDQG W\SHVRIGHYHORSPHQWWKDW&DUORZ&RXQW\ ODQGXVHREMHFWLYHVUHIHUWRODQG &RXQFLOFRQVLGHUVPRVWDSSURSULDWHLQ ]RQLQJVDVLGHQWLILHGRQ0DSDQG HDFK]RQH,WDOVRSURPRWHV 7DEOHVEHORZ UHGHYHORSPHQWDQGUHQHZDOZKLFKDOORZV WKHGHYHORSHUWRSODQLQYHVWPHQWZLWK VRPHFHUWDLQW\,QWKHFRQWURORI GHYHORSPHQW]RQLQJVHHNVWROLPLW FRPSHWLQJDQGLQFRPSDWLEOHXVHVLQRUGHU WRSURPRWHJUHDWHUVXVWDLQDELOLW\DQG HQYLURQPHQWDOTXDOLW\:LWKGXH FRQVLGHUDWLRQWRWKHH[WHQWDQGW\SHVRI ODQGXVH]RQLQJREMHFWLYHVWKHIROORZLQJ IDFWRUVKDYHEHHQWDNHQLQWR FRQVLGHUDWLRQ D 7KHSUHVHQWGHYHORSPHQWDUHDDQG UHFHQWWUHQGVLQGHYHORSPHQW E 7KHDPRXQWRIFRPPLWWHGDQG XQFRPPLWWHGODQGZLWKLQWKHH[LVWLQJ GHYHORSPHQWDUHD F 7KHDFFHVVLELOLW\DYDLODELOLW\DQG ORFDWLRQRIODQGIRUGHYHORSPHQW G 7KHORFDWLRQDQGDGHTXDF\RIH[LVWLQJ VRFLDOLQIUDVWUXFWXUH VFKRROV FRPPXQLW\IDFLOLWLHVHWF H 7KHFKDUDFWHURIWKHWRZQZLWKUHJDUG WRWKHVFDOHDQGSDWWHUQRI GHYHORSPHQW I 7KHQHHGWRSURPRWHSODQQLQJDQG VXVWDLQDEOHGHYHORSPHQWLQ DFFRUGDQFHZLWKQDWLRQDOUHJLRQDODQG ORFDOSROLFLHVDQG*RYHUQPHQW *XLGHOLQHV J 3K\VLFDOIHDWXUHVDQGDPHQLWLHVRIWKH WRZQ Tullow Draft LAP 2016-2022 - 105 - 5HI 8VH =RQLQJ2EMHFWLYH $ 7RZQ&HQWUH 7RSURYLGHIRUWKHGHYHORSPHQWDQGLPSURYHPHQWRIDSSURSULDWHWRZQFHQWUH $FWLYLWLHV XVHVLQFOXGLQJUHWDLOUHVLGHQWLDOFRPPHUFLDORIILFHDQGFLYLFXVH 7KHSXUSRVHRIWKLV]RQHLVWRSURWHFWDQGHQKDQFHWKHVSHFLDOFKDUDFWHURI7XOORZ WRZQFHQWUHDQGWRSURYLGHIRUDQGLPSURYHUHWDLOLQJUHVLGHQWLDOFRPPHUFLDORIILFH FXOWXUDODQGRWKHUXVHVDSSURSULDWHWRWRZQFHQWUH,WLVDQREMHFWLYHRIWKH&RXQFLO WRHQFRXUDJHWKHXVHRIEXLOGLQJVDQGEDFNODQGVDQGHVSHFLDOO\WKHIXOOXVHRIXSSHU IORRUV,WLVDOVRDQREMHFWLYHRIWKH&RXQFLOWKDWJURXQGIORRUVZKHUHDSSURSULDWHZLOO SURYLGHDFWLYHIURQWDJHV*HQHUDOO\WZRDQGLQH[FHSWLRQDOFLUFXPVWDQFHVWKUHH VWRUH\EXLOGLQJVZLOOEHSUHIHUUHG:DUHKRXVLQJDQGRWKHUOLJKWLQGXVWULDOXVHVZLOO JHQHUDOO\QRWEHHQFRXUDJHGZLWKLQWKHWRZQFHQWUH Flood Risk Requirements 7KH WRZQ FHQWUH ODQGV FRQWDLQ VLJQLILFDQW DUHDV WKDW DUH ZLWKLQ WKH GHIHQGHG )ORRG=RQH$DQG)ORRG=RQH%0LQRUDSSOLFDWLRQVIRUUHGHYHORSPHQWDQG RUUHQRYDWLRQVKRXOGDSSO\WKHSULQFLSOHVRXWOLQHGZLWKLQ6HFWLRQDQG 7KHIRFXVLVRQPDQDJLQJWKHSRWHQWLDOUHVLGXDOIORRGULVNVWRWKHGHYHORSPHQW DQGPDLQWDLQLQJVDIHDFFHVVDQGHJUHVV 7KHSRWHQWLDOIRUODUJHVFDOHUHGHYHORSPHQWLVOLPLWHGWRWZRRSSRUWXQLW\VLWHV 2SSRUWXQLW\6LWH 26 LVWKH 0LOO 6WUHHW &DU 3DUN RSSRVLWH WKH &RXQFLO EXLOGLQJV 2SSRUWXQLW\ 6LWH 26 LV ORFDWHG RQ ERWK VLGHV RI WKH 7KRPDV 7UD\QRU5RDGQHDULWVMXQFWLRQZLWKWKH1%RWKVLWHVDUHSDUWLDOO\ZLWKLQ)ORRG =RQH$%DQGWKHLUUHGHYHORSPHQWUHTXLUHVDJUHDWHUOHYHORIDVVHVVPHQWDQG FRQVLGHUDWLRQ $VZKHQVLJQLILFDQWQHZGHYHORSPHQWLVSURSRVHGZLWKLQ26RU26LWVKRXOG EH DFFRPSDQLHG E\ D VLWH VFDOH GHWDLOHG PDQDJHPHQW SODQ DQG )5$ ZKLFK ZRXOG EXLOG XSRQ WKH RXWSXWV RI WKH 6( &)5$0 EXW VKRXOG DOVR LQFOXGH DQ H[DPLQDWLRQ RI KD]DUG YHORFLW\ DQG WLPH RI LQXQGDWLRQ DQG VKRXOG SURSRVH VXLWDEOHPDQDJHPHQWDQGPLWLJDWLRQPHDVXUHVDORQJZLWKDQHPHUJHQF\SODQ LQWKHHYHQWRIGHIHQFHIDLOXUH,WLVSDUWLFXODUO\LPSRUWDQWWKDWWKHFDSDELOLW\RI EOXHOLJKWVHUYLFHVWRPDQDJHWKHDGGLWLRQDOULVNVEHDGGUHVVHG 26LVVXEMHFWWRDJUDGXDOLQFUHDVHLQJUDGLHQWLQDQRUWKHDVWHUO\GLUHFWLRQ WRZDUGV0LOO6WUHHWSRWHQWLDOLQXQGDWLRQGHSWKVJUDGXDWHIURPPRUOHVVWR]HUR DVWKHVLWHPRYHVXSDQGRXWRIWKHIORRGSODLQ,WLVUHFRPPHQGHGWKDW))/VRI DQ\KLJKO\YXOQHUDEOHXVHLVNHSWDERYHWKHGHVLJQIORRGOHYHOSOXVIUHHERDUGRI DWOHDVWPPDQGWKDWHPHUJHQF\DFFHVVLVUHWDLQHGWR)ORRG=RQH&DWWKH 0LOO6WUHHWVLGHRIWKHGHYHORSPHQW 26LVVSOLWHLWKHUVLGHRIWKH7KRPDV7UD\QRU5RDG/DQGVRQWKHULYHUVLGH QRUWK RIWKHURDGDUHORZO\LQJDQGJLYHQWKHSRWHQWLDOIORRGGHSWKV !P RQ WKHVLWHLQDEUHDFKFRQGLWLRQLWLVXQOLNHO\WKDW))/VLQH[FHVVRIEUHDFKOHYHOV ZLOO EH IHDVLEOH $V VXFK WKHVH ODQGV VKRXOG RQO\ EH FRQVLGHUHG IRU OHVV YXOQHUDEOHODQGXVHV/DQGVWRWKHVRXWKRIWKH7KRPDV7UD\QRU5RDGDUHDWD KLJKHUHOHYDWLRQDQGLQFOXGHDUHDVRI)ORRG=RQH&3RWHQWLDOIORRG GHSWKV JUDGHIURPPWR]HURDVWKHVLWHPRYHVXSDQGRXWRIWKHGHIHQGHGIORRGSODLQ 7KHODQGVDUHVXLWDEOHIRUKLJKO\RUOHVVYXOQHUDEOHXVHDQGFRQVLGHUDWLRQFDQ DOVREHJLYHQWRHQVXULQJ))/VDUHDERYHSRWHQWLDOEUHDFKOHYHOV$Q\)5$IRU WKLV VLWH PXVW LQYHVWLJDWH WKH LVVXH RI WKH VWDQGDUG RI SURWHFWLRQ DW WKH GRZQVWUHDP ZHVWHUQ EULGJH SDUDSHW DV GLVFXVVHG LQ 6HFWLRQ ,W ZLOO EH QHFHVVDU\WROLDLVHZLWK&DUORZ&RXQW\&RXQFLOWRHQVXUHWKDWWKHSURWHFWLRQLV IXQFWLRQLQJDVGHVLJQHG 5HIHUWR6HFWLRQDQGIRUIXUWKHUJXLGDQFHIRUWKHRSSRUWXQLW\VLWHVDQG WKHUHTXLUHPHQWVIRUIXUWKHUDVVHVVPHQWDQG))/V *LYHQ WKH UHVWULFWHG IXQFWLRQ RI WKH VXUIDFH ZDWHU GUDLQDJH GXULQJ KLJK ULYHU OHYHOVWKHFRQVLGHUDWLRQRIVXUIDFHZDWHUGUDLQDJHVKRXOGEHJLYHQDSSURSULDWH FRQVLGHUDWLRQDWGHVLJQVWDJH7KLVLVPRVWUHOHYDQWWRWKHRSSRUWXQLW\VLWHVDQG JXLGDQFHLVSURYLGHGZLWKLQ6HFWLRQ )RUDQ\UHGHYHORSPHQWRIH[LVWLQJUHVLGHQWLDOODQGVORFDWHGWRWKHQRUWKZHVWRI WKHWRZQFHQWUHDQDSSURSULDWHO\GHWDLOHG)5$ZLOOEHUHTXLUHGLQOLQHZLWKWKH FRQVLGHUDWLRQVVWLSXODWHGZLWKLQ6HFWLRQ % ([LVWLQJ 7RSURWHFWDQGLPSURYHH[LVWLQJUHVLGHQWLDODPHQLW\ WRSURYLGHIRU 5HVLGHQWLDO,QILOO DSSURSULDWHLQILOOUHVLGHQWLDOGHYHORSPHQW WRSURYLGHIRUQHZDQGLPSURYHG DQFLOODU\VHUYLFHV 7KLV]RQLQJSULQFLSDOO\FRYHUVH[LVWLQJUHVLGHQWLDODUHDV7KH]RQLQJSURYLGHVIRU LQILOOGHYHORSPHQWZLWKLQWKHVHH[LVWLQJUHVLGHQWLDODUHDV7KHSULPDU\DLPVRIWKLV Tullow Draft LAP 2016-2022 - 106 - ]RQLQJREMHFWLYHDUHWRSUHVHUYHDQGLPSURYHUHVLGHQWLDODPHQLW\DQGWRSURYLGHIRU IXUWKHULQILOOUHVLGHQWLDOGHYHORSPHQWDWDGHQVLW\WKDWLVFRQVLGHUHGVXLWDEOHWRWKH DUHDDQGWRWKHQHHGVRIWKHSRSXODWLRQ6XFKDUHDVSDUWLFXODUO\ZKHUHERUGHULQJ WKHFRPPHUFLDOFHQWUHZLOOEHSURWHFWHGIURPWKHSUHVVXUHRIGHYHORSPHQWRIKLJKHU RUGHUXVHVVXFKDVUHWDLODQGRIILFHV Flood Risk Requirements x )XWXUHDSSOLFDWLRQVIRUUHGHYHORSPHQWRQDQ\UHVLGHQWLDOVLWHVRQRU DGMDFHQWWR)ORRG=RQH$%ZLOOUHTXLUHDQ)5$DWGHYHORSPHQW PDQDJHPHQWVWDJHLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWVVWDWHGXQGHU 6HFWLRQRIWKLV6)5$ x 7KHWZRPLQRUZDWHUFRXUVHVIORZLQJLQWRWKH6ODQH\DUHWKH0RXQW :ROVHOH\DQG7XOORZSKHOLP6WUHDPV7KHZDWHUFRXUVHVKDYHEHHQ PRGHOOHGXQGHUWKH&)5$0DQGGRQRWLQGLFDWHDQ\VLJQLILFDQWULVNWR DGMDFHQWODQGV([LVWLQJUHVLGHQWLDO]RQLQJDGMDFHQWWRWKH0RXQW :ROVHOH\DQG7XOORZSKHOLP6WUHDPVVKDOOPDLQWDLQDJUHHQFRUULGRU DGMDFHQWWRWKHFKDQQHOWRIDFLOLWDWHPDLQWHQDQFHZD\OHDYHDQGPDLQWDLQ RSHQVSDFH7KHZLGWKRIWKLVPDUJLQFDQEHGLVFXVVHGDQGDJUHHGZLWK &DUORZ&RXQW\&RXQFLO$VXLWDEO\GHWDLOHG)5$VKDOOEHSURYLGHGIRUDQ\ GHYHORSPHQWDGMDFHQWWRWKHVWUHDPVRUQHDUWRDFXOYHUWFURVVLQJ7KH )5$FDQPDQDJHVLWHGHVLJQDWGHYHORSPHQWPDQDJHPHQWVWDJHEXWWKH UHVLGXDOULVNRIFXOYHUWEORFNDJHZLOOQHHGWREHVSHFLILFDOO\LQYHVWLJDWHGLQ DOOFDVHVDQGLWPXVWEHGHWHUPLQHGWKHVLWHGHVLJQFDQPDQDJHWKH SRWHQWLDOUHVLGXDOULVN5HIHUWR6HFWLRQRIWKH6)5$ & 1HZ5HVLGHQWLDO± 7RSURYLGHIRUQHZUHVLGHQWLDOGHYHORSPHQWDQGRWKHUVHUYLFHVLQFLGHQWDOWR 3KDVH UHVLGHQWLDOGHYHORSPHQW :KLOHKRXVLQJLVWKHSULPDU\XVHLQWKLV]RQHUHFUHDWLRQHGXFDWLRQFUqFKH SOD\VFKRROFOLQLFVXUJHU\XVHVVKHOWHUHGKRXVLQJDQGVPDOOFRUQHUVKRSVPD\DOVR EHFRQVLGHUHGVXEMHFWWRWKHSUHVHUYDWLRQRIQHLJKERXULQJUHVLGHQWLDODPHQLW\ 3HUPLVVLRQPD\DOVREHJUDQWHGIRUKRPHEDVHGHFRQRPLFDFWLYLW\ZLWKLQWKLV]RQH VXEMHFWWRWKHSUHVHUYDWLRQRIUHVLGHQWLDODPHQLW\DQGWUDIILFFRQVLGHUDWLRQV Flood Risk Requirements x 7KH0RXQW:ROVHOH\6WUHDPDGMRLQVUHVLGHQWLDO]RQHGODQGV7KH ZDWHUFRXUVHKDVEHHQPRGHOOHGXQGHUWKH&)5$0DQGGRHVQRWLQGLFDWH DQ\VLJQLILFDQWULVNWRDGMDFHQWODQGV([LVWLQJUHVLGHQWLDO]RQLQJDGMDFHQW WRWKH0RXQW:ROVHOH\6WUHDPVKDOOPDLQWDLQDJUHHQFRUULGRUDGMDFHQWWR WKHFKDQQHOWRIDFLOLWDWHPDLQWHQDQFHZD\OHDYHDQGPDLQWDLQRSHQVSDFH 7KHZLGWKRIWKLVPDUJLQFDQEHGLVFXVVHGDQGDJUHHGZLWK&DUORZ &RXQW\&RXQFLO$VXLWDEO\GHWDLOHG)5$VKDOOEHSURYLGHGIRUDQ\ GHYHORSPHQWDGMDFHQWWRWKHVWUHDPVRUQHDUWRDFXOYHUWFURVVLQJ7KH )5$FDQPDQDJHVLWHGHVLJQDWGHYHORSPHQWPDQDJHPHQWVWDJHEXWWKH UHVLGXDOULVNRIFXOYHUWEORFNDJHZLOOQHHGWREHVSHFLILFDOO\LQYHVWLJDWHGLQ DOOFDVHVDQGLWPXVWEHGHWHUPLQHGWKHVLWHGHVLJQFDQPDQDJHWKH SRWHQWLDOUHVLGXDOULVN5HIHUWR6HFWLRQRIWKH6)5$ & 1HZ5HVLGHQWLDO± 7RSURYLGHODQGVIRUIXWXUHUHVLGHQWLDOGHYHORSPHQWDQGRWKHUVHUYLFHV 3KDVH LQFLGHQWDOWRUHVLGHQWLDOGHYHORSPHQWLQOLQHZLWKIXWXUHQDWLRQDODQGUHJLRQDO WDUJHWVRYHUWKHQH[WSODQSHULRGRUSHQGLQJUHYLHZRIVDPH 3KDVHODQGVZLOOQRWLQDQ\ZD\LQIHUDSULRUFRPPLWPHQWRQWKHSDUWRIWKH&RXQFLO UHJDUGLQJIXWXUH]RQLQJXQGHUDQ\IXWXUH/RFDO$UHD3ODQ6XFKDGHFLVLRQZLOOEH FRQVLGHUHGZLWKLQWKHIUDPHZRUNRIQDWLRQDODQGUHJLRQDOSRSXODWLRQWDUJHWV DSSOLFDEOHDWWKDWWLPHDQGWKHSURSHUSODQQLQJDQGVXVWDLQDEOHGHYHORSPHQWRIWKH DUHD Flood Risk Requirements x 7KH0RXQW:ROVHOH\6WUHDPDGMRLQVUHVLGHQWLDO]RQHGODQGV7KH ZDWHUFRXUVHKDVEHHQPRGHOOHGXQGHUWKH&)5$0DQGGRHVQRWLQGLFDWH DQ\VLJQLILFDQWULVNWRDGMDFHQWODQGV([LVWLQJ]RQLQJDGMDFHQWWRWKH 0RXQW:ROVHOH\6WUHDPVKDOOPDLQWDLQDJUHHQFRUULGRUDGMDFHQWWRWKH FKDQQHOWRIDFLOLWDWHPDLQWHQDQFHZD\OHDYHDQGPDLQWDLQRSHQVSDFH 7KHZLGWKRIWKLVPDUJLQFDQEHGLVFXVVHGDQGDJUHHGZLWK&DUORZ &RXQW\&RXQFLO$VXLWDEO\GHWDLOHG)5$VKDOOEHSURYLGHGIRUDQ\ GHYHORSPHQWDGMDFHQWWRWKHVWUHDPVRUQHDUWRDFXOYHUWFURVVLQJ7KH )5$FDQPDQDJHVLWHGHVLJQDWGHYHORSPHQWPDQDJHPHQWVWDJHEXWWKH UHVLGXDOULVNRIFXOYHUWEORFNDJHZLOOQHHGWREHVSHFLILFDOO\LQYHVWLJDWHGLQ Tullow Draft LAP 2016-2022 - 107 - DOOFDVHVDQGLWPXVWEHGHWHUPLQHGWKHVLWHGHVLJQFDQPDQDJHWKH SRWHQWLDOUHVLGXDOULVN5HIHUWR6HFWLRQ(UURU5HIHUHQFHVRXUFHQRW IRXQGRIWKH6)5$ ( &RPPXQLW\ 7RSURYLGHIRUFRPPXQLW\HGXFDWLRQDOIDFLOLWLHVDQGLQVWLWXWLRQDO8VHV 6HUYLFHV (GXFDWLRQDO 7KLV]RQLQJREMHFWLYHSURYLGHVIRUFLYLFUHOLJLRXVFRPPXQLW\DQGHGXFDWLRQDO IDFLOLWLHVLQFOXGLQJKHDOWKFDUHFKLOGFDUHILUHVWDWLRQFRXUWKRXVHVFKRROV FKXUFKHVPHHWLQJKDOOVDQGRWKHUFRPPXQLW\IDFLOLWLHVDQFLOODU\QHLJKERXUKRRG XVHVDQGVHUYLFHV Flood Risk Requirements x 7KH7XOORZSKHOLP6WUHDPDGMRLQVFRPPXQLW\VHUYLFHVDQGHGXFDWLRQDO ]RQHGODQGV7KHZDWHUFRXUVHKDVEHHQPRGHOOHGXQGHUWKH&)5$0DQG GRHVQRWLQGLFDWHDQ\VLJQLILFDQWULVNWRDGMDFHQWODQGV([LVWLQJ]RQLQJ DGMDFHQWWRWKH7XOORZSKHOLP6WUHDPVVKDOOPDLQWDLQDJUHHQFRUULGRU DGMDFHQWWRWKHFKDQQHOWRIDFLOLWDWHPDLQWHQDQFHZD\OHDYHDQGPDLQWDLQ RSHQVSDFH7KHZLGWKRIWKLVPDUJLQFDQEHGLVFXVVHGDQGDJUHHGZLWK &DUORZ&RXQW\&RXQFLO$VXLWDEO\GHWDLOHG)5$VKDOOEHSURYLGHGIRUDQ\ GHYHORSPHQWDGMDFHQWWRWKHVWUHDPVRUQHDUWRDFXOYHUWFURVVLQJ7KH )5$FDQPDQDJHVLWHGHVLJQDWGHYHORSPHQWPDQDJHPHQWVWDJHEXWWKH UHVLGXDOULVNRIFXOYHUWEORFNDJHZLOOQHHGWREHVSHFLILFDOO\LQYHVWLJDWHGLQ DOOFDVHVDQGLWPXVWEHGHWHUPLQHGWKHVLWHGHVLJQFDQPDQDJHWKH SRWHQWLDOUHVLGXDOULVN5HIHUWR6HFWLRQRIWKH6)5$ x $Q\UHGHYHORSPHQWZLWKLQWKHLQVWLWXWLRQDOODQGV QXUVLQJKRPH ZLOO UHTXLUHGHWDLOHG)5$WRHQVXUHDSSURSULDWH))/VGHVLJQDQGDQ\SRWHQWLDO LQWHUDFWLRQZLWKWKHXQGHUFDSDFLW\DJULFXOWXUDOFXOYHUWDJDLQWKLVPXVWEH LQDFFRUGDQFHZLWK6HFWLRQRIWKH6)5$ ) $PHQLW\ 2SHQ 7RSURWHFWDQGSURYLGHIRUUHFUHDWLRQRSHQVSDFHDQGDPHQLW\SURYLVLRQ 6SDFH 7KHDUHDVLQFOXGHGLQWKLV]RQLQJREMHFWLYHFRYHUERWKSULYDWHDQGSXEOLFRSHQ VSDFHDQGDUHGLVSHUVHGWKURXJKRXWWKHWRZQ7KHDLPVRIWKLVODQGXVH]RQLQJ REMHFWLYHLQFOXGH WRSURWHFWLPSURYHDQGSURYLGHIRUUHFUHDWLRQRSHQVSDFHDQG DPHQLW\SURYLVLRQ WRSURWHFWLPSURYHDQGPDLQWDLQSXEOLFRSHQVSDFH WRSUHVHUYH SULYDWHRSHQVSDFHDQGWRSURYLGHUHFUHDWLRQDODQGFRPPXQLW\IDFLOLWLHV7KH &RXQFLOZLOOQRWQRUPDOO\SHUPLWGHYHORSPHQWWKDWZRXOGUHVXOWLQDORVVRIRSHQ VSDFHZLWKLQWKHWRZQH[FHSWZKHUHFRPSHQVDWRU\RSHQVFDSHLVSURYLGHGWR VHUYLFHWKHFRPPXQLW\DIIHFWHGLQDQDSSURSULDWHORFDWLRQ([LVWLQJDJULFXOWXUDOXVHV LQRSHQVSDFHDUHDVZLOOFRQWLQXHWREHSHUPLWWHGDQGUHDVRQDEOHGHYHORSPHQW SURSRVDOVLQUHODWLRQWRWKLVXVHZLOOEHFRQVLGHUHGRQWKHLUPHULWV + ,QGXVWU\ 7RSURYLGHIRULQGXVWULDO'HYHORSPHQWDQGDVVRFLDWHG2IILFH8VH 7KLV]RQLQJSURYLGHVIRULQGXVWULDOGHYHORSPHQW2WKHUXVHVDQFLOODU\RUVLPLODUWR LQGXVWU\ZLOOEHFRQVLGHUHGRQWKHPHULWVRIHDFKSODQQLQJDSSOLFDWLRQDQGPD\EH DFFHSWDEOH 4 (QWHUSULVH 7RIDFLOLWDWHDQDSSURSULDWHPL[RIHPSOR\PHQWXVHVZLWKLQDKLJKTXDOLW\ (PSOR\PHQW ODQGVFDSHGGHYHORSPHQWLQFOXGLQJRIILFHEDVHGLQGXVWU\HQWHUSULVHDQG LQFXEDWRUXQLWVEXVLQHVVVFLHQFHDQGWHFKQRORJ\ 7KHIROORZLQJGHILQLWLRQRIXVHVDUHSURYLGHG x 2IILFH%DVHG,QGXVWU\ :KHUHWKHDFWLYLW\LVFRQFHUQHGSULPDULO\ZLWKSURGXFLQJ DQHQGSURGXFW HJVRIWZDUHGHYHORSPHQWUHVHDUFKDQGGHYHORSPHQW RU SURYLGHVWHOHSKRQHRUZHEEDVHGVHUYLFHV HJWHOHPDUNHWLQJ 2QO\RIILFH GHYHORSPHQWVWRZKLFKWKHSXEOLFGRQRWQRUPDOO\KDYHDFFHVVZLOOEHSHUPLWWHG ZLWKLQWKLV]RQH x (QWHUSULVHDQG,QFXEDWRUXQLWV 6PDOODQGPL[HGVL]HGZRUNVSDFHXQLWVVXLWDEOH IRUVPDOOEXVLQHVVHVDQGVWDUWXSFRPSDQLHV/LPLWHGOLJKWLQGXVWULDOZLOOEH FRQVLGHUHGLQWKHFRQWH[WRIWKHRYHUDOOFDPSXVGHYHORSPHQW Tullow Draft LAP 2016-2022 - 108 - x %XVLQHVV6FLHQFH 7HFKQRORJ\XQLWV +LJKWHFKQRORJ\UHVHDUFKDQG GHYHORSPHQWIDFLOLWLHVFRUSRUDWHLQGXVWULDORIILFHVDQGVXSSRUWVHUYLFHIDFLOLWLHV x 6XSSRUW)DFLOLWLHV :LWKRXWFRPSURPLVLQJSROLF\RIUHVLVWLQJLQDSSURSULDWHO\ ORFDWHGUHWDLODQGOHLVXUHGHYHORSPHQWSURYLVLRQLVPDGHIRUVPDOOVFDOHµZDON WR¶IDFLOLWLHV LHUHVWDXUDQWVDQGZLFKVKRSDQGVSHFLDOLVWVHUYLFHVOLNHFUqFKHV ZKLFKDUHLQWHJUDWHGZLWKHPSOR\PHQWXQLWVDQGDUHRIDQDWXUHDQGVFDOHWR VHUYHWKHQHHGVRIHPSOR\HHVZLWKLQWKLVHPSOR\PHQWDUHD $OOGHYHORSPHQWRQWKHVHODQGVPXVWLQFRUSRUDWHWKHIROORZLQJ x 6XVWDLQDEOHGHVLJQWKURXJKXVHRILQQRYDWLYHVPDUWJUHHQWHFKQRORJLHV x 6XVWDLQDEOHWUDQVSRUWDWLRQZLWKSHGHVWULDQDQGF\FOHOLQNDJHVWRWKHWRZQ FHQWUH x 1RWGHWUDFWIURPWKHH[LVWLQJQDWXUDOODQGVFDSH (QWHUSULVHDQG(PSOR\PHQWODQGVZLOOEHHQFRXUDJHGWRGHYHORSLQDSKDVHG PDQQHUZLWKWKRVHODQGVFORVHUWRWKHWRZQFHQWUHEHLQJGHYHORSHGILUVW 7 ,QWHJUDWHG7RXULVP 7RIDFLOLWDWHWKHSURYLVLRQRIDQLQWHJUDWHGWRXULVPDQGOHLVXUH'HYHORSPHQW DQG/HLVXUH 7KHSXUSRVHRIWKLV]RQLQJLVWRVHHNWKHGHOLYHU\RIDQLQWHJUDWHGWRXULVPDQG OHLVXUHGHYHORSPHQWZKLOHHQVXULQJWKHVXVWDLQDELOLW\DQGJURZWKRIWKH0RXQW :ROVHOH\5HVRUW$SSURSULDWHXVHVLQWKLVDUHDLQFOXGHWRXULVPDFFRPPRGDWLRQ KRWHOJROIHTXHVWULDQDQGOHLVXUHGHYHORSPHQWVDVVRFLDWHGZLWKWKH5LYHU6ODQH\ 2WKHUXVHVZKLFKFRPSOHPHQWWKHRYHUDOO]RQLQJZLOOEHFRQVLGHUHGRQWKHLUPHULWV , $JULFXOWXUDO 7RUHWDLQDQGSURWHFWDJULFXOWXUDOXVHV 7KHSXUSRVHRIWKLV]RQLQJLVWRHQVXUHWKHUHWHQWLRQRIDJULFXOWXUDOXVHVDQGSURWHFW WKHPIURPXUEDQVSUDZODQGULEERQGHYHORSPHQW8VHVZKLFKDUHGLUHFWO\ DVVRFLDWHGZLWKDJULFXOWXUHRUZKLFKZRXOGQRWLQWHUIHUHZLWKWKLVXVHDUHRSHQIRU FRQVLGHUDWLRQ7KLVLQFOXGHVOLPLWHGKRXVLQJIRUPHPEHUVRIODQGRZQHUV¶IDPLOLHVRU SHUVRQVZKRFDQGHPRQVWUDWHDJHQXLQHQHHGWROLYHLQWKHDJULFXOWXUH]RQH WRXULVPUHODWHGSURMHFWVVXFKDVWRXULVWFDUDYDQSDUNVRUFDPSVLWHVDQGDPHQLW\ XVHVVXFKDVSOD\LQJILHOGVRUSDUNV - 8WLOLWLHV 7RIDFLOLWDWHWKHSURYLVLRQRILQIUDVWUXFWXUHDQGXWLOLWLHV 7KLV]RQLQJREMHFWLYHSURYLGHVIRUWKHGHYHORSPHQWRIZDWHUDQGZDVWHZDWHU IDFLOLWLHVDQGRWKHUVXFKXVHVDQGIDFLOLWLHV 7DEOH 6SHFLILF/DQG8VH=RQLQJ2EMHFWLYHV Tullow Draft LAP 2016-2022 - 109 - 12.2 Zoning Matrix x Open for Consideration /DQGXVHVVKRZQDV 2SHQIRU 7KH=RQLQJ0DWUL[ VHH7DEOH &RQVLGHUDWLRQ DUHXVHVWKDWDUHQRW LOOXVWUDWHVDUDQJHRIODQGXVHVWRJHWKHU FRQVLGHUHGDFFHSWDEOHLQSULQFLSOHLQDOO ZLWKDQLQGLFDWLRQRIWKHLUEURDG SDUWVRIWKHUHOHYDQWXVH]RQH+RZHYHU DFFHSWDELOLW\LQHDFKRIWKHODQGXVH VXFKXVHVPD\EHDFFHSWDEOHLQ ]RQHV8VHVRWKHUWKDQWKHSULPDU\XVH FLUFXPVWDQFHVZKHUHWKH&RXQFLOLV IRUZKLFKDQDUHDLV]RQHGPD\EH VDWLVILHGWKDWWKHSURSRVHGXVHZRXOGQRW SHUPLWWHGSURYLGHGWKH\DUHQRWLQFRQIOLFW FRQIOLFWZLWKWKHJHQHUDOREMHFWLYHVIRUWKH ZLWKWKHSULPDU\XVH]RQLQJREMHFWLYH ]RQHDQGWKHSHUPLWWHGRUH[LVWLQJXVHVDV 7KHODQGXVH]RQLQJPDWUL[LVLQWHQGHGWR ZHOODVEHLQJLQWKHLQWHUHVWVRIWKHSURSHU SURYLGHJXLGDQFHWRODQGRZQHUVDQG SODQQLQJDQGVXVWDLQDEOHGHYHORSPHQWRI GHYHORSHUVDQGLVQRWLQWHQGHGWRVXSSODQW WKHDUHD WKHQRUPDOSODQQLQJSURFHVV$Q LQGLFDWLRQWKDWDSURSRVDOZRXOGEH x Not Permitted µSHUPLWWHGLQSULQFLSOH¶IURPWKHPDWUL[ /DQGXVHVZKLFKDUHLQGLFDWHGDV 1RW VKRXOGQRWEHWDNHQWRLPSO\DJUDQWLQJRI 3HUPLWWHG LQWKH/DQG8VH=RQLQJ0DWUL[ SHUPLVVLRQRULQGHHGWKDWDSODQQLQJ 7DEOH ZLOOQRWEHSHUPLWWHG DSSOLFDWLRQPD\QHFHVVDULO\EHVXFFHVVIXO x Other Uses 12.2.1 Application of Zoning 3URSRVHGODQGXVHVQRWOLVWHGLQWKH Policy PDWULFHVZLOOEHFRQVLGHUHGRQWKHPHULWV RIWKHLQGLYLGXDOSODQQLQJDSSOLFDWLRQZLWK ,WLVDQREMHFWLYHRIWKH&RXQFLOWRFDUU\RXW UHIHUHQFHWRWKHPRVWDSSURSULDWHXVHRID LWVGHYHORSPHQWFRQWUROIXQFWLRQLQ VLPLODUQDWXUHLQGLFDWHGLQWKHWDEOHDQGLQ DFFRUGDQFHZLWKWKH0DWUL[7DEOHIRUHDFK UHODWLRQWRWKHJHQHUDOSROLFLHVDQG]RQLQJ ]RQH+RZHYHULWVKRXOGQRWEHDVVXPHG REMHFWLYHVIRUWKHDUHDLQTXHVWLRQRIWKH WKDWLIDSURSRVHGGHYHORSPHQWFRPSOLHV 3ODQ ZLWKWKH0DWUL[7DEOHLWZRXOGQHFHVVDULO\ EHDFFHSWHG7KHPDWUL[UHODWHVWRODQG x Non-Conforming Uses XVHRQO\2WKHUIDFWRUVLQFOXGLQJGHQVLW\ ([LVWLQJHVWDEOLVKHGXVHVWKDWDUH EXLOGLQJKHLJKWGHVLJQVWDQGDUGVWUDIILF LQFRQVLVWHQWZLWKWKHSULPDU\]RQLQJ JHQHUDWLRQHQYLURQPHQWDOIDFWRUVDQGVR REMHFWLYHZKHUHOHJDOO\HVWDEOLVKHGE\ RQDUHDOVRUHOHYDQWLQHVWDEOLVKLQJ FRQWLQXRXVXVHIRUWKHVDPHSXUSRVHSULRU ZKHWKHURUQRWDGHYHORSPHQWSURSRVDO WRVW2FWREHU RUE\DSODQQLQJ ZRXOGEHDFFHSWDEOHLQDSDUWLFXODU SHUPLVVLRQZLOOQRWEHVXEMHFWWROHJDO ORFDWLRQDQGFRQIRUPVWRWKHSURSHU SURFHHGLQJVXQGHUWKH$FWLQUHVSHFWRI SODQQLQJDQGVXVWDLQDEOHGHYHORSPHQWRI WKHLUFRQWLQXHGXVH:KHUHH[WHQVLRQVRU WKHWRZQ LPSURYHPHQWVRISUHPLVHV DFFRPPRGDWLQJWKHVHXVHVDUHSURSRVHG HDFKVKDOOEHFRQVLGHUHGRQLWVPHULWVLQ 12.2.2 Definition of Terms DFFRUGDQFHZLWKWKHSURSHUSODQQLQJDQG VXVWDLQDEOHGHYHORSPHQWRIWKHDUHD x Permitted in Principle x Transitional Areas 7KH&RXQFLOZLOOVHHNWRHQVXUHWKH :KLOHWKH]RQLQJREMHFWLYHVLQGLFDWHWKH GHYHORSPHQWRIODQGVDQGSURSHUWLHVLQ GLIIHUHQWXVHVSHUPLWWHGLQHDFK]RQHLWLV DFFRUGDQFHZLWKWKH=RQLQJ2EMHFWLYHVVHW LPSRUWDQWWRDYRLGDEUXSWWUDQVLWLRQVLQ RXWLQWKLVVHFWLRQRIWKHSODQ/DQGXVHV VFDOHDQGXVHDWWKHERXQGDU\RIDGMRLQLQJ GHVLJQDWHGXQGHUHDFK]RQLQJREMHFWLYH ODQGXVH]RQHV,QWKHVHDUHDVLWLV DV 3HUPLWWHGLQ3ULQFLSOH DUHJHQHUDOO\ QHFHVVDU\WRDYRLGGHYHORSPHQWVWKDW DFFHSWDEOHVXEMHFWWRFRPSOLDQFHZLWKWKH ZRXOGEHGHWULPHQWDOWRDPHQLW\,Q]RQHV SURYLVLRQVRIWKLV/RFDO$UHD3ODQDQGWKH DEXWWLQJUHVLGHQWLDODUHDVSDUWLFXODU SROLFLHVDQGREMHFWLYHVRIWKH&DUORZ DWWHQWLRQZLOOEHSDLGWRWKHXVHVVFDOH &RXQW\'HYHORSPHQW3ODQ GHQVLW\DQGDSSHDUDQFHRIGHYHORSPHQW SURSRVDOVDQGWRODQGVFDSLQJFUHDWLRQRI DEXIIHU]RQHDQGVFUHHQLQJSURSRVDOVLQ RUGHUWRSURWHFWWKHDPHQLWLHVRIUHVLGHQWLDO Tullow Draft LAP 2016-2022 - 110 - SURSHUWLHV'HYHORSPHQWDEXWWLQJDPHQLW\ DQGRSHQVSDFHZLOOJHQHUDOO\IDFLOLWDWHWKH SDVVLYHVXSHUYLVLRQRIWKDWVSDFHZKHUH SRVVLEOHE\IURQWLQJRQWRLW Tullow Draft LAP 2016-2022 - 111 - Tullow Draft LAP 2016-2022 - 112 - &RPPXQLW\ ,QWHJUDWHG 7RZQ ([LVWLQJ 1HZ 1HZ $PHQLW\ (QWHUSULVH 6HUYLFHV ,QGXVWU\DQG 7RXULVP &HQWUH 5HVLGHQWLDO 5HVLGHQWLDO 5HVLGHQWLDO 2SHQ DQG $JULFXOWXUH 8WLOLWLHV /DQGXVH DQG :DUHKRXVLQJ DQG $FWLYLWLHV ,QILOO 3KDVH 3KDVH 6SDFH (PSOR\PHQW , - (GXFDWLRQ + /HLVXUH $ % & & ) 4 ( 7 'ZHOOLQJ < < < 2 1 1 1 1 2 2 1 *XHVWKRXVH < 2 2 2 1 1 1 1 < 1 1 KRWHOKRVWHO 5HVWDXUDQW < 2 2 2 1 1 1 2 < 1 1 3XE < 1 1 1 1 1 1 2 2 1 1 6KRS < 2 2 2 1 1 1 2 1 1 1 FRQYHQLHQFH 6KRS < 1 1 1 1 1 1 1 2 1 1 FRPSDULVRQ 5HWDLOZDUHKRXVH 1 1 1 1 1 1 1 1 1 1 1 6FKRRO < 2 2 2 < 2 1 2 1 1 1 0HGLFDODQG < 2 2 2 < 1 1 < 1 1 1 5HODWHG &RQVXOWDQW +HDOWK&HQWUH < 2 2 2 < 1 1 < 1 1 1 1XUVLQJ+RPH < 2 2 2 < 1 1 1 1 1 1 &RPPXQLW\KDOO < 2 2 2 < 2 1 2 2 2 1 VSRUWVKDOOV 5HFUHDWLRQDO < 2 2 2 < 2 1 2 < 2 1 EXLOGLQJV &XOWXUDOXVHV < 2 2 2 < 2 1 2 < 1 1 OLEUDU\ 2IILFHV < 1 1 1 1 1 < < 2 1 1 /LYHZRUN8QLW < 2 2 2 1 1 1 1 1 1 1 *DUDJHVSDQHO 2 1 1 1 1 1 < 2 1 1 < EHDWLQJDQGFDU UHSDLUV 3HWUROVWDWLRQ 2 1 1 1 1 1 2 < 1 2 < 0RWRUVDOHV 2 1 1 1 1 1 2 < 1 1 < &DUSDUNV < 1 1 1 2 2 < < 2 1 < +HDY\FRPPHUFLDO 1 1 1 1 1 1 2 2 1 1 < YHKLFOHSDUNV &LQHPD < 1 1 1 2 1 1 2 2 1 1 GDQFHKDOOGLVFR 5HSRVLWRU\VWRUH 2 1 1 1 1 1 2 2 1 1 2 GHSRW ,QGXVWU\ 1 1 1 1 1 1 < 1 1 1 2 Tullow Draft LAP 2016-2022 - 113 - ,QGXVWU\ OLJKW 2 1 1 1 1 1 < 2 2 1 2 :RUNVKRSV 2 1 1 1 1 1 < 2 2 2 < 3OD\LQJILHOGV 2 2 2 2 < < 1 2 < < 1 3ODFHRIZRUVKLS < 2 2 2 < 1 1 2 2 1 1 3DUNSOD\JURXQG < 2 < < < < 1 2 < < 1 7RXULVWUHODWHG < 2 2 2 1 2 1 2 < 2 1 IDFLOLWLHV &DWWOHVKHGVODWWHG 1 1 1 1 1 1 1 1 1 < 1 XQLW %URLOHUKRXVH 1 1 1 1 1 1 1 1 1 < 1 6WDEOH\DUG 1 1 1 1 1 1 1 1 < < 1 +RWIRRGWDNH 2 1 1 1 1 1 1 < 2 1 1 DZD\ 8WLOLW\6WUXFWXUHV < 2 2 2 < 2 2 2 2 < < )XQHUDO+RPHV < 1 1 1 < 1 1 2 1 1 1 &UHFKHSOD\VFKRRO < 2 < < < 2 1 2 < 2 1 $GXOW(GXFDWLRQ < 2 2 2 < 2 1 < < 2 1 OLWHUDF\EDVLF HGXFDWLRQ\RXWK UHDFKIDFLOLW\ 1HLJKERXUKRRG < < 1 1 1 1 1 1 1 1 1 &HQWUH 7KHUPDO 1 1 1 1 1 1 1 1 1 1 1 7UHDWPHQW3ODQW < SHUPLWWHGLQSULQFLSOH 2 RSHQIRUFRQVLGHUDWLRQ 1 QRWSHUPLWWHG 5HVLGHQWLDO]RQLQJWREHFRQVLGHUHGEH\RQGSHULRGRIWKLV/$3LQDFFRUGDQFHZLWK&RUH6WUDWHJ\WKHQSHUWDLQLQJ5HVLGHQWLDO6FKHPHVZLOOQRWEHSHUPLWWHG$VLQJOHUHVLGHQWLDOGZHOOLQJPD\EH FRQVLGHUHGRQLWVPHULWVLQDFFRUGDQFHZLWKWKHFRUHVWUDWHJ\DQGWKHSURSHUSODQQLQJDQGVXVWDLQDEOHGHYHORSPHQWRIWKHDUHD 7DEOH /DQG8VH=RQLQJ0DWUL[7REHUHDGLQFRQMXQFWLRQZLWK0DS Tullow Draft LAP 2016-2022 - 114 - 0DS 7XOORZ/DQG8VH=RQLQJ0DS Tullow Draft LAP 2016-2022 - 115 - Tullow Draft LAP 2016-2022 - 116 - 0DS /DQG8VH=RQLQJ0DSVKRZLQJ6$&ERXQGDU\ Tullow Draft LAP 2016-2022 - 117 - Tullow Draft LAP 2016-2022 - 118 - Tullow Draft Local Area Plan 2016-2022 APPENDICES SEA ENVIRONMENTAL REPORT FOR THE DRAFT TULLOW LOCAL AREA PLAN 2016-2022 for: Carlow County Council Athy Road Carlow County Carlow by: CAAS Ltd. 2nd Floor, The Courtyard 25 Great Strand Street Dublin 1 JULY 2016 Includes Ordnance Survey Ireland data reproduced under OSi Licence Number 2014/21/CCMA/CarlowCountyCouncil. Unauthorised Reproduction infringes Ordnance Survey Ireland and Government of Ireland Copyright. © Ordnance Survey Ireland SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Table of Contents List of Abbreviations ...... vi Glossary ...... vii Section 1 SEA Introduction and Background ...... 1 1.1 Introduction and Terms of Reference...... 1 1.2 SEA Definition ...... 1 1.3 SEA Directive and its transposition into Irish Law ...... 1 1.4 Implications for the Local Area Plan and the Planning Authority ...... 2 Section 2 The Local Area Plan ...... 3 2.1 Plan Format ...... 3 2.2 Statutory Context ...... 3 2.3 Vision for Tullow ...... 3 2.4 Strategic Objectives for Tullow...... 3 2.5 Relationship with other relevant Plans and Programmes ...... 3 Section 3 SEA Methodology ...... 5 3.1 Introduction to the Iterative Approach ...... 5 3.2 Appropriate Assessment and Integrated Biodiversity Impact Assessment ...... 6 3.3 Strategic Flood Risk Assessment ...... 6 3.4 Requirement for SEA ...... 6 3.5 Scoping ...... 6 3.6 Environmental Baseline Data ...... 7 3.7 Alternatives ...... 7 3.8 The SEA Environmental Report ...... 7 3.9 The SEA Statement ...... 8 3.10 Difficulties Encountered ...... 8 Section 4 Environmental Baseline ...... 10 4.1 Introduction...... 10 4.2 Biodiversity and Flora and Fauna...... 11 4.3 Population and Human Health ...... 17 4.4 Soil ...... 17 4.5 Water ...... 19 4.6 Air and Climatic Factors ...... 29 4.7 Material Assets ...... 31 4.8 Cultural Heritage ...... 32 4.9 Landscape ...... 37 4.10 Overlay of Environmental Sensitivities...... 41 Section 5 Strategic Environmental Objectives ...... 43 Section 6 Alternative Development Strategies ...... 46 Section 7 Evaluation of Alternatives ...... 51 7.1 Methodology ...... 51 CAAS for Carlow County Council ii SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 7.2 Cumulative Effects...... 53 7.3 Potentially Significant Adverse Effects ...... 55 7.4 Comparative Evaluation of all Alternative Development Strategies ...... 56 7.5 The Selected Alternative Development Strategy for the Draft Plan ...... 59 Section 8 Evaluation of Plan Provisions ...... 61 8.1 Overall Findings ...... 61 8.2 Methodology ...... 61 8.3 Appropriate Assessment and Strategic Flood Risk Assessment ...... 62 8.4 Potential Adverse Effects and their Determination...... 63 8.5 Interrelationship between Environmental Components ...... 64 8.6 Cumulative Effects...... 66 8.7 Residual Adverse Effects ...... 66 8.8 Detailed Evaluation ...... 67 Section 9 Mitigation Measures ...... 93 9.1 Introduction...... 93 9.2 Integration of Environmental Considerations ...... 93 Section 10 Monitoring Measures ...... 100 10.1 Introduction...... 100 10.2 Indicators and Targets ...... 100 10.3 Sources ...... 100 10.4 Reporting ...... 100 10.5 Thresholds ...... 100 Appendix I Relationship with Legislation and Other Plans and Programmes .... 103 Appendix II Non-Technical Summary..…………………………………Separately bound CAAS for Carlow County Council iii SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 List of Figures Figure 3.1 Tullow Local Area Plan and SEA, AA and SFRA Stages ...... 5 Figure 4.1 cSACs and SPAs in the vicinity of the Plan area ...... 13 Figure 4.2 River Slaney Valley cSAC ...... 14 Figure 4.3 NHAs and pNHAs in the vicinity of the Plan area ...... 15 Figure 4.4 CORINE Land Cover Data 2012 ...... 16 Figure 4.5 Soil Type ...... 18 Figure 4.6 WFD Surface Water Status ...... 23 Figure 4.7 Q-Values at Points on Rivers post 2004 ...... 24 Figure 4.8 WFD Status of Groundwater ...... 25 Figure 4.9 Aquifer Vulnerability ...... 26 Figure 4.10 Entries to the RPAs ...... 27 Figure 4.11 Flood Zones ...... 28 Figure 4.12 Archaeological Heritage - Entries to the Record of Monuments and Places and Zones of Notification ...... 35 Figure 4.13 Architectural Heritage - Entries to the RPS and NIAH ...... 36 Figure 4.14 Landscape Character Areas ...... 39 Figure 4.15 Landscape Sensitivity ...... 40 Figure 4.16 Overlay of Environmental Sensitivities ...... 42 Figure 6.1 Alternative Development Strategy 1 ...... 48 Figure 6.2 Alternative Development Strategy 2 ...... 49 Figure 6.3 Alternative Development Strategy 3 ...... 50 Figure 7.1 The Draft Plan Land Use Zoning Map ...... 60 CAAS for Carlow County Council iv SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 List of Tables Table 3.1 Checklist of Information included in this Environmental Report ...... 9 Table 4.1 Natura 2000 sites within 15km of the Plan area...... 11 Table 4.2 pNHAs within 15km of the Plan area ...... 11 Table 4.3 Overall Vulnerability Classes ...... 41 Table 5.1 Strategic Environmental Objectives, Indicators and Targets ...... 44 Table 6.1 Description of Alternative Development Strategies ...... 47 Table 7.1 Strategic Environmental Objectives ...... 52 Table 7.2 Criteria for appraising the effect on SEOs ...... 52 Table 7.3 Potentially Significant Adverse Environmental Effects common to all alternatives ...... 55 Table 7.4 Comparative Evaluation of Alternative Development Strategies ...... 58 Table 8.1 Criteria for appraising the effect of Plan provisions on SEOs ...... 62 Table 8.2 Strategic Environmental Objectives ...... 62 Table 8.3 Potential Adverse Effects ...... 63 Table 8.4 Presence of Interrelationships between Environmental Components ...... 65 Table 8.5 Residual Adverse Effects ...... 66 Table 9.1 Integration of Environmental Considerations ...... 94 Table 10.1 Selected Indicators, Targets and Monitoring Sources ...... 101 CAAS for Carlow County Council v SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 List of Abbreviations AA Appropriate Assessment CSO Central Statistics Office DAHG Department of Arts, Heritage and the Gaeltacht DCENR Department of Communications, Energy and Natural Resources DEHLG Department of the Environment, Heritage and Local Government DECLG Department of the Environment, Community and Local Government EIA Environmental Impact Assessment EPA Environmental Protection Agency EU European Union GSI Geological Survey of Ireland NHA Natural Heritage Area NIAH National Inventory of Architectural Heritage RBD River Basin District RMP Record of Monuments and Places RPS Record of Protected Structures RPGs Regional Planning Guidelines SAC Special Area of Conservation SEA Strategic Environmental Assessment SEO Strategic Environmental Objective SI No. Statutory Instrument Number SPA Special Protection Area WFD Water Framework Directive CAAS for Carlow County Council vi SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Glossary Appropriate Assessment The obligation to undertake Appropriate Assessment derives from Article 6(3) and 6(4) of the Habitats Directive 92/43/EEC. AA is a focused and detailed impact assessment of the implications of a strategic action or project, alone and in combination with other strategic actions and projects, on the integrity of a Natura 2000 site in view of its conservation objectives. Biodiversity and Flora and Fauna Biodiversity is the variability among living organisms from all sources including inter alia, terrestrial, marine and other aquatic ecosystems and the ecological complexes of which they are a part; this includes diversity within species, between species and of ecosystems’ (United Nations Convention on Biological Diversity 1992). Flora is all of the plants found in a given area. Fauna is all of the animals found in a given area. Biotic Index Values (Q Values) The Biotic Index Values, or Q values, are assigned to rivers in accordance with biological monitoring of surface waters - low Q ratings, as low as Q1, are indicative of low biodiversity and polluted waters, and high Q ratings, as high as Q5, are indicative of high biodiversity and unpolluted waters. Good status as defined by the Water Framework Directive equates to approximately Q4 in the national scheme of biological classification of rivers as set out by the Environmental Protection Agency. Environmental Problems Annex I of Directive 2001/42/EC of the European Parliament and of the Council of Ministers, of 27th June 2001, on the assessment of the effects of certain Plans and programmes on the environment (the Strategic Environmental Assessment Directive) requires that information is provided on ‘any existing environmental problems which are relevant to the plan or programme’, thus, helping to ensure that the proposed strategic action does not make existing environmental problems worse. Environmental problems arise where there is a conflict between current environmental conditions and ideal targets. If environmental problems are identified at the outset they can help focus attention on important issues and geographical areas where environmental effects of the plan or programme may be likely. Environmental Vectors Environmental vectors are environmental components, such as air, water or soil, through which contaminants or pollutants, which have the potential to cause harm, can be transported so that they come into contact with human beings. Mitigate To make or become less severe or harsh. CAAS for Carlow County Council vii SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Mitigation Measures Mitigation measures are measures envisaged to prevent, reduce and, as fully as possible, offset any significant adverse impacts on the environment of implementing a human action, be it a plan, programme or project. Mitigation involves ameliorating significant negative effects. Where there are significant negative effects, consideration should be given in the first instance to preventing such effects or, where this is not possible, to lessening or offsetting those effects. Mitigation measures can be roughly divided into those that: avoid effects; reduce the magnitude or extent, probability and/or severity of effects; repair effects after they have occurred; and compensate for effects, balancing out negative impacts with other positive ones. Protected Structure Protected Structure is the term used in the Planning and Development Act 2000 as amended to define a structure included by a planning authority in its Record of Protected Structures. Such a structure shall not be altered or demolished in whole or part without obtaining planning permission or confirmation from the planning authority that the part of the structure to be altered is not protected. Recorded Monument A monument included in the list and marked on the map that comprises the Record of Monuments and Places that is set out County by County under Section 12 of the National Monuments (Amendment) Act, 1994 by the Archaeological Survey of Ireland. The definition includes Zones of Archaeological Potential in towns and all other monuments of archaeological interest, which have so far been identified. Any works at or in relation to a recorded monument requires two months’ notice to the former Department of the Environment, Heritage and Local Government (now Department of Arts, Heritage and the Gaeltacht) under section 12 of the National Monuments (Amendment) Act, 1994. Scoping Scoping is the process of determining what issues are to be addressed, and setting out a methodology in which to address them in a structured manner appropriate to the plan or programme. Scoping is carried out in consultation with appropriate environmental authorities. Strategic Actions Strategic actions include: Policies/Strategies, which may be considered as inspiration and guidance for action and which set the framework for Plans and programmes; Plans, sets of co- ordinated and timed objectives for the implementation of the policy; and Programmes, sets of projects in a particular area. Strategic Environmental Assessment (SEA) Strategic Environmental Assessment (SEA) is the formal, systematic evaluation of the likely significant environmental effects of implementing a plan or programme before a decision is made to adopt it. Strategic Environmental Objective (SEO) Strategic Environmental Objectives (SEOs) are methodological measures developed from policies which generally govern environmental protection objectives established at international, Community or Member State level and are used as standards against which the provisions of the Plan and the alternatives can be evaluated in order to help identify which provisions would be likely to result in significant environmental effects and where such effects would be likely to occur, if - in the case of adverse effects - unmitigated. CAAS for Carlow County Council viii SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 1 SEA Introduction and Background 1.1 Introduction and Environment, referred to hereafter as the SEA Directive, introduced the requirement that SEA Terms of Reference be carried out on plans and programmes which are prepared for a number of sectors, including This is the Strategic Environmental Assessment land use planning. (SEA) Environmental Report for the Tullow Local Area Plan 2016-2022. It has been The SEA Directive was transposed into Irish undertaken by CAAS Ltd. on behalf of Carlow Law through the European Communities County Council. (Environmental Assessment of Certain Plans and Programmes) Regulations 2004 (Statutory The purpose of this report is to provide a clear Instrument Number (SI No. 435 of 2004) and understanding of the likely environmental the Planning and Development (Strategic consequences of decisions regarding the Environmental Assessment) Regulations 2004 adoption and implementation of the Plan. The (SI No. 436 of 2004). Both sets of Regulations SEA is carried out in order to comply with the became operational on 21st July 2004. The provisions of the Planning and Development Regulations have been amended by the (Strategic Environmental Assessment) European Communities (Environmental Regulations 2004 (SI No. 436 of 2004) as Assessment of Certain Plans and Programmes) amended. This report should be read in (Amendment) Regulations 2011 (SI No. 200 of conjunction with the Local Area Plan. 2011) and the Planning and Development (Strategic Environmental Assessment) (Amendment) Regulations 2011 (SI No. 201 of 1.2 SEA Definition 2011). Environmental assessment is a procedure that ensures that the environmental implications of decisions are taken into account before such decisions are made. Environmental Impact Assessment, or EIA, is generally used for describing the process of environmental assessment for individual projects, while Strategic Environmental Assessment, or SEA, is the term that has been given to the environmental assessment of plans and programmes, which help determine the nature and location of individual projects taking place. SEA is a systematic process of predicting and evaluating the likely significant environmental effects of implementing a proposed plan or programme in order to ensure that these effects are adequately addressed at the earliest appropriate stages of decision-making in tandem with economic, social and other considerations. 1.3 SEA Directive and its transposition into Irish Law Directive 2001/42/EC of the European Parliament and of the Council of Ministers, of 27th June 2001, on the Assessment of the Effects of Certain Plans and Programmes on the CAAS for Carlow County Council 1 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 1.4 Implications for the Local Area Plan and the Planning Authority Having considered the review and preparation of the Tullow Local Area Plan under Article 8 (14A) of the Planning and Development (SEA) Regulations (as amended), Carlow County Council, based on available information on both the expected content of the draft Plan and the existing environment, determined that the Plan would be likely, if unmitigated, to have significant effects on the environment1. Furthermore, a Stage 2 Appropriate Assessment (AA) under the Habitats Directive is being undertaken on the LAP. The SEA Directive requires that SEA is undertaken where Stage 2 AA is being undertaken on plans, programmes or variations to these. It therefore was determined SEA is required to be undertaken on the Draft Plan. The findings of the SEA are expressed in the Environmental Report. This report will be altered to take account of both: recommendations contained in submissions; and changes that may be made to the Draft Plan on foot of submissions. Elected Members of Carlow County Council must take into account the findings of this report and other related SEA output during their consideration of the Draft Plan and before its adoption. An SEA Statement summarising how environmental considerations have been integrated into the Plan will be prepared at the end of the process. 1 It was identified as mitigation needed to be the Department of Arts, Heritage and the Gaeltacht integrated into the LAP in order to ensure the as part of the Plan preparation process that protection of the Slaney River Valley candidate highlights the need to consider the protection of Special Area of Conservation (Site Code 000781). ecological sensitivities - including cSACs and This cSAC is designated for a number of species, protected species. Other issues for the Plan include including freshwater pearl mussel, which are highly those relating to wastewater treatment capacity and protected and sensitive. A submission was made by performance, water quality and flood risk. CAAS for Carlow County Council 2 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 2 The Local Area Plan To provide a focused approach to planning for 2.1 Plan Format the future growth of Tullow in a coherent and spatial fashion which seeks to deliver high The Local Area Plan (LAP) for Tullow consists of levels of employment and balances future a Written Statement and a land use-zoning sustainable development with the conservation map. It comprises of 12 Chapters: and enhancement of the town’s natural and built environment. x Chapters 1-3 outlines the context of the LAP review the historical development of Tullow, the existing profile of the 2.4 Strategic Objectives town together with the vision and for Tullow strategic objectives for the future development of the area. The main Strategic Objectives for the town are as follows: x Chapters 4-11 address key development objectives including 1. To create vibrant integrated economic development, housing, communities in a more consolidated infrastructure, community facilities, urban form. natural and built heritage, tourism, 2. To create a thriving town which town centre and public realm contributes to the natural and built principles. heritage amenities of the town and provides a vibrant and vital mixed-use x Chapter 12 addresses land use zoning environment. objectives. 3. To facilitate the creation of a sustainable vibrant economy which 2.2 Statutory Context maximises the unique attributes of the town. The LAP has been prepared in accordance with The Council is committed to delivering this Sections 18 to 20 of the Planning and vision of the town through working in Development Act 2000, as amended. The Plan partnership with the local community and local replaces the Tullow LAP 2010-2016. organisations, and through promoting the policies and objectives contained in the LAP, LAPs are required to be consistent with the and future LAPs. policies and objectives of the County Development Plan and its Core Strategy, as well as the Regional Planning Guidelines that apply 2.5 Relationship with to the area of the Plan. other relevant Plans The LAP should be read in conjunction with the and Programmes Carlow County Development Plan 2015-2021, which sets out the overarching development 2.5.1 Introduction strategy for the County. The Plan sits within a hierarchy of strategic Whereby any provisions of the LAP conflict with actions such as plans and programmes and is the provisions of the County Development Plan, subject to a number of high-level environmental the provisions of the LAP shall cease to have protection policies and objectives with which it effect. must comply (including those detailed below and in Appendix I, Section 4, Section 5 and 2.3 Vision for Tullow Section 9 of this report). Carlow County Council’s Vision for the town is The Plan may, in turn, guide lower level as follows: strategic actions. In this regard, Appendix I includes statutory provisions, plans, policies and strategies that set the context within which CAAS for Carlow County Council 3 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 the Plan is framed and which have influenced 2.5.3 Carlow County the strategies and objectives of the Plan. Development Plan 2015- 2.5.2 Regional Planning 2021 Guidelines for the South- The Carlow County Development Plan 2015- East Region 2010-2022 2021 sets out the strategic planning and sustainable development of County Carlow over Ireland was divided into eight regional forward its lifetime and is consistent with the Regional planning regions, Dublin, Midlands, Mid East, Planning Guidelines. Mid-West, South East, South West, West and Border, each with its own regional planning 2.5.4 River Basin Management authority composed of Elected Members selected by the constituent local government Plans councils. Regional planning authorities were required, under the Planning and Development Local Authorities, including Carlow County (Regional Planning Guidelines) Regulations Council, have prepared the South East River 2003 (SI No. 175 of 2003), to draw up Regional Basin Management Plan that is implemented in Planning Guidelines (RPGs), long term strategic order to help protect and improve waters in the planning frameworks, for their relevant region. town and wider River Basin District. The Plan Since 2015, three new regional assemblies (the and associated Programme of Measures Northern and Western, Southern and Eastern includes provisions to help ensure that water and Midland Regional Assemblies) undertake bodies in the districts meet the objectives of the the work previously undertaken by the Regional Water Framework Directive. Authorities, including the implementation of the Regional Planning Guidelines. Carlow County 2.5.5 Catchment Flood Risk Council was part of the South-East Regional Assessment and Authority and is now part of the Southern Management Studies Regional Assembly. Catchment Flood Risk Assessment and County Carlow, including Tullow, is subject to Management (CFRAM) Studies are being the Regional Planning Guidelines for the South undertaken for the South Eastern River Basin Eastern Region 2010-2022 that provide a District by the Office of Public Works. framework for the long-term strategic development of the South-Eastern Region. The The study is focusing on areas known to have Guidelines do this through setting out goals, experienced flooding in the past and areas that policies and objectives in relation to population may be subject to flooding in the future either targets, housing, infrastructure, economic due to development pressures or climate development, environment, amenities, social change. The final output from the study will be infrastructure and community development, a CFRAM Plan, to be published in December ensuring the successful implementation of the 2016. The Plan will define the current and NSS at regional, county and local level. future flood risk in the River Basin District and set out how this risk can be managed. The RPGs have allocated a population target of 63,536 for County Carlow by 2022. This represents a population increase of 4,085 from the 2016 population target of 59,451. Applying an average allocation per annum, this amounts to a population of 680 per annum between 2016-2022. The allocation for Tullow to 2022 is therefore calculated as 4.3 % of the population target (29 pop / average household size (2.7) = 11 units with 75% over zoning = 19 additional units). Adding this to the 2021 housing target (112) gives a revised target of 131 housing units for Tullow for the period 2016-2022. CAAS for Carlow County Council 4 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 3 SEA Methodology 3.1 Introduction to the The Plan and associated SEA, Appropriate Iterative Approach Assessment (AA) and Strategic Flood Risk Assessment (SFRA) documents were prepared This section details how the SEA has been in an iterative manner whereby multiple undertaken alongside the preparation of the revisions of each document were prepared, Plan. Figure 3.1 lays out the main stages in the each informing subsequent iterations of the Plan/SEA preparation process. others. Figure 3.1 Tullow Local Area Plan and SEA, AA and SFRA Stages CAAS for Carlow County Council 5 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 The SFRA has facilitated the integration of flood risk management considerations into the Plan. 3.2 Appropriate Assessment and 3.4 Requirement for SEA Integrated Biodiversity Impact Having considered the review and preparation of the Tullow Local Area Plan under Article 8 Assessment (14A) of the Planning and Development (SEA) Regulations (as amended), Carlow County 3.2.1 Appropriate Assessment Council, based on available information on both the expected content of the draft Plan and the A Stage 2 Appropriate Assessment (AA) has existing environment, determined that the Plan been undertaken alongside the preparation of would be likely, if unmitigated, to have the Plan. significant effects on the environment3. The requirement for AA is provided under the Furthermore, a Stage 2 Appropriate EU Habitats Directive (Directive 1992/43/EEC). Assessment (AA) under the Habitats Directive is being undertaken on the LAP. The SEA The AA concluded that the Plan will not affect Directive requires that SEA is undertaken the integrity of the Natura 2000 network2. where Stage 2 AA is being undertaken on plans, programmes or variations to these. The preparation of the Plan, SEA and AA has taken place concurrently and the findings of the It therefore was determined SEA is required to AA have informed both the Plan and the SEA. be undertaken on the Draft Plan. All recommendations made by the AA were integrated into the Plan. 3.5 Scoping 3.3 Strategic Flood Risk 3.5.1 Introduction Assessment In consultation with the environmental A Strategic Flood Risk Assessment (SFRA) has authorities, the scope of environmental issues been undertaken alongside the preparation of to be dealt with by the SEA together with the the Plan. level of detail to which they are addressed was broadly decided upon taking into account the The requirement for SFRA is provided under collection of environmental baseline data and ‘The Planning System and Flood Risk input from environmental authorities. Scoping Management Guidelines for Planning allowed the SEA to become focused upon key Authorities’ (DEHLG and OPW, 2009). issues relevant to the environmental components that are specified under the SEA The preparation of the Plan, SEA and SFRA has Directive4. taken place concurrently and the findings of the SFRA have informed both the Plan and the SEA. As the Plan is not likely to have significant effects on the environment in another Member State transboundary consultations as provided 2 Except as provided for in Section 6(4) of the the Department of Arts, Heritage and the Gaeltacht Habitats Directive, viz. There must be: as part of the Plan preparation process that (a) no alternative solution available; highlights the need to consider the protection of (b) imperative reasons of overriding public interest ecological sensitivities - including cSACs and for the plan to proceed; and protected species. Other issues for the Plan include (c) adequate compensatory measures in place. those relating to wastewater treatment capacity and 3 It was identified as mitigation needed to be performance, water quality and flood risk. integrated into the LAP in order to ensure the 4 These components comprise biodiversity, fauna, protection of the Slaney River Valley candidate flora, population, human health, soil, water, air, Special Area of Conservation (Site Code 000781). climatic factors, material assets, cultural heritage This cSAC is designated for a number of species, including architectural and archaeological heritage, including freshwater pearl mussel, which are highly landscape and the interrelationship between the protected and sensitive. A submission was made by above factors. CAAS for Carlow County Council 6 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 for by Article 7 of the SEA Directive were not the environment. In accordance with this undertaken. requirement, alternatives are considered in Section 6 and Section 7. 3.5.2 Scoping Notices All relevant environmental authorities5 3.8 The SEA identified under the SEA Regulations as Environmental amended, were sent SEA scoping notices by the Report Council indicating that submissions or observations in relation to the scope and level In this Environmental Report, which is placed of detail of the information to be included in the on public display alongside the Draft Plan, the environmental report could be made to the likely environmental effects of the Draft Plan Council. Environmental authorities were and the alternatives are predicted and their informed that submissions, or parts of significance evaluated. submissions, made on the AA or SFRA would also be taken into account. The Environmental Report provides the Council, stakeholders and the public with a clear 3.5.3 Scoping Responses understanding of the likely environmental consequences of implementing the Draft Plan. Submissions were made by the Environmental Protection Agency and the Department of Arts, Mitigation measures to prevent or reduce Heritage and the Gaeltacht. These submissions significant adverse effects posed by the Plan influenced the scope of the assessments and are identified in Section 9 - these have been have been taken into account during the integrated into the Plan. undertaking of the SEA, SFRA and AA. The Environmental Report will be updated in order to take account of recommendations 3.6 Environmental contained in submissions and in order to take Baseline Data account of changes that are made to the original, Draft Plan that is being placed on The SEA process is informed by the public display. environmental baseline (i.e. the current state of the environment) to facilitate the identification The Environmental Report is required to contain and evaluation of the likely significant the information specified in Schedule 2 of the environmental effects of implementing the Planning and Development (Strategic provisions of the Plan and the alternatives and Environmental Assessment) Regulations 2004 the subsequent monitoring of the effects of (SI No. 436 of 2004) as amended (see Table implementing the provisions of the Plan. 3.1). 3.7 Alternatives The SEA Directive requires that reasonable alternatives (taking into account the objectives and the geographical scope of the plan or programme) are identified, described and evaluated for their likely significant effects on 5 The following authorities were notified: Environmental Protection Agency; Department of Communications, Energy and Natural Resources; Department of Agriculture, Fisheries and Food; Department of the Environment, Community and Local Government; Department of Arts, Heritage and the Gaeltacht; and adjoining planning authorities whose areas are contiguous to the administrative area of Carlow County Council. CAAS for Carlow County Council 7 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 3.9 The SEA Statement On the making of the Plan by the Council, an SEA Statement will be prepared which will include information on: x How environmental considerations have been integrated into the Plan, highlighting the main changes to the Plan which resulted from the SEA process; x How the SEA Environmental Report and consultations have been taken into account, summarising the key issues raised in consultations and in the Environmental Report indicating what action was taken in response; x The reasons for choosing the Plan in the light of the other alternatives, identifying the other alternatives considered, commenting on their potential effects and explaining why the Plan as adopted was selected; and x The measures decided upon to monitor the significant environmental effects of implementing of the Plan. 3.10 Difficulties Encountered The lack of a centralised data source that could make all environmental baseline data for the County both readily available and in a consistent format posed a challenge to the SEA process. This difficulty is one which has been encountered while undertaking SEAs at local authorities across the country and was overcome by investing time in the collection of data from various sources and through the use of Geographical Information Systems. CAAS for Carlow County Council 8 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Table 3.1 Checklist of Information included in this Environmental Report Information Required to be included in the Environmental Report Corresponding Section of this Report (A) Outline of the contents and main objectives of the plan or programme, Sections 2, 5 and 7 and of its relationship with other relevant plans and programmes (B) Description of relevant aspects of the current state of the environment Section 4 and the evolution of that environment without implementation of the plan or programme (C) Description of the environmental characteristics of areas likely to be Sections 4, 6 and 7 significantly affected (D) Identification of any existing environmental problems which are relevant Section 4 to the plan or programme, particularly those relating to European protected sites (E) List environmental protection objectives, established at international, EU Sections 5, 6, 7 and 8 or national level, which are relevant to the plan or programme and describe how those objectives and any environmental considerations have been taken into account when preparing the Plan (F) Describe the likely significant effects on the environment Sections 6 and 7 (G) Describe any measures envisaged to prevent, reduce and as fully as Section 8 possible offset any significant adverse environmental effects of implementing the plan or programme (H) Give an outline of the reasons for selecting the alternatives considered, Sections 3, 6 and 7 and a description of how the assessment was undertaken (including any difficulties) (I) A description of proposed monitoring measures Section 9 (J) A non-technical summary of the above information Non-Technical Summary (Appendix II) (K) Interrelationships between each environmental topic Addressed as it arises within each Section CAAS for Carlow County Council 9 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 4 Environmental Baseline 4.1 Introduction development would have the potential to result in an increase in the occurrence of adverse The SEA Directive requires that the information effects on all environmental components, on the baseline environment is focused upon especially those arising cumulatively. the relevant aspects of the environmental Cumulative effects occur as a result of the characteristics of areas likely to be significantly addition of many small impacts to create one affected and the likely evolution of the current larger, more significant, impact. environment in the absence of the Plan. Being consistent with the strategic provisions of the Such adverse effects could include: Plan, this section provides a strategic description of aspects of environmental x Loss of biodiversity with regard to components that have the greatest potential to Natura 2000 Sites and Annexed be affected by implementation of the Plan, if habitats and species; unmitigated. x Loss of biodiversity with regard to ecological connectivity and stepping Article 5 of the SEA Directive states that the stones; report shall include the information that may x Loss of biodiversity with regard to reasonably be required taking into account: designated sites including Wildlife Sites and species listed on Schedule 5 of the x Current knowledge and methods of Wildlife Act 1976; assessment; x Spatially concentrated deterioration in x The contents and level of detail in the human health; plan or programme and its stage in the x Adverse impacts on the decision-making process; and hydrogeological and ecological function x The extent to which certain matters are of the soil resource; more appropriately assessed at x Adverse impacts upon the status of different levels in that process in order water bodies arising from changes in to avoid duplication of the assessment. quality, flow and/or morphology; x Increase in the risk of flooding; What this means in practice is, inter alia, that x Failure to provide adequate and SEA involves collating currently available, appropriate waste water treatment; relevant environmental data; it does not require x Failure to comply with drinking water major new research. Where data deficiencies or regulations and serve new gaps exist, this should be acknowledged in the development with adequate drinking report. water that is both wholesome and clean; With respect to the likely evolution of the x Increases in waste levels; environment in the absence of the Plan, the x Failure to contribute towards current Tullow Local Area Plan 2010-2016 sustainable transport and associated contains provisions that contribute towards impacts; environmental protection and sustainable x Effects on entries to the Record of development within Tullow. Monuments and Places and other archaeological heritage; If the current Plan was to expire and not be x Effects on entries to the Records of replaced by the new 2016 Plan, this would Protected Structures and other result in a deterioration of the town’s planning architectural heritage; and and environmental protection framework. x Occurrence of adverse visual impacts. Although higher-level environmental protection objectives – such as those of the new 2015- 2021 County Development Plan and various EU Directives and transposing Irish Regulations – would still apply, the deterioration of this framework would mean that new development would be less coordinated and controlled. Such CAAS for Carlow County Council 10 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 4.2 Biodiversity and 4.2.2 Proposed Natural Flora and Fauna Heritage Area 4.2.1 Natura 2000 Natural Heritage Areas (NHAs) are designated due to their national conservation value for ecological and/or geological/geomorphological Candidate Special Areas of Conservation heritage. They cover nationally important semi- (cSACs) have been selected for protection natural and natural habitats, landforms or under the European Council Directive on the geomorphological features, wildlife plant and conservation of natural habitats and of wild animal species or a diversity of these natural fauna and flora (92/43/EEC) by the (former) attributes. NHAs are designated under the Department of the Environment, Heritage and Wildlife (Amendment) Act 2000. Proposed Local Government due to their conservation NHAs (pNHA) were published on a non- value for habitats and species of importance in statutory basis in 1995, but have not since been the European Union. statutorily proposed or designated. Special Protection Areas (SPAs) have been There are no NHAs or pNHAs occurring inside selected for protection under the 1979 the Plan boundary. pNHAs within 15km of the European Council Directive on the Conservation Plan area are listed on Table 4.2 and mapped of Wild Birds (79/409/EEC) due to their on Figure 4.3. There are no NHAs located within conservation value for birds of importance in the 15km buffer zone of the plan area. the European Union. SPAs, along with SACs, comprise Ireland’s Natura 2000 network – part Table 4.2 pNHAs within 15km of the Plan of an EU-wide network of protected areas area established under the Habitats Directive. Proposed Natural Heritage Areas Designation Code Site Name There is one Natura 2000 site occurring inside pNHA 770 Blackstairs Mountains the Plan boundary, which is the River Slaney 781 River Slaney Valley Valley cSAC. This site has been designated due 788 Ardristen Fen to the presence of a number of habitats and 792 Baggot’s Wood species including Floating River Vegetation, Old 797 Ballymoon Esker Oak Woodlands, Alluvial Forests, Freshwater 806 Cloghristick Wood Pearl Mussel, Sea Lamprey, Brook Lamprey, 808 John’s Hill River Lamprey, Atlantic Salmon and Otter. 810 Oakpark 1389 Corballis Hill cSACs within 5, 10 and 15km buffers of the Plan 1757 Holdenstown Bog area are shown on Figure 4.1. The River Slaney 1852 Tomnafinnoge Wood Valley cSAC transects the Plan area and is shown on Figure 4.2. These are also listed on Table 4.1. There are currently no SPAs within 15km of the Plan area. Table 4.1 Natura 2000 sites within 15km of the Plan area Natura 2000 Sites Designation Code Site Name 0770 Blackstairs Mountains SAC 0781 Slaney River Valley SAC 1757 Holdenstown Bog SAC 2162 River Barrow and River Nore SAC Additional information on Natura 2000 sites is provided in the Stage 2 Appropriate Assessment Natura Impact Report that accompanies the Draft Plan. CAAS for Carlow County Council 11 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 4.2.3 CORINE Land Cover Entries to RPAs for wildlife within or adjacent to the town all relate to cSAC designations and Mapping associated species, including salmon. 6 CORINE land cover mapping for Tullow and Further information on entries to the RPA by surrounding environs for the year 2012 is virtue of their value to people is provided in shown on Figure 4.4. Discontinuous Urban Section 4.5. Fabric (indicative of the built area of the town) covers most of the Plan area with other areas within and surrounding the Plan area covered 4.2.6 Other Protected by Sport and Leisure facilities (this is Mount Species/Habitats Wolseley), Non-Irrigated lands and Pasture, and indicative agricultural uses. In addition to certain species and habitats already mentioned above, other species are 4.2.4 Ecological Networks and protected under law wherever they occur, such Connectivity as: x ‘Protected Species and natural habitats’ Ecological networks are important in connecting as defined in the Environmental areas of local biodiversity with each other and Liability Directive (2004/35/EC) and with nearby designated sites so as to prevent European Communities (Environmental islands of habitat from being isolated entities. Liability) Regulations 2008 including They are composed of linear features, such as annexed habitats and species listed treelines, hedgerows and rivers/streams, which under Annexes I, II and IV of the EU provide corridors or stepping stones for wildlife Habitats Directive and Annex I of the species moving within their normal range. They EU Birds Directive; are important for the migration, dispersal and x Species/Habitats legally protected genetic exchange of species of flora and fauna under the Flora Protection Order in the particularly for mammals, especially for bats Wildlife (Amendment) Act 2000; and small birds and facilitate linkages both x Other species of flora and fauna and between and within designated ecological sites, their key habitats which are protected the non-designated surrounding countryside under the Wildlife Acts 1976-2000 and the town. including all native mammals; and x Stepping stones and ecological Important ecological networks comprise a corridors including nature conservation variety of features including the Slaney River sites (other than Natura 2000 sites), that flows through the Plan area, various habitats and species locations covered agricultural lands, stands of trees and by Article 10 of the Habitats Directive. hedgerows. 4.2.7 Existing Problems 4.2.5 Registers of Protected Areas Previous developments such as residential, commercial and transportation have resulted in In response to the requirements of the Water loss of biodiversity and flora and fauna Framework Directive, a number of water however, legislative objectives governing bodies, or parts of water bodies, which must biodiversity and fauna were not identified as have extra controls on their quality by virtue of being currently conflicted with. how their waters are used by people and by wildlife, have been listed on Registers of Protected Areas (RPAs). 6 CORINE Land Cover (CLC) is a map of the European collected there are likely to be a number of environmental landscape based on interpretation of inaccuracies at the local level. It is noted, however, satellite images. Land cover is the observed physical that the land cover shown on the maps is generally cover, as seen from the ground or through remote accurate at the County level. The European sensing, including for example natural or planted Environment Agency, in conjunction with the vegetation, water and human constructions which European Space Agency, the European Commission cover the earth's surface. Because of the scale of the and member countries is currently updating the CORINE data and the method by which it was CORINE land cover database. CAAS for Carlow County Council 12 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.1 cSACs and SPAs in the vicinity of the Plan area Source: NPWS (datasets downloaded February 2016) CAAS for Carlow County Council 13 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.2 River Slaney Valley cSAC Source: NPWS (datasets downloaded February 2016) CAAS for Carlow County Council 14 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.3 NHAs and pNHAs in the vicinity of the Plan area Source: NPWS (datasets downloaded February 2016) CAAS for Carlow County Council 15 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.4 CORINE Land Cover Data 2012 Source: EPA (2015) CAAS for Carlow County Council 16 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 a habitat and gene pool, serves as a platform for human activities, landscape and heritage 4.3 Population and and acts as a provider of raw materials. Such Human Health functions of soil are worthy of protection because of their socio-economic as well as 4.3.1 Population environmental importance. Soils in any area are the result of the interaction of various factors, such as parent material, climate, vegetation The population of Tullow was recorded by the and human action. Central Statistics Office as being 3,972 in 2011. To date, there is no Directive that is specific to 4.3.2 Human Health the protection of soil resources. However, there is currently an EU Thematic Strategy on the Human health has the potential to be impacted protection of soil that includes a proposal for a upon by environmental vectors (i.e. Soil Framework Directive that proposes environmental components such as air, water common principles for protecting soils across or soil through which contaminants or the EU. pollutants, which have the potential to cause harm, can be transported so that they come 4.4.2 Soil Types into contact with human beings). Hazards or nuisances to human health can arise as a result Soil types, as classified by the EPA, are mapped of exposure to these vectors arising from on Figure 4.5. The primary underlying soil incompatible adjacent land uses for example. below the town of Tullow is identifiable as Made These factors have been considered with soil type (coral blue colour). The surrounding regard to the description of: the baseline of areas largely consist of Renzinas / Lithosols each environmental component; and the soils (purple colour) along with Mineral alluvium identification and evaluation of the likely soils located along the River Slaney. Areas of significant environmental effects of Lithosols / Regosols (Pink colour) and Acid implementing the Plan. Brown Earths / Brown Podzolics soils (red colour) are also distinguishable to the north, 4.3.3 Existing Problems east and west of the town. The Strategic Flood Risk Assessment (SFRA) 4.4.3 County Geological Sites undertaken alongside the preparation of the Plan has identified lands that are at elevated The Geological Survey of Ireland (GSI) levels of flood risk within the Plan area. The completed an audit of County Geological Sites SFRA has facilitated the integration of flood risk in County Carlow in 2004. This audit identified management considerations into the Plan. six Geological Heritage Sites. Three of the County Geological Sites identified (Aclare, Other issues relating to drinking water and Ballymoon Esker and Morrisey’s Quarry) are wastewater treatment are discussed in detail in located within 15km of the Plan area. Section 4.7 to include the Tullow Waste Water Treatment Plant and the Tullow Water Supply Scheme. 4.4.4 Existing Problems Legislative objectives governing soil were not 4.4 Soil identified as being conflicted with. 4.4.1 Introduction Soil can be considered as a non-renewable natural resource because it develops over very long timescales. It is an extremely complex, variable and living medium and performs many vital functions including: food and other biomass production, storage, filtration and transformation of many substances including water, carbon, and nitrogen. Soil has a role as CAAS for Carlow County Council 17 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.5 Soil Type Source: Teagasc, GSI, Forest Service & EPA (2006) Soils and Subsoils Class CAAS for Carlow County Council 18 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 4.5.2 The Water Framework 4.5 Water Directive 4.5.1 Potential Pressures on 4.5.2.1 Introduction and Requirements Water Quality Since 2000, Water Management in the EU has been directed by the Water Framework Human activities, if not properly managed, can Directive 2000/60/EC (WFD). The WFD requires cause deterioration in water quality. Pressures that all Member States implement the exerted by human activities include the necessary measures to prevent deterioration of following: the status of all waters - surface, ground, estuarine and coastal - and protect, enhance x Sewage and other effluents discharged to and restore all waters with the aim of achieving waters from point sources, e.g. pipes from “good status”. All public bodies are required to treatment plants; coordinate their policies and operations so as to maintain the good status of water bodies that x Discharges arising from diffuse or are currently unpolluted and improve polluted dispersed activities on land; water bodies to good status. x Abstractions from waters; and Article 4 of the WFD sets out various exemptions for deterioration in status caused as x Structural alterations to water bodies. a result of certain physical modifications to water bodies. This is provided: all practicable A point source pressure has a recognisable and mitigation measures are taken; there are specific location at which pollution may reasons of overriding public interest or the originate. Examples of significant point source benefits to human health, safety or sustainable pressures include direct discharges from development outweigh the benefits in achieving wastewater treatment plants, licensed the WFD objective; there are no better discharges from industrial activities, landfills, alternatives; and the reasons for the physical contaminated lands (e.g. disused gas works) modification are explained in the relevant river and mines. basin management plan. A diffuse source pressure unlike a point source 4.5.2.2 River Basin Districts and Water is not restricted to an individual point or Bodies location. The source of a diffuse pressure can For the purpose of implementing the WFD, be quite extensive. Significant examples of Ireland has been divided into eight River Basin diffuse pressures include runoff from forestry Districts (RBDs) or areas of land that are and agricultural lands. drained by a large river or number of rivers and the adjacent estuarine/coastal areas. The Excessive abstractions from surface waters and management of water resources is on these groundwater for drinking and industrial river basin districts. Tullow falls within the purposes can create pressures on the ability of South Eastern RBD. a water body to maintain both chemical and ecological status. Within each river basin district - for the purpose of assessment, reporting and management - Structural alterations such as river water has been divided into groundwater, straightening; construction of embankments, rivers, lakes, estuarine waters and coastal weirs, dams, port facilities and dredging can waters that are in turn divided into specific, create conditions such that a water body is no clearly defined water bodies. longer able to support the natural ecology which would have existed prior to such 4.5.2.3 River Basin Management Plans modifications. These pressures are also Local Authorities, including Carlow County referred to as morphological pressures. Council, have prepared the South East River Basin Management Plan that is implemented in order to help protect and improve the status of waters. The Management Plan provides specific policies for individual river basins in order to implement the requirements of the WFD. CAAS for Carlow County Council 19 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 4.5.3 Surface Water 4.5.4 Ground Water 4.5.3.1 WFD Surface Water Status 4.5.4.1 Introduction The WFD defines ‘surface water status’ as the Groundwater is stored in the void spaces in general expression of the status of a body of underground layers of rock, or aquifers. These surface water, determined by the poorer of its aquifers are permeable, allowing both the ecological status and its chemical status. Thus, infiltration of water from the soils above them to achieve ‘good surface water status’ both the and the yielding of water to surface and coastal ecological status and the chemical status of a waters. Groundwater is the part of the surface water body need to be at least ‘good’. subsurface water that is in the saturated zone - the zone below the water table, the uppermost Ecological status is an expression of the level of saturation in an aquifer at which the structure and functioning of aquatic ecosystems pressure is atmospheric, in which all pores and associated with surface waters. Such waters are fissures are full of water. classified as of “good ecological status” when they meet Directive requirements. 4.5.4.2 WFD Groundwater Status For groundwater bodies, the approach to Chemical Status is a pass/fail assignment with classification is different from that for surface a failure defined by a face-value exceedance of water. For each body of groundwater, both the an Environmental Quality Standards (EQS) for chemical status and the quantitative must be one or more Priority Action Substances (PAS) determined. Both have to be classed as either listed in Annex X of the Water Framework good or poor. The WFD sets out a series of Directive (WFD). The EQS values for individual criteria that must be met for a body to be PAS substances are set at European level. Good classed as good chemical and quantitative surface water chemical status means that status. concentrations of pollutants in the water body do not exceed the environmental limit values The status of the groundwater underlying the specified in the Directive. Tullow area is identified as being of good status (see Figure 4.8). Figure 4.6 maps the status of the River Slaney and its tributaries as currently available from 4.5.4.3 Aquifer Productivity, the EPA7. Stretches of water bodies upstream Vulnerability and Protection and running through the town are currently identified by the EPA as having a Moderate The Geological Survey of Ireland (GSI) rates status with while Good status is attributed to aquifers according to both their productivity stretches of water bodies downstream, to the and vulnerability to pollution. south of Ford Tullow Br. Much of the Plan area is underlain by two 4.5.3.2 Biological Quality of Rivers overlapping aquifers – A locally important aquifer and a Bedrock Aquifer. A gravel aquifer Biological river water quality within the vicinity (Burren Basin) occurs to the west and south- of the town is monitored by the EPA at a west of the Plan area, while as another bedrock number of locations. The most recent data from aquifer lies to the east. the EPA (see Figure 4.7) points on the River Slaney identify the river as being of Q2 – Q3 Aquifer vulnerability refers to the ease with (poor status) downstream of the town (Station which pollutants of various kinds can enter name: Ford), Q3 – Q4 (moderate status) at underground water. Figure 4.9 maps aquifer Tullow Bridge within the town and Q4 (good vulnerability for the Plan and surrounding area status) upstream of the Tullow Bridge within – much of the area is identified as being of high the plan area. vulnerability with pockets of extreme vulnerability or ‘rock at or near surface or Karst’ in the surrounding environs of the town. Medium vulnerability exists in small patches to the north, south and east of the town. 7 Dataset downloaded February 2016 CAAS for Carlow County Council 20 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 4.5.5 Register of Protected of flood risk. Flood hazard and flood risk maps for AFAs were made available in 2015 and Flood Areas Risk Management Plans may be finalised in 2016. Tullow is indicated as an AFA. In response to the requirements of the Water Framework Directive, a number of water 4.5.6.2 DEHLG Flood Risk Management bodies, or parts of water bodies, which must Guidelines have extra controls on their quality by virtue of how their waters are used by people and by In 2009 the DEHLG published The Planning wildlife, have been listed on Registers of System and Flood Risk Management Guidelines Protected Areas (RPAs). for Planning Authorities. These are aimed at ensuring a more consistent, rigorous and Entries to RPAs (as shown on Figure 4.10) systematic approach which will fully incorporate relating to the use of waters by people and flood risk assessment and management into the biodiversity within or adjacent to the town planning system. Planning authorities are include: required to undertake flood risk identification, assessment and management processes as x The groundwater underlying both the appropriate when preparing land use plans and town and surrounding environs (this is in the consideration of applications for planning listed on the RPA for Drinking Water permission. from Groundwater Sources). x Groundwater in the wider area is part 4.5.6.3 Strategic Flood Risk Assessment of catchments that contain entries to A Strategic Flood Risk Assessment (SFRA) has the RPA for Nutrient Sensitive Areas been undertaken alongside the preparation of and Salmonid Rivers to the west of the the Plan. town is listed for groundwater in a nutrient sensitive area. The requirement for SFRA is provided under x The River Slaney is listed on the RPA ‘The Planning System and Flood Risk for Salmonid Rivers. Management Guidelines for Planning x A section of the River Slaney located Authorities’ (DEHLG and OPW, 2009). the south of the town is listed on the RPA for drinking water rivers. The main source of historic and potential flood risk to development in Tullow is the River 4.5.6 Flooding Slaney with the river Derreen presenting a low risk. The River Slaney has been subject to a 4.5.6.1 Introduction Flood Relief Scheme (FRS). In addition to the Flooding is an environmental phenomenon that, River Slaney and Derreen there are three as well have causing economic and social smaller tributaries that drain into the impacts, could in certain circumstances pose a aforementioned rivers. The tributaries do not risk to human health. cause significant impacts and present a low risk. Areas at risk of flooding adjacent to these European Directive 2007/60/EC on the watercourses are mapped on Figure 4.11. assessment and management of flood risks requires Member States to carry out a The preparation of the Plan, SEA and SFRA has preliminary assessment by 2011 in order to taken place concurrently and the findings of the identify the river basins and associated coastal SFRA have informed both the Plan and the SEA. areas at risk of flooding. For such zones, flood The SFRA has facilitated the integration of flood risk maps are currently being finalised. Flood risk management considerations into the Plan. risk management plans focused on prevention, protection and preparedness are scheduled to 4.5.7 Existing Problems be available may be finalised in 2016. The Office of Public Works has prepared Preliminary The SFRA has identified lands that are at Flood Risk Assessment (PFRA) maps that elevated levels of flood risk within the Plan area identify areas where the risks associated with and has facilitated the integration of flood risk flooding might be significant. These areas, management considerations into the Plan. Areas for Further Assessment (AFAs), are where more detailed assessment is required to The moderate surface water status of the River more accurately assess the extent and degree Slaney upstream and throughout the town is CAAS for Carlow County Council 21 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 distinguished as an issue due to the objective of the Water Framework Directive to achieve ‘good surface water status’ for all surface water catchments within the EU. CAAS for Carlow County Council 22 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.6 WFD Surface Water Status Source: EPA (2011; datasets downloaded February, 2014) CAAS for Carlow County Council 23 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.7 Q-Values at Points on Rivers post 2004 Source: EPA (Various) CAAS for Carlow County Council 24 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.8 WFD Status of Groundwater Source: EPA (2011; datasets downloaded March 2015) CAAS for Carlow County Council 25 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.9 Aquifer Vulnerability Source: GSI (2006) CAAS for Carlow County Council 26 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.10 Entries to the RPAs (EPA 2016) CAAS for Carlow County Council 27 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.11 Flood Zones Source: SFRA on the draft Tullow Local Area Plan (2016) CAAS for Carlow County Council 28 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 of the country - excluding Zones A, B and C. 4.6 Air and Climatic Factors The Tullow Plan area is located within Zone where air quality is currently identified as being 4.6.1 Ambient Air Quality “good”. The EPA’s (EPA, 2015) Air Quality in Ireland 2014 identifies that air quality in Ireland continues to be good, with no exceedances for 4.6.1.1 Introduction and Legislation the pollutants measured. In order to protect human health, vegetation and ecosystems, EU Directives set down air 4.6.2 Noise quality standards in Ireland and the other Member States for a wide variety of pollutants. Noise is unwanted sound. The Environmental These pollutants are generated through fuel Noise Regulations (SI No. 140 of 2006) combustion, in space heating, traffic, electricity transpose into Irish law the EU Directive generation and industry and, in sufficient 2002/49/EC relating to the assessment and amounts, could affect the well-being of the management of environmental noise, which is areas inhabitants. The EU Directives include commonly referred to as the Environmental details regarding how ambient air quality Noise Directive or END. The END defines a should be monitored, assessed and managed. common approach intended to avoid, prevent or reduce on a prioritised basis the harmful The principles to this European approach are effects, including annoyance, due to exposure set out under the Air Quality Framework to environmental noise. The END does not set Directive 1996 as transposed into Irish law any limit value, nor does it prescribe the under the Environmental Protection Agency Act measures to be used in the action plans, which 1992 (Ambient Air Quality Assessment and remain at the discretion of the competent Management) Regulations 1999 (SI No. 33 of authorities. Limit values are left to each 1999). member state. At this point in time, Ireland does not have any statutory limit values. Four daughter Directives lay down limits or thresholds for specific pollutants. The first two 4.6.3 Climatic Factors of these directives cover: sulphur dioxide, nitrogen dioxide and oxides of nitrogen, The key issue involving the assessment of the particulate matter and lead; and, carbon effects of implementing the plan on climatic monoxide and benzene. Two more daughter factors relates to greenhouse gas emissions directives deal with: ozone; and polyaromatic arising from transport. Climatic factors also hydrocarbons, arsenic, nickel, cadmium and interact with flooding (see Section 4.5). mercury in ambient air. In 2009, Ireland's greenhouse gas emissions 4.6.1.2 Air Zones decreased across all sectors due to the effects In order to comply with the directives of the economic downturn with a decline in total mentioned above, the EPA measures the levels emissions of 7.9 per cent. In 2010, Ireland's of a number of atmospheric pollutants. For the emissions fell by a further 0.7 per cent. purposes of monitoring in Ireland, four zones are defined in the Air Quality Standards Ireland’s emissions profile has changed Regulations 2002 (SI No. 271 of 2002). The considerably since 1990, with the contribution main areas defined in each zone are: from transport more than doubling and the share from agriculture reducing since 1998. x Zone A: Dublin Conurbation. Travel is a source of: x Zone B: Cork Conurbation. x Zone C: 21 Other cities and large towns 1. Noise; including Galway, Limerick, Waterford, 2. Air emissions; and Clonmel, Kilkenny, Sligo, Drogheda, 3. Energy use (41.7% of Total Final Wexford, Athlone, Ennis, Bray, Naas, Energy Consumption in Ireland in 2014 Carlow, Tralee and Dundalk. x Zone D: Rural Ireland, i.e. the remainder of the State - small towns and rural areas CAAS for Carlow County Council 29 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 was taken up by transport, the largest will require focus and effort which take up of any sector)8. includes meeting renewable targets for transport and heat as well as energy Land-use planning contributes to what number efficiency targets. and what extent of journeys occur. By x Transport emissions are projected to addressing journey time through land use show strong growth over the period to planning and providing more sustainable modes 2020 with a 13%-19% increase on and levels of mobility, noise and other current levels depending on the level of emissions to air and energy use can be policy implementation. Relative to minimised. Furthermore, by concentrating 2005, transport emissions are populations, greenfield development - and its projected to remain the same or, at associated impacts - can be minimised and the best, decrease by 4% by 2020. cost of service provision can be reduced. Maximising sustainable mobility will help Between 2008 and 2011, Ireland's greenhouse Ireland meet its emission target for greenhouse gas emissions decreased across all sectors due gases under the 2020 EU Effort Sharing target to the effects of the economic downturn with that commits Ireland to reducing emissions emissions falling by 15.2% between 2008 and from those sectors that are not covered by the 2011. However, 2012 saw emissions rise by Emissions Trading Scheme (e.g. transport, 1.2% when compared with 20119. agriculture, residential) to 20% below 2005 levels. Between 1990 and 2013, the Transport sector shows the greatest overall increase of all Land-use planning contributes to the number sectors, at 115.5%. Emissions increased by and the extent of which journeys occur. By 2.1% in 2013, the first increase in Transport addressing journey time through land use emissions since 2007. However, Transport planning and providing more sustainable modes emissions have decreased by 23.1% below and levels of mobility (as is provided for by the peak levels in 2007 primarily due to the Draft Plan), noise and other emissions to air and economic downturn, improving vehicle energy use can be minimised. Furthermore, by standards due to the changes in vehicle concentrating populations, greenfield registration tax and the increase use in biofuels. development - and its associated impacts - can The increase up to 2007 can be attributed to be minimised and the cost of service provision general economic prosperity, increasing can be reduced. population with a high reliance on private car travel as well as rapidly increasing road freight Provisions in relation to green infrastructure transport.10 have also been integrated into the Plan. Green Infrastructure has the potential to achieve The EPA 2015 publication Ireland’s Greenhouse objectives and synergies with regard to the Gas Emission Projections 2014-2035, identifies following: that: x Provision of open space amenities; x Under the ‘worst case’ scenario, Ireland x Sustainable management of water; is projected to cumulatively exceed its x Protection and management of obligations by four Mtonnes of CO2eq biodiversity; over the period 2013-2020. x Protection of cultural heritage; and x Under the ‘best case’ scenario, Ireland x Protection of protected landscape is projected to cumulatively meet its sensitivities. compliance obligations over the 2013- 2020 period and meet its 2020 target. 4.6.4 Existing Problems This takes into account the overachievement of the annual limits in Legislative objectives governing air and climatic the period 2013- 2017 that is banked factors in Carlow were not identified as being and used in the years 2018-2020. The conflicted with. report identifies that achieving the outlook under the ‘best case’ scenario 8 Sustainable Energy Ireland (2014) Energy in Ireland 1990 10 EPA (2014) Ireland's Provisional Greenhouse Gas – 2014 Emissions in 2013 9 EPA (2014) Ireland's Greenhouse Gas Emissions in 2012 CAAS for Carlow County Council 30 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 4.7.1.3 Waste Water Capacity and 4.7 Material Assets Demand The development of the town’s wastewater 4.7.1 Water Services drainage system is essential to facilitate growth. The current Tullow waste water 4.7.1.1 Irish Water treatment plant, located on the Bunclody Road, Since January 2014 the delivery, integration was originally designed with a treatment and implementation of strategic water and capacity of 4,000 population equivalent (PE). wastewater projects and infrastructural Recent upgrades to the plant including new improvements are now the responsibility of the intake works, new aeration system and tertiary newly established State body ‘Irish Water’. treatment have allowed for an increase in the organic treatment capacity of the plant. The Carlow County Council no longer has a direct current loading on the plant is determined at role in this area; however, the Local Authority 5,100 PE equivalent. Irish Water have will work with Irish Water to ensure that the acknowledged that the existing plant is Local Area Plan and any water services overloaded and have committed to including investment plan will align with both the National this plant in Irish Waters Emerging Investment Spatial Strategy and the Regional Planning Plan for inclusion in the next Capital Investment Guidelines and that the provision of Plan. Preliminary works have commenced water/waste water services will not be a limiting regarding the design phase of the upgrade factor in terms of forecasted growth. works to both the treatment plant and the network. The function and role of Irish Water includes: 4.7.1.4 Drinking Water Performance x Abstracting and treating water; Drinking water must be clean and wholesome. x Delivering water and waste water That means it must meet the relevant water services to homes and businesses; quality standards and must not contain any x Installing water meters and billing other substance or micro-organism in domestic and business customers; concentrations or numbers that constitute a x Raising finance to fund improvements potential danger to human health. and repairs in the water system; and x Maintaining and operating the water Compliance with the drinking water system. requirements is determined by comparing the results of analyses submitted by water suppliers The upgrading of the infrastructure will to the standard for 48 parameters specified in contribute towards compliance with the Water the European Communities (Drinking Water) Framework Directive, EU Urban Waste Water Regulations (No. 2), 2007. To ensure that these Treatment Directive and Drinking Water standards are met, each water supply must be Regulations and will help to protect human monitored on a regular basis. health and maintain the quality of coastal waters. Under Section 58 of the Environmental Protection Agency Act 1992 the EPA is required The responsibility for the provision of these to collect and verify monitoring results for all services now lies with Irish Water, supported by water supplies in Ireland covered by the Carlow County Council, as appropriate. European Communities (Drinking Water) Regulations, 2000. The EPA publishes their 4.7.1.2 Waste Water Performance results in annual reports that are supported by The EPA’s most recent report on waste water Remedial Action Lists (RALs). The RAL identifies treatment performance ‘Urban Waste Water water supplies that do not comply with the Treatment in 2014’, EPA 2015, identifies that Regulations mentioned above. the Tullow Waste Water Treatment Plant (WWTP) failed the water quality standards set Both the Tullow Water Supply Scheme and the down under requirements of the Urban Waste North Regional Water Supply Scheme (both Water Treatment Directive. This is a drop in supplying Tullow) are not listed on the EPA’s standards as the WWTP passed the water most recent (Q1 2016) Remedial Action List (a quality standards in 2013. list of public water supplies where remedial action is required to ensure compliance with drinking water standards). CAAS for Carlow County Council 31 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 4.7.1.5 Capacity and Demand various locations throughout the town, such as Flynn’s Garage to the north of the town and The Tullow town network is interconnected to Supervalu carpark in the centre of town. The the North Regional Water Supply Scheme that closest Civic Amenity Centre is located in is the surface water source at Rathvilly Water Powerstown, which provides for a wide range Treatment Plant. This plant is operating below of household recycling materials. The Council its capacity and has adequate reserve to cater will continue to encourage recycling and the for predicted future growth in Tullow over the minimisation of waste through its lifetime of this plan. environmental education programme and the Green-Schools programme. The town also has its own water treatment plant that has a capacity of 1,200 cubic metres of water per day. It has a surface water 4.7.3 Transport abstraction from the River Slaney and is located on the Ballymurphy Road. This plant is Tullow is strategically located on the N81 currently operating at capacity. Wexford to Dublin route. The M9 is also located 8 km to the west of Tullow and is accessed via The current water supply between both the N81 and the N80. Tullow is also served by schemes is considered to have adequate the R725 regional road linking Gorey to Carlow. (headroom) capacity available and would cater Private car is the main means of accessibility in for any future development growth during the Tullow. A considerable amount of through lifetime of this plan. Water supplied to the town traffic passes the town centre daily. The is tested regularly and is consistently of the traditional layout of the town with narrow highest quality. streets and the bridge over the River Slaney contribute to these traffic issues. Bus Eireann 4.7.2 Waste Management route 132 provides a limited service between Dublin and Tullow, operating approximately three times a day each way Monday to Saturday In March 2011, the EC (Waste Directive) and twice on Sunday. Private bus operators also Regulations 2011 came into force. As well as provide a service between Hacketstown and including new re-use and recycling targets, Carlow Town serving Tullow approximately these Regulations included a requirement to twice a day in each direction. There is no train evaluate existing waste management plans by service to Tullow, the nearest service being 31 December 2012 and make a provided by Carlow town. recommendation to revise or replace the existing plans. An evaluation of the South East Plan was carried out and it was recommended 4.7.4 Existing Problems that the Plan be replaced with a new plan. In 2015 a new plan was published; the Southern No existing conflicts with legislative objectives Region Waste Management Plan 2015 – 2021 governing material assets have been identified. with an objective to set out a framework for the prevention and management of waste on a regional scale. 4.8 Cultural Heritage With regard to domestic waste collection, the 4.8.1 Introduction refuse collection service in County Carlow is privatised. A number of domestic waste Heritage, by definition, means inherited collection companies collect waste in the Tullow properties, inherited characteristics and area. Collectors provide a segregated collection anything transmitted by past ages and service, using waste collection permits issued ancestors. It covers everything, from objects by Carlow County Council. Waste collected in and buildings to the environment. Cultural Tullow is disposed of mainly at the council’s heritage includes physical buildings, structures central landfill and civic amenity site at and objects, complete or in part, which have Powerstown, located approximately 15km to been left on the landscape by previous and the south west of Tullow. indeed current generations. The Council has provided bring banks for the collection of glass, aluminium cans and textiles at a site on the Thomas Traynor Road. There are also some bring centres for textiles at CAAS for Carlow County Council 32 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 4.8.2 Archaeological Heritage distribution of entries to the RMP in the Tullow area. 4.8.2.1 Introduction 4.8.3 Architectural Heritage Archaeology is the study of past societies through the material remains left by those 4.8.3.1 Introduction societies and the evidence of their environment. Archaeological heritage consists of such The term architectural heritage is defined in the material remains (whether in the form of sites Architectural Heritage (National Inventory) and and monuments or artefacts in the sense of Historic Monuments Act 1999 as meaning all: moveable objects) and environmental structures and buildings together with their evidence. As archaeological heritage can be settings and attendant grounds, fixtures and used to gain knowledge and understanding of fittings; groups of structures and buildings; the past, it is of great cultural and scientific and, sites which are of technical, historical, importance. archaeological, artistic, cultural, scientific, social, or technical interest. Archaeological sites and monuments vary greatly in form and date; examples include 4.8.3.2 Record of Protected Structures earthworks of different types and periods, (e.g. The Record of Protected Structures (RPS) early historic ringforts and prehistoric burial included in the Plan is legislated for under mounds), megalithic tombs from the Prehistoric Section 12 and Section 51 of the Planning and period, medieval buildings, urban Development Act 2000 as amended. archaeological deposits and underwater features. Protected Structures are defined in the Planning and Development Act 2000 as amended as Archaeological sites may have no visible surface structures, or parts of structures that are of features; the surface features of an special interest from an architectural, historical, archaeological site may have decayed archaeological, artistic, cultural, scientific, completely or been deliberately removed but social or technical point of view. archaeological deposits and features may survive beneath the surface. In relation to a protected structure or proposed protected structure, the following are 4.8.2.2 Record of Monuments and Places encompassed: Tullow’s archaeological heritage is protected under the National Monuments Acts (1930- (i) the interior of the structure; 2004), Natural Cultural Institutions Act 1997 (ii) the land lying within the curtilage11 and the Planning Acts. The Record of of the structure; Monuments and Places (RMP) is an inventory, (iii) any other structures lying within established under Section 12 of the National that curtilage and their interiors; Monuments (Amendment) Act 1994, of sites and, and areas of archaeological significance, (iv) all fixtures and features which form numbered and mapped. The RMP includes all part of the interior or exterior of known monuments and sites of archaeological any structure or structures referred importance dating to before 1700 AD, and some to in subparagraph (i) or (iii). sites that date from after 1700 AD. Current entries to the RPS in Tullow are There are 20 designated areas of archaeological mapped on Figure 4.13. Examples include potential within Tullow’s zoning boundary Tullow Monastery National School, St. recorded on the OPW’s Sites and Monuments Columba’s National School, the Bridge House, Record. Figure 4.12 shows the spatial the Coachhouse on the Dublin Road, the Courthouse and the Museum. 11 Curtilage is normally taken to be the parcel of buildings now in separate ownership, e.g. the lodge ground immediately associated with the Protected of a former country house, or the garden features Structure, or in use for the purposes of the structure. located in land subsequently sold off. Such lands are Protection extends to the buildings and land lying described as being attendant grounds, and the within the curtilage. While the curtilage sometimes protection extends to them just as if they were still coincides with the present property boundary, it can within the curtilage of the Protected Structure. originally have included lands, features or even CAAS for Carlow County Council 33 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Tullow is one of five settlements in Carlow originating from Anglo Norman Times and along with Leighlinbridge and Carlow Town it has survived as a population centre since that time. The town declined in size during the later Middle Ages, but with the revival of English influence in Ireland during the sixteenth and seventeenth centuries, the town took on a new prosperity and much of its present layout particularly around Market Square originated from that time. In addition to mapping entries to the RPS, Figure 4.13 maps entries to the National Inventory of Architectural Heritage (NIAH) (these provide the basis for the recommendations of the Minister for Arts, Heritage and the Gaeltacht for the inclusion of particular structures into the RPS). 4.8.4 Existing Problems The context of archaeological and architectural heritage has changed over time within the Plan area however no existing conflicts with legislative objectives governing archaeological and architectural heritage have been identified. CAAS for Carlow County Council 34 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.12 Archaeological Heritage - Entries to the Record of Monuments and Places and Zones of Notification Source: Carlow County Council (2016) CAAS for Carlow County Council 35 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.13 Architectural Heritage - Entries to the RPS and NIAH Source: Carlow County Council (2016) CAAS for Carlow County Council 36 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 x Central Lowlands Landscape Character Area; 4.9 Landscape x Blackstairs and Mount Leinster Uplands Landscape Character Area; and 4.9.1 Introduction x River Slaney – East Rolling Farmland Landscape Character Area. Landscapes are areas that are perceived by people and are made up of a number of layers: Components of the landscape within and landform, which results from geological and adjacent to Tullow which contribute towards geomorphological history; landcover, which landscape character include the River Slaney, includes vegetation, water, human settlements, hedgerows and lines of trees. and; human values that are a result of historical, cultural, religious and other 4.9.3.2 Key Characteristics of the Central understandings and interactions with landform Lowlands Character Area12 and landcover. The central plain landscape character area occupies a substantial portion of the County. 4.9.2 Legislation The landscape is primarily rural, with medium to quite large fields defined by well-maintained The importance of landscape and visual and generally low hedges and occasional to amenity and the role of its protection are frequent hedgerow trees. Since the 1950s, field recognised in the Planning and Development enlargement has been taken place to Act 2000 as amended, which requires that Plans accommodate larger farm machinery, and has include objectives for the preservation of the involved the removal of hedges and trees. The landscape, views and the amenities of places boundary of the area is based on soil types and and features of natural beauty. topography. Its historically determined land uses derive from the high fertility of the soil and 4.9.3 Landscape Character the gentle topography. The topography is Assessment underlain by limestone in the western portion of the area (flanking the Barrow River), and by granite in the east. A dense network of local 4.9.3.1Overview roads traverses the area in addition to the N80 A Landscape Character Assessment (LCA) is a and the N9. There are also isolated gravel and study of a given landscape to determine its quarry workings in the area. 60% of the ‘character’. Landscape character is the County’s population lives in the northern combination of physical, as well as, perceived portion of the Character Area. The County’s aspects of the landscape. major settlements are also located in the Character Area. They include Carlow town, The Carlow LCA was produced as part of the Tullow, Muine Bheag and Leighlinbridge. The Carlow County Development Plan 2015-2021. majority of the County’s designated habitats are The LCA divides the County into Landscape also in the Character Area including the Barrow/ Character Areas i.e. unique, geographically Nore River Valleys, the Slaney River Valley, specific areas of a particular landscape type. Ardristan Fen, Oak Wood, and Borris Estate. The aim of the County Carlow LCA is to provide a tool for decision making regarding 4.9.3.3 Key Characteristics of the development control and to influence landscape Blackstairs and Mount Leinster policy at local level. In considering landscape Uplands Character Area character in the area, the Council acknowledges The Mount Leinster/ Blackstairs Landscape the importance of taking into account adjoining Character Area is situated on the eastern side landscape character, landscape features and of the County along the border with County designations, including those in adjoining Wexford. It is dominated by the uplands of the counties. Blackstairs Mountains and Mount Leinster, which extend as a distinct ridgeline for c. 25km There are five Principal Landscape Character northwards from the border with Wexford. Areas. Tullow falls within three character areas, Mount Leinster is largely located in Wexford. which are as follows: The western slopes are however in County 12 Source: Carlow Landscape Character Assessment CAAS for Carlow County Council 37 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Carlow. The majority of this area is underlain by key issues to the area include the over granite, but Ordovician Metasediments of schist management of roadside hedges and housing and sandstone occur between Clonegal and development pressures. Myshall. This area is dominated by the Blackstairs Mountains and their lower slopes, 4.9.4 Landscape Sensitivity which comprise till and scree deposits. The higher slopes of the Blackstairs are essentially Landscape sensitivity mapping was prepared unproductive lands with a thin covering of soil for the Carlow LCA by according sensitivity and blanket bog, and heather type vegetation rating to the existing adopted Principal cover. The lower slopes at c. 80m to 200m OD Landscape Character Areas. These boundaries are in rough grazing merging into arable lands were based on extensive LCA fieldwork and grasslands. The fields are small and augmented by ensuring conformity with a bounded by a mixture of hedges and stone number of ‘mappable’ and natural factors such walls with occasional trees. There are a number as landcover, soils, geology and slope. A large of small and intact villages in the area including portion of the built area in Tullow is identified Glynn, Ballymurphy and Miseal (Myshall). There as having the least sensitivity rating, a rating of are no major settlements. In terms of ‘1’. However, areas to the south and east of the designated sites, the Blackstairs, John’s Hill and Plan area have been attributed with a higher the River Slaney are designated habitats within rating, a rating of ‘4’, while as land to the north- the area. Some of the key issues to the area is west of the town has the highest sensitivity development pressure for one-off dwellings, rating of ‘5’. Other lands to the north and west impacts from plantation forestry and of the town are attributed with a sensitivity infrastructural developments. rating of ‘2’. Landscape sensitivity is mapped on Figure 4.15. 4.9.3.4 Key Characteristics of the River Slaney – East Rolling Farmland 4.9.5 Views and Prospects Character Area The Slaney - East Rolling Farmland Character It is the policy of the Council to protect scenic Area is located in the northeast corner of the views and routes within the County. The Plan County to the east of the River Slaney Valley. area itself does not contain protected scenic The bedrock in this area is wholly comprised of views or routes. However, there is a protected granite, which is overlain with thick tills and viewpoint to the south of the Plan area, which localised pockets of sands and gravels in the provides a view of typical rolling farmland near river valleys, as well as some peat and alluvial Mount Wolseley. deposits. The landscape is characterised by rounded granite dome-shaped hills, and 4.9.6 Existing Environmental interspersed rolling topography. Soils in the area include well drained, acidic, brown earth Problems soils, and pockets of poorly drained gleys. The change in elevation and soil type is reflected in Developments have resulted in changes to the a change in natural vegetation with the visual appearance of the landscape within the appearance of gorse in clumps and along field Plan area however legislative objectives boundaries. Fields are smaller and more governing landscape and visual appearance compact than those in the central plain. Lands were not identified as being conflicted with. are generally undulating. There are a number of distinctive hills in the area, notably Eagle Hill and Constable Hill to the south of Hacketstown, which confer a distinct identity on that part of the County. There are a number of large forestry plantations to the south of Clonmore on the border with County Wicklow. Landcover is agricultural (primarily grassland), merging into rough grazing at higher elevations. Hacketstown is the main centre serving the Character Area. Clonmore is a village in the south of the area. Designated Habitats within the area include; Baggot’s Wood, the Derreen River and the River Slaney Valley. Examples of CAAS for Carlow County Council 38 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.14 Landscape Character Areas Source: Carlow County Council (2015) CAAS for Carlow County Council 39 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.15 Landscape Sensitivity Source: Carlow County Council (2015) CAAS for Carlow County Council 40 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 x Scenic routes and views (10 points); x Sensitive landcover categories (Inland 4.10 Overlay of marshes and water bodies - 10 points); Environmental x Surface and groundwaters with bad and poor (10 points) and moderate, Sensitivities good and high (5 points) status; x Aquifers which are highly (5 points) or 4.10.1Introduction and extremely (10 points) vulnerable to Methodology pollution; and In order to identify where most sensitivities Indicative flood zones A (10 points) and B (5 within Tullow occur, a number of the points) from the Strategic Flood Risk environmental sensitivities described above Assessment. were weighted and mapped overlapping each other. Figure 4.16 provides an overlay of The scores for each area are added together in environmental sensitivities for the town. order to determine overall vulnerability as shown on Table 4.3. It is emphasised that the occurrence of environmental sensitivities does not preclude Score Vulnerability Class development; rather it flags at a strategic level 5-15 Low that the mitigation measures - which have 20-25 Moderate already been integrated into the Plan - will need 30-35 Elevated to be complied with in order to ensure that the implementation of the Plan contributes towards 40-45 High environmental protection. 50-60 Extreme >60 Acute Environmental sensitivities are indicated by Table 4.3 Overall Vulnerability Classes colours which range from acute vulnerability (brown), extreme vulnerability (red) to high vulnerability (dark orange) to elevated 4.10.2Conclusions vulnerability (light orange) to moderate vulnerability (yellow) to low vulnerability The most sensitive areas within Tullow are (green). Only low, moderate and elevated located along the watercourses through the levels of vulnerability occur within and adjacent Plan area (on account of the sensitivity of the to the Plan area. Where the mapping shows a River Slaney, fluvial flood risk and Natura 2000 concentration of environmental sensitivities site designations). Sensitivity ratings vary along there is an increased likelihood that the watercourse from medium to extreme. development will conflict with these sensitivities and cause environmental deterioration. Other sensitive areas are also identified within the town (these largely relate to cultural A weighting system applied through heritage designations), however, these are of a Geographical Information System (GIS) comparatively lower rating in comparison to the software was used in order to calculate the sensitivities along the river. vulnerability of all areas in the town. Environmental considerations are given equal weight as follows, with a slight differentiation is made in certain layers: x Ecological designations (candidate Special Areas of Conservation - 10 points - and proposed Natural Heritage Areas - 5 points); x Cultural heritage (Entries to the Record of Protected Structures and entries to the Record Monuments and Places - 10 points); x Landscape character areas of very high (10 points) and high value (5 points); CAAS for Carlow County Council 41 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 4.16 Overlay of Environmental Sensitivities Source: CAAS (2016) CAAS for Carlow County Council 42 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 5 Strategic Environmental Objectives Strategic Environmental Objectives (SEOs) are methodological measures developed from policies that generally govern environmental protection objectives established at international, Community or Member State level e.g. the environmental protection objectives of various European Directives which have been transposed into Irish law and which are required to be implemented. The SEOs are set out under a range of topics and are used as standards against which the provisions of the Plan and the alternatives are evaluated in order to help identify which provisions would be likely to result in significant environmental effects and where such effects would be likely to occur, if - in the case of adverse effects - unmitigated. The SEOs are linked to indicators that can facilitate monitoring the environmental effects of the Plan as well identifying targets which the Plan can help work towards. All SEOs, indicators and targets are provided on Table 5.1 overleaf. Further detail on legislation, plans and programmes are provided under Section 2 (and associated Appendix I ‘‘Relationship with Legislation and Other Plans and Programmes’’) and Section 4. CAAS for Carlow County Council 43 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Table 5.1 Strategic Environmental Objectives, Indicators and Targets Environmental Strategic Environmental Selected Indicator(s) Selected Target(s) Component Objectives Biodiversity, B1: To ensure compliance B1: Conservation status of habitats Maintenance of favourable Flora and with the Habitats and Birds and species as assessed under conservation status for all habitats Fauna Directives with regard to Article 17 of the Habitats Directive and species protected under the protection of Natura national and international 2000 Sites and Annexed legislation to be unaffected by habitats and species13 implementation of the Plan14 B2: To ensure compliance B2: Percentage loss of functional B2: No significant ecological with Article 10 of the connectivity without remediation networks or parts thereof which Habitats Directive with resulting from development provide functional connectivity to regard to the management provided for by the Plan be lost without remediation of features of the landscape resulting from development which - by virtue of their provided for in the Plan linear and continuous structure or their function act as stepping stones (designated or not) - are of major importance for wild fauna and flora and essential for the migration, dispersal and genetic exchange of wild species B3: To avoid significant B3i: Number of significant impacts B3i: Avoid significant impacts on impacts on relevant on relevant habitats, species, relevant habitats, species, habitats, species, environmental features or other environmental features or other environmental features or sustaining resources in designated sustaining resources in other sustaining resources sites including Wildlife Sites resulting designated sites including Wildlife in designated sites from development provided for by Sites resulting from development including Wildlife Sites15 the Plan provided for by the Plan and to ensure compliance with the Wildlife Acts 1976- B3ii: Number of significant impacts B3ii: No significant impacts on the 2010 with regard to the on the protection of species listed on protection of species listed on protection of species listed Schedule 5 of the Wildlife Act 1976 Schedule 5 of the Wildlife Act on Schedule 5 of the 1976 principal Act Population PHH1: To protect PHH1: Occurrence (any) of a PHH1: No spatial concentrations and Human human health form spatially concentrated deterioration of health problems arising from Health exposure to incompatible in human health arising from environmental factors as a result landuses environmental factors resulting from of implementing the Plan development provided for by the Plan, as identified by the Health Service Executive and Environmental Protection Agency Soil S1: To avoid damage S1: Soil extent and hydraulic S1: To minimise reductions in soil to the hydrogeological and connectivity extent and hydraulic connectivity ecological function of the soil resource Water W1: To maintain and W1: Classification of Overall Status W1: Not to cause deterioration in improve, where possible, (comprised of ecological and the status of any surface water or the quality and status of chemical status) under the European affect the ability of any surface surface waters Communities Environmental water to achieve ‘good status’16 Objectives (Surface Waters) Regulations 2009 (SI No. 272 of 2009) 13 ‘Annexed habitats and species’ refer to those listed under Annex I, II & IV of the EU Habitats Directive and Annex I of the EU Birds Directive. 14 Except as provided for in Section 6(4) of the Habitats Directive, viz. There must be: (a) no alternative solution available; (b) imperative reasons of overriding public interest for the plan to proceed; and (c) adequate compensatory measures in place. 15 The Planning and Development Act 2000 as amended defines a ‘wildlife site’ as including Natural Heritage Areas (NHAs) and proposed NHAs. 16 Good status as defined by the WFD equates to approximately Q4 in the current national scheme of biological classification of rivers as set out by the EPA. CAAS for Carlow County Council 44 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Environmental Strategic Environmental Selected Indicator(s) Selected Target(s) Component Objectives W2: To prevent pollution W2: Groundwater Quality Standards W2: Not to affect the ability of and contamination of and Threshold Values under groundwaters to comply with ground water Directive 2006/118/EC Groundwater Quality Standards and Threshold Values under Directive 2006/118/EC W3: To comply as W3: Number of incompatible W3: Minimise developments appropriate with the developments granted permission granted permission on lands provisions of the Flood Risk on lands which pose - or are likely to which pose - or are likely to pose Management Guidelines for pose in the future - a significant in the future - a significant flood Planning Authorities flood risk risk in compliance with The Planning System and Flood Risk Management Guidelines for Planning Authorities Material M1: To serve new M1: Number of new developments M1: All new developments Assets development with adequate granted permission which can be granted permission to be and appropriate waste adequately and appropriately served connected to and adequately and water treatment with waste water treatment over the appropriately served by waste lifetime of the Plan water treatment over the lifetime of the Plan M2: To serve new M2: Number of non-compliances M2: No non-compliances with the development with adequate with the 48 parameters identified in 48 parameters identified in the drinking water that is both the European Communities (Drinking European Communities (Drinking wholesome and clean Water) Regulations (No. 2) 2007 Water) Regulations (No. 2) 2007 which present a potential danger to which present a potential danger human health as a result of to human health as a result of implementing the Plan implementing the Plan M3: To reduce waste M3i: Total collected and brought M3i: Minimise increases in and, volumes, minimise waste to household waste where possible, reduce household landfill and increase waste generation recycling and reuse M3ii: Packaging recovered (t) by self-complying packagers M3ii: Maximise increases in packaging recovered (t) by self- complying packagers Air and C1: To reduce travel related C1: Percentage of population C1: An increase in the percentage Climatic emissions to air and to travelling to work, school or college of the population travelling to Factors encourage modal change by public transport or non- work, school or college by public from car to more mechanical means transport or non-mechanical sustainable forms of means transport Cultural CH1: To protect CH1: Percentage of entries to the CH1: Protect entries to the Record Heritage archaeological heritage Record of Monuments and Places - of Monuments and Places - and including entries to the and the context these entries within the context of these entries within Record of Monuments and the surrounding landscape where the surrounding landscape where Places and/or their context relevant - protected from adverse relevant – protected from adverse effects resulting from development effects resulting from which is granted permission under development which is granted the Plan permission under the Plan CH2: To protect CH2: Percentage of entries to the CH2: Protect entries to the Record architectural heritage Record of Protected Structures and of Protected Structures and their including entries to the their context protected from adverse context from adverse effects Record of Protected effects resulting from development resulting from development which Structures and their context which is granted permission under is granted permission under the the Plan Plan Landscape L1: To avoid significant L1: Number of complaints received L1: No developments permitted adverse impacts on the from statutory consultees regarding which result in avoidable impacts landscape avoidable impacts on the landscape on the landscape resulting from resulting from development which is development which is granted granted permission under the Plan permission under the Plan CAAS for Carlow County Council 45 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 6 Alternative Development Strategies The SEA Directive requires that reasonable alternatives (taking into account the objectives and the geographical scope of the plan or programme) are identified, described and evaluated for their likely significant effects on the environment. The description of the environmental baseline (both maps and text) and Strategic Environmental Objectives (SEOs) are used in the evaluation of alternatives. Carlow County Council in preparing the Local Area Plan 2016-2022 developed three alternative development strategies for Tullow as follows: x Development Scenario 1: A general continuation in accordance with the development objectives of the current 2010 – 2016 Plan; x Development Scenario 2: To provide high density residential, retail and employment development on vacant key opportunity sites and limited consolidation of the town centre, and; x Development Scenario 3: To consolidate and strengthen the town centre and provide for the limited expansion of Tullow on the outskirts of the town in a phased manner. These alternatives are detailed on Table 6.1 below and mapped on Figure 6.1, Figure 6.2 and Figure 6.3. CAAS for Carlow County Council 46 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Table 6.1 Description of Alternative Development Strategies Alternative Development Strategy 1 Alternative Development Strategy 2 Alternative Development Strategy 3 Summary Development Scenario 1: A general continuation in Development Scenario 2: Directs new development to Development Scenario 3: To consolidate and accordance with the development objectives of the vacant and infill sites in the town only. strengthen the town centre and provide for the current 2010 – 2016 Plan limited expansion of Tullow on the outskirts of the town in a phased sustainable manner. Features x Peripheral areas of lands zoned for residential / x Consolidation of the existing town centre by x Consolidation of mixed uses in Town enterprise and employment development on the encouraging the development of vacant or Centre zoning encouraging the outskirts of the town, with no direct link to the underutilised sites such as the vacant car park development of underutilised sites in a town centre. opposite the Civic offices on the New Link Road, sensitive and appropriate manner. in a sensitive and appropriate manner. x Emphasis on regeneration of Market x Seek investment to improve existing pedestrian Square and Bridge Street in the town provision within the town and also to the town x New residential development restricted to centre. centre from peripheral areas where pedestrian existing vacant properties within the town, x Residential development is phased access is limited. individual infill sites and unfinished residential outward from the town centre with housing estates i.e. where dwellings are partially opportunities for new residential x Extensive area of land zoned residential to the completed. development provided closer to the town north, west, south east and north west of the centre. No new areas of residential or town environs. x Lands in the west and south west of the Plan commercial on the periphery of the area, in particular out the Bunclody Road, zoned development envelope. x Extensive area of land zoned enterprise and primarily for Enterprise and Employment uses. x Encourage new retail / commercial employment to the south western outskirts of the development within the town centre. town. x Seek improvement of pedestrian links to enhance the character and accessibility x An expansive town centre area which dilutes the within the town by greater linkages importance of the centre of the town around throughout. Market Square and Bridge Street. x Maximising the potential of the River Slaney, through the creation of a mix of x Accessibility to the backlands of Tullow town uses, high quality public realm and public centre. spaces. x Adequate lands zoned for Industrial and x Proposed link road in order to reduce traffic Enterprise and Employment. congestion in the town centre along Market Square and Bridge Street. CAAS for Carlow County Council 47 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 6.1 Alternative Development Strategy 1 CAAS for Carlow County Council 48 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 6.2 Alternative Development Strategy 2 CAAS for Carlow County Council 49 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 6.3 Alternative Development Strategy 3 CAAS for Carlow County Council 50 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 7 Evaluation of Alternatives degree and significant adverse 7.1 Methodology effects would be less likely; o Interactions that would conflict The description of the environmental baseline the most with status of SEOs - together with the maps provided in Section 4 of these would be likely to be this report (including the Environmental mitigated to a lesser degree Sensitivity Overlay Mapping) is used in the and significant adverse effects evaluation. would be more likely. Strategic Environmental Objectives (SEOs) identified in Section 5 and reproduced overleaf are also used. The provisions of the alternatives are evaluated using compatibility criteria (see Table 7.2 below) in order to determine how they would be likely to affect the status of the SEOs. The SEOs and the alternatives are arrayed against each other to identify which interactions - if any - would cause effects on specific components of the environment. Where the appraisal identifies a likely conflict with the status of an SEO the relevant SEO code is entered into the conflict column - e.g. B1 which stands for the SEO likely to be affected - in this instance ‘to ensure compliance with the Habitats and Birds Directives with regard to the protection of Natura 2000 Sites and Annexed habitats and species17’. The interactions identified are reflective of likely significant environmental effects18; 1. Interactions that would be likely to improve the status of a particular SEO would be likely to result in a significant positive effect on the environmental component to which the SEO relates. The extent of positive effects which would be likely to occur varies and there are two ‘likely to improve columns’ (see Table 7.2) 2. Interactions that would potentially conflict with the status of an SEO and would be likely to be mitigated are divided into two groups: o Interactions that would conflict the least with the status of SEOs – these would be likely to be mitigated to a greater 17 ‘Annexed habitats and species’ refers to those 18 These effects include secondary, cumulative, listed under Annex I, II & IV of the EU Habitats synergistic, short, medium and long-term permanent Directive and Annex I of the EU Birds Directive. and temporary, positive and negative effects. CAAS for Carlow County Council 51 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Table 7.1 Strategic Environmental Objectives20 SEO Code SEO B1 To ensure compliance with the Habitats and Birds Directives with regard to the protection of Natura 2000 Sites and Annexed habitats and species19 B2 To ensure compliance with Article 10 of the Habitats Directive with regard to the management of features of the landscape which - by virtue of their linear and continuous structure or their function act as stepping stones - are of significant importance for wild fauna and flora and/or essential for the migration, dispersal and genetic exchange of wild species B3 To avoid significant impacts on relevant habitats, species, environmental features or other sustaining resources in designated sites including Wildlife Sites and to ensure compliance with the Wildlife Acts 1976-2010 with regard to the protection of species listed on Schedule 5 of the principal Act PHH1 To protect populations and human health from exposure to incompatible landuses S1 To avoid damage to the hydrogeological and ecological function of the soil resource W1 To maintain and improve, where possible, the quality and status of surface waters W2 To prevent pollution and contamination of ground water W3 To comply as appropriate with the provisions of the Flood Risk Management Guidelines M1 To serve new development with adequate and appropriate waste water treatment M2 To serve new development with adequate drinking water that is both wholesome and clean M3 To reduce waste volumes, minimise waste to landfill and increase recycling and reuse C1 To reduce travel related emissions to air and to encourage modal change from car to more sustainable forms of transport CH1 To protect archaeological heritage including entries to the Record of Monuments and Places and/or their context CH2 To protect architectural heritage including entries to the Record of Protected Structures and their context L1 To avoid significant adverse impacts on the landscape Table 7.2 Criteria for appraising the effect on SEOs Likely to Likely to Least Potential More Potential Probable No Improve status Improve status Conflict with Conflict with Conflict with significant of SEOs to a of SEOs to a status of SEOs - status of SEOs - status of SEOs- interaction greater degree lesser degree likely to be likely to be unlikely to be with status of mitigated to mitigated to mitigated SEOs greater an degree, intermediate significant degree, adverse effects significant less likely adverse effects more likely 19 ‘Annexed habitats and species’ refer to those listed under Annex I, II & IV of the EU Habitats Directive and Annex I of the EU Birds Directive. 20 See Section 5 for a description of Strategic Environmental Objectives. CAAS for Carlow County Council 52 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 7.2 Cumulative Effects Cumulative effects are one of the types of effects that have been considered in the assessment of the alternatives. Cumulative effects can be described as the addition of many small impacts to create one larger, more significant, impact. There are two types of potential cumulative effects that have been considered, namely: x Potential intra-Plan cumulative effects - these arise from the interactions between different types of potential environmental effects resulting from a Plan, programme etc. Where there are elevated levels of environmental sensitivities, future development could result in environmental conflicts and lead to a deterioration in environmental integrity. The interrelationships between environmental components that help determine these potential effects are identified on Table 8.4 in Section 8 e.g. interrelationships between: human health and water quality; human health and air quality; human health and flood risk; and ecology and water quality. x Potential inter-Plan cumulative effects - these arise when the effects of the implementation of one plan occur in combination with those of other plans, programmes, developments, etc. Effects that may arise as a result of implementing the Plan have been mitigated to the extent that the only residual adverse effects likely to occur as a result of implementation of the Plan are those that are identified under Section 8.7. With regard to potential inter-Plan cumulative environmental effects, these occur as a result of the combination of: potential environmental effects that are identified by the assessment; and the effects arising from other legislation, plans, programmes or developments arising. In considering the relationship with legislation and other plans and programmes it is important to note that the Plan will be implemented within areas that have existing plans and programmes (see Appendix I, Section 4, Section 5 and Section 9 of this report) for a range of sectors at a range of levels (e.g. National, River Basin District, Regional, County and Local) that are already subject to more specific higher and lower tier SEA and AA. The assessment of the likely inter-Plan cumulative environmental effects requires knowledge of the likely effects of all plans/developments under consideration. The assessment is limited in this instance as there has been limited assessment of the likely types of developments provided for by other policies, plans and programmes that could occur in combination with the implementation of the Plan. Where they exist, the SEA recognises the existence of other environmental assessments with a view to avoid duplication of assessment, in compliance with the SEA Directive. The SEA undertaken for the Plan has taken account of the Council’s obligation to comply with all environmental legislation and align with and cumulatively contribute towards – in combination with other users and bodies and their plans etc. – the achievement of the objectives of the regulatory framework for environmental protection and management. Cumulative effects that have been considered include those resulting from the Draft Plan and: x Other land use Plans (e.g. the Carlow and Wicklow County Development Plans); x Water services, transport and energy infrastructure plans (e.g. Irish Water’s Water Services Strategic Plan and associated Capital Investment Plan 2014-2016, Grid25 and associated Implementation Programme) and the emerging County Carlow 2021 Local Economic & Community Plan 2016-2021; and x Environmental protection and management plans (e.g. South East River Basin Management Plans and flood risk management plans). CAAS for Carlow County Council 53 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Such potential cumulative effects include the following (note that these will be mitigated by provisions that have been integrated into the Draft Plan): x Contributions towards reductions in travel related greenhouse gas and other emissions to air (in combination with plans and programmes from all sectors, including transport and land use planning) as a result of consolidating development and facilitating sustainable mobility/a shift from motorised transport modes to more sustainable and non-motorised transport modes. x Contributions towards travel related greenhouse gas and other emissions to air (in combination with plans and programmes from all sectors, including transport and land use planning) as a result of facilitating development that must be accompanied by road capacity. x Facilitation of new development that is accompanied by appropriate levels of water services thereby contributing towards environmental protection. x Need for and use of water and wastewater treatment capacity arising from new developments and associated potential adverse effects. x Potential cumulative effects upon surface and ground water status as a result of development including housing and employment – loadings and abstractions; x Potential cumulative effects (habitat damage, enhancing ecological connectivity, contributing towards sustainable mobility) arising from linear developments, such as those relating to Green Infrastructure; x Potential cumulative effects on flood risk by, for example, development of greenfield lands; x Potential cumulative visual impact of development at the interface between the LAP boundary and the surrounding area of the County which is subject to the provisions of the County Development Plan; and x In combination with plans and programmes from all sectors potential adverse effects on all environmental components arising from all development in greenfield and brownfield areas (e.g. infrastructural, residential, economic, agricultural etc.). The type of these effects are consistent with those described on Table 7.3. These plans and programmes from other sectors undergo SEA and comply with environmental legislation while projects are subject to EIA and AA, as relevant. CAAS for Carlow County Council 54 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 7.3 Potentially Significant Adverse Effects A number of potentially significant adverse environmental effects that are common to all alternatives and are described on the Table below. For the chosen alternative, these effects are mitigated by measures that have been integrated into the Plan. Table 7.3 Potentially Significant Adverse Environmental Effects common to all alternatives Environmental Component Likely Significant Effect, if unmitigated Biodiversity and Flora and Fauna o Loss of biodiversity with regard to designated biodiversity and flora and fauna (including Natura 2000 Sites, proposed Natural Heritage Areas and Annexed habitats and species), ecological connectivity and stepping stones and non-designated biodiversity and flora and fauna (see baseline Section 4.2) Population and Human Health o Spatially concentrated deterioration in human health (see baseline Section 4.3) Soil o Adverse impacts on the hydrogeological and ecological function of the soil resource (see baseline Section 4.4) (especially soil on greenfield lands) Water o Adverse impacts upon the status of water bodies arising from changes in quality, flow and/or morphology (see baseline Sections 4.5) o Increase in flood risk (see baseline Section 4.5.6) (including the River Slaney and its tributaries and underlying groundwater) Material Assets o Failure to provide adequate and appropriate waste water treatment (see baseline Section 4.7.1) (it is the function of Irish Water to o Failure to comply with drinking water regulations and serve new provide for water services needs) development with adequate drinking water that is both wholesome and clean (see baseline Section 4.7.1) o Increases in waste levels (see baseline Section 4.7.2) Air and Climatic Factors o Failure to contribute towards sustainable transport and associated impacts (energy usage and emissions to air including noise and greenhouse gases) (see baseline Section 4.6) Cultural Heritage o Effects on entries to the Record of Monuments and Places and other archaeological heritage (see baseline Section 4.8.2) o Effects on entries to the Records of Protected Structures and other architectural heritage (see baseline Section 4.8.3) Landscape o Occurrence of adverse visual impacts (see baseline Section 4.9) CAAS for Carlow County Council 55 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 7.4 Comparative Evaluation of all Alternative Development Strategies Alternative Development Strategy 1 would contribute towards efforts to improve sustainable mobility21 (and associated effects on energy, air, noise and human health) by improving existing pedestrian access and the development of a proposed relief road, however: such a contribution would be outweighed by the overall direction of the Strategy which prefers an expansion of peripheral areas for residential, mixed use, industrial and commercial uses, some of which have no direct link to the town centre. The extent of development provided for would have to be served by infrastructure22 and could affect flood risk23. By providing significant expansion of suburbs of the town and peripheral areas, this alternative would be likely to result in the greatest number and extent of residual adverse effects across the widest area. Such effects include loss of ecology (including non-designated ecology and ecological corridors and stepping- stones), the sealing of greenfield soils and threats to the status of waters24. This Scenario would provide for various uses on greenfield lands in the peripheries of the plan area, adversely impacting upon the consolidation of the town and sustainable mobility. The visual appearance of peripheral greenfield areas within the LAP area would be most likely to change under this scenario25. Alternative Development Strategy 2 directs new development to vacant and infill sites in the town only. By consolidating the existing town centre and improving connectivity, this alternative would contribute towards efforts to both improve sustainable mobility26 (and associated effects on energy, air, noise and human health), protect cultural heritage27 and improve the residential fabric within the town centre. However, by restricting new development to high density to vacant and infill sites, this alternative would be likely to result in an increase of applications for development outside the LAP area thereby weakening the town centre. It would be a challenge to serve peripheral areas with the necessary infrastructure28. The increase in applications for development within the periphery to the LAP area would provide for the greatest number and extent of residual adverse effects beyond the LAP area as a result of greenfield development. Such effects include loss of ecology (including non-designated ecology and ecological corridors and stepping-stones), the sealing of greenfield soils and threats to the status of waters29 and changes to the visual appearance of lands30. By encouraging an extent of development within the town centre, this alternative would somewhat contribute towards the protection and management of the environment elsewhere31, however the higher densities of development would have the potential to adversely impact upon the character of the town including cultural heritage and its context32. This alternative provides a significant amount of lands zoned primarily for Enterprise and Employment uses in the west and south west of the Plan area. The extent of lands zoned would be in significantly in excess of the needs of the town and would lead to unnecessary environmental effects on a variety of 21 SEOs C1 PHH1 22 SEOs M1 M2 M3 23 SEOs W3 PHH1 24 SEOs B1 B2 B3 S1 PHH1 W1 W2 W3 25 SEOs CH1 CH2 L1 26 SEOs C1 PHH1 27 SEOs CH1 CH2 L1 28 SEOs M1 M2 M3 29 SEOs B1 B2 B3 S1 PHH1 W1 W2 W3 30 SEO L1 31 SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 M1 M2 M3 C1 CH1 CH2 L1 32 SEOs CH1 CH2 L1 CAAS for Carlow County Council 56 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 environmental components as a result of greenfield development in this edge of town location. Such effects would include a hindrance of efforts to maximise sustainable mobility as well as adverse effects on non-designated biodiversity and visual impacts. Alternative Development Strategy 3 consolidates and strengthens the town centre and provides for the limited expansion of Tullow on the outskirts of the town in a phased sustainable manner. Consolidation of the town centre, phasing of residential development, improvement of pedestrian links and public spaces are all provided for. By providing for development in this manner, this alternative would maximise sustainable mobility33 (and associated effects on energy, air, noise and human health) and protect cultural heritage34 within the town centre. Overall, new development would be best served by existing and planned infrastructure under this scenario35. By limiting development within the Plan area and on the periphery of the development envelope, this alternative would benefit the protection of various environmental components (e.g. ecology, water, visual sensitivities etc.) beyond the LAP area that could otherwise be threatened36. Potential conflicts with all environmental components37 (detailed under Table 7.3) would still have to be mitigated to ensure that significant adverse residual environmental effects do not occur. This scenario provides for a greenbelt along the River Slaney that would contribute towards the protection of the status of the river including associated biodiversity38, however, provisions of the plan to maximise the potential of the River Slaney through the creation of a number of uses could potentially have adverse effects on the biodiversity for which the site is designated for 39. Table 7.4 below provides a comparative evaluation of the environmental effects of alternative development strategies against Strategic Environmental Objectives. This is supported by the narrative above and by effects that are common to all alternatives detailed on Table 7.3. 33 SEOs C1 PHH1 34 SEOs CH1 CH2 L1 35 SEOs M1 M2 M3 36 SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 M1 M2 M3 C1 CH1 CH2 L1 37 B1 B2 B3 PHH1 S1 W1 W2 W3 C1 M1 M2 M3 CH1 CH2 L1 38 SEOs B1 B2 B3 39 SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 C1 M1 M2 M3 CH1 CH2 L1 CAAS for Carlow County Council 57 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Table 7.4 Comparative Evaluation of Alternative Development Strategies Likely to Likely to Least More Probable No Alternative Improve Improve Potential Potential Conflict with significant Development status of SEOs status of SEOs Conflict with Conflict with status of SEOs- interaction Strategy to a greater to a lesser status of SEOs status of SEOs unlikely to be with status of degree degree - likely to be - likely to be mitigated SEOs mitigated to mitigated to greater an degree, intermediate significant degree, adverse significant effects less adverse likely effects more likely Alternative B1 B2 B3 B1 B2 B3 Development PHH1 S1 W1 PHH1 S1 W1 Strategy 1 W2 W3 C1 W2 W3 C1 M1 M2 M3 M1 M2 M3 CH1 CH2 L1 CH1 CH2 L1 Alternative B1 B2 B3 B1 B2 B3 Development PHH1 S1 W1 PHH1 S1 W1 Strategy 2 W2 W3 C1 W2 W3 C1 M1 M2 M3 M1 M2 M3 CH1 CH2 L1 CH1 CH2 L1 Alternative B1 B2 B3 B1 B2 B3 Development PHH1 S1 W1 PHH1 S1 W1 Strategy 3 W2 W3 C1 W2 W3 C1 M1 M2 M3 M1 M2 M3 CH1 CH2 L1 CH1 CH2 L1 CAAS for Carlow County Council 58 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 7.5.3 Land Use Zoning Map 7.5 The Selected including Constrained Alternative Land Use Zoning Development The Land Use Zoning map from the Draft Plan Strategy for the Draft that evolved from and which is consistent with Alternative Development Strategy 3 is shown Plan on Figure 7.1 overleaf. 7.5.1 Overview Also shown on this map is the constrained land use zoning objective (Policy HR 10B) for the The Draft Plan has been developed by the River Slaney cSAC. This Policy has been Planning Team and placed on public display by integrated into the Plan as there are a number the Council having regard to both: of overlaps between the area that is designated as cSAC and existing land use zoning 1. The environmental effects which were objectives. Policy HR 10B requires applications identified by the SEA and are detailed for development within the constrained land above; and use zoning objective for the Natura 2000 site 2. Planning - including social and (Map 13 – as shown on Figure 7.1 overleaf) to economic - effects that also were undergo Appropriate Assessment and considered by the Council. demonstrate that the proposal will not give rise to any effect on the Natura 2000 site in view of Potential adverse effects will be mitigated by its qualification features and conservation various provisions that have been integrated objectives. into the Draft Plan (see Section 9). 7.5.2 Selected Alternative Development Strategy The Alternative Development Strategy that was selected and developed for the Draft Plan was Strategy 3 - to consolidate and strengthen the town centre and provide for the limited expansion of Tullow on the outskirts of the town in a phased manner. However, the emerging Draft Plan was amended to include a significant extent of lands zoned for Enterprise and Employment uses in the west and south west of the Plan area. The extent of these lands zoned is significantly in excess of the needs of the town and would lead to unnecessary environmental effects on a variety of environmental components as a result of greenfield development in this edge of town location. Such effects would include a hindrance of efforts to maximise sustainable mobility as well as adverse effects on non- designated biodiversity and visual impacts. The alternative development strategy that has been placed on public display therefore is a mixture between Alternative Strategies 2 and 3. CAAS for Carlow County Council 59 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Figure 7.1 The Draft Plan Land Use Zoning Map CAAS for Carlow County Council 60 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 8 Evaluation of Plan Provisions 8.1 Overall Findings The overall findings are that: x The Draft Plan includes a significant extent of lands zoned for Enterprise and Employment uses in the west and south west of the Plan area. The extent of these lands zoned is significantly in excess of the needs of the town and would lead to unnecessary environmental effects on a variety of environmental components as a result of greenfield development in this edge of town location. Such effects would include a hindrance of efforts to maximise sustainable mobility as well as adverse effects on non-designated biodiversity and visual impacts. x The Council have integrated all recommendations arising from the SEA, Appropriate Assessment (AA) and Strategic Flood Risk Assessment (SFRA) processes into the Plan, facilitating compliance of the Plan with various European and National legislation and Guidelines relating to the environment and sustainable development. x Plan provisions would be likely to result in significant positive effects upon the protection and management of the environment (including all environmental components; biodiversity, fauna, flora, population, human health, soil, water, air, climatic factors, material assets, cultural heritage including architectural and archaeological heritage, landscape). x Some Plan provisions would have the potential to result in significant negative environmental effects (these will be described in the reports) however these effects will be mitigated by the mitigation measures that have been integrated into the Plan (see Section 9). 8.2 Methodology This section evaluates the provisions of the Plan. The description of the environmental baseline together with the maps provided in Section 4 of this report (including the Environmental Sensitivity Overlay Mapping) is used for this purpose. Strategic Environmental Objectives (SEOs) identified in Section 5 and reproduced overleaf are also used. The provisions of the Plan are evaluated using compatibility criteria (see Table 8.1 below) in order to determine how they would be likely to affect the status of the SEOs. The SEOs and the provisions of the Plan are arrayed against each other to identify which interactions - if any - would cause effects on specific components of the environment. Where the appraisal identifies a likely conflict with the status of an SEO the relevant SEO code is entered into the conflict column - e.g. B1 which stands for the SEO likely to be affected - in this instance ‘to ensure compliance with the Habitats and Birds Directives with regard to the protection of Natura 2000 Sites and Annexed habitats and species40’. The interactions identified are reflective of likely significant environmental effects41: 1. Interactions that would be likely to improve the status of a particular SEO would be likely to result in a significant positive effect on the environmental component to which the SEO relates. 2. Interactions that would probably conflict with the status of an SEO and would be unlikely to be mitigated would be likely to result in a significant negative effect on the environmental component to which the SEO relates. 40 ‘Annexed habitats and species’ refers to those listed under Annex I, II & IV of the EU Habitats Directive and Annex I of the EU Birds Directive. 41 These effects include secondary, cumulative, synergistic, short, medium and long-term permanent and temporary, positive and negative effects. CAAS for Carlow County Council 61 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 3. Interactions that would potentially conflict with the status of an SEO and would be likely to be mitigated would be likely to result in potential significant negative effects however these effects would be likely to be mitigated by measures which have been integrated into the Plan. The degree of significance of effects occurring cannot be fully determined at this level of decision making due to the lack of exact detail available with regard to the type or scale of development that will be permitted under the Plan. Mitigation measures to prevent or reduce significant adverse effects posed by the Plan are identified in Section 9 - these have been integrated into the Plan. Table 8.1 Criteria for appraising the effect of Plan provisions on SEOs Likely to Improve status of Probable Conflict with Potential Conflict with No Likely interaction with SEOs status of SEOs - unlikely to status of SEOs- likely to be status of SEOs be mitigated mitigated Table 8.2 Strategic Environmental Objectives42 SEO Code SEO B1 To ensure compliance with the Habitats and Birds Directives with regard to the protection of Natura 2000 Sites and Annexed habitats and species43 B2 To ensure compliance with Article 10 of the Habitats Directive with regard to the management of features of the landscape which - by virtue of their linear and continuous structure or their function act as stepping stones - are of significant importance for wild fauna and flora and/or essential for the migration, dispersal and genetic exchange of wild species B3 To avoid significant impacts on relevant habitats, species, environmental features or other sustaining resources in designated sites including Wildlife Sites and to ensure compliance with the Wildlife Acts 1976-2010 with regard to the protection of species listed on Schedule 5 of the principal Act PHH1 To protect populations and human health from exposure to incompatible landuses S1 To avoid damage to the hydrogeological and ecological function of the soil resource W1 To maintain and improve, where possible, the quality and status of surface waters W2 To prevent pollution and contamination of ground water W3 To comply as appropriate with the provisions of the Flood Risk Management Guidelines M1 To serve new development with adequate and appropriate waste water treatment M2 To serve new development with adequate drinking water that is both wholesome and clean M3 To reduce waste volumes, minimise waste to landfill and increase recycling and reuse C1 To reduce travel related emissions to air and to encourage modal change from car to more sustainable forms of transport CH1 To protect archaeological heritage including entries to the Record of Monuments and Places and/or their context CH2 To protect architectural heritage including entries to the Record of Protected Structures and their context L1 To avoid significant adverse impacts on the landscape 8.3 Appropriate Assessment and Strategic Flood Risk Assessment A Stage 2 Appropriate Assessment (AA) and a Strategic Flood Risk Assessment (SFRA) have both been undertaken alongside the preparation of the Plan. The requirement for AA is provided under the EU Habitats Directive (Directive 1992/43/EEC). The requirement for SFRA is provided under ‘The Planning System and Flood Risk Management Guidelines for Planning Authorities’ (DEHLG and OPW, 2009). 42 See Section 5 for a description of Strategic Environmental Objectives. 43 ‘Annexed habitats and species’ refer to those listed under Annex I, II & IV of the EU Habitats Directive and Annex I of the EU Birds Directive. CAAS for Carlow County Council 62 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 The AA concluded that the Plan will not affect the integrity of the Natura 2000 network44 and the SFRA has facilitated the integration of flood risk management considerations into the Plan. The preparation of the Plan, SEA, AA and SFRA has taken place concurrently and the findings of the AA and SFRA have informed both the Plan and the SEA. All recommendations made by the AA and SEA were integrated into the Plan. 8.4 Potential Adverse Effects and their Determination Environmental impacts which occur, if any, will be determined by the nature and extent of multiple or individual projects and site-specific environmental factors. Avoidance of conflict with SEOs and the environment is dependent upon compliance with the mitigation measures which have emerged through the SEA, AA and SFRA processes and which have been integrated into the Plan. The potentially significant adverse environmental effects arising from implementation of the Plan are detailed on Table 8.3 below. Environmental Component Likely Significant Effect, if unmitigated Biodiversity and Flora and Fauna o Loss of biodiversity with regard to designated biodiversity and flora and fauna (including Natura 2000 Sites, proposed Natural Heritage Areas and Annexed habitats and species), ecological connectivity and stepping stones and non-designated biodiversity and flora and fauna (see baseline Section 4.2) Population and Human Health o Spatially concentrated deterioration in human health (see baseline Section 4.3) Soil o Adverse impacts on the hydrogeological and ecological function of the soil resource (see baseline Section 4.4) (especially soil on greenfield lands) Water o Adverse impacts upon the status of water bodies arising from changes in quality, flow and/or morphology (see baseline Sections 4.5) o Increase in flood risk (see baseline Section 4.5.6) (including the River Slaney and its tributaries and underlying groundwater) Material Assets o Failure to provide adequate and appropriate waste water treatment (see baseline Section 4.7.1) (it is the function of Irish Water to o Failure to comply with drinking water regulations and serve new provide for water services needs) development with adequate drinking water that is both wholesome and clean (see baseline Section 4.7.1) o Increases in waste levels (see baseline Section 4.7.2) Air and Climatic Factors o Failure to contribute towards sustainable transport and associated impacts (energy usage and emissions to air including noise and greenhouse gases) (see baseline Section 4.6) Cultural Heritage o Effects on entries to the Record of Monuments and Places and other archaeological heritage (see baseline Section 4.8.2) o Effects on entries to the Records of Protected Structures and other architectural heritage (see baseline Section 4.8.3) Landscape o Occurrence of adverse visual impacts (see baseline Section 4.9) Table 8.3 Potential Adverse Effects 44 Except as provided for in Section 6(4) of the Habitats Directive, viz. There must be: (a) no alternative solution available; (b) imperative reasons of overriding public interest for the plan to proceed; and (c) adequate compensatory measures in place. CAAS for Carlow County Council 63 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 8.5 Interrelationship between Environmental Components The SEA Directive requires the Environmental Report to include information on the likely significant effects on the environment, including on issues such as biodiversity, fauna, flora, population, human health, soil, water, air, climatic factors, material assets, cultural heritage including architectural and archaeological heritage, landscape and the interrelationship between the above factors. Likely significant effects on environmental components that are identified include those that are interrelated; implementation of the Plan will not affect the interrelationships between these components. The presence of significant interrelationships between environmental components is identified on Table 8.4. CAAS for Carlow County Council 64 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Table 8.4 Presence of Interrelationships between Environmental Components Component Biodiversity, Population Soil Water Air and Material Cultural Landscape flora and and human Climatic assets heritage fauna health factors Biodiversity, No Yes Yes Yes Yes No Yes flora and fauna Population Yes Yes Yes Yes No No and human health Soil Yes No Yes No No Water No Yes No No Air and Yes No No Climatic factors Material Yes Yes assets Cultural Yes heritage Landscape CAAS for Carlow County Council 65 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 8.6 Cumulative Effects Please refer to Section 7.2 for specific consideration of cumulative effects – these are taken into account throughout the evaluation. 8.7 Residual Adverse Effects Section 9 outlines the measures that have mitigated and will mitigate the potential negative effects that are detailed above. Residual adverse effects likely to occur - considering the extent of detail provided by the Plan and assuming that all mitigation measures are complied with by development - are identified for each of the environmental components on Table 8.5 below. Table 8.5 Residual Adverse Effects Environmental Component Residual Adverse Effects Biodiversity and Flora and Fauna Loss of an extent of non-protected habitats arising from the replacement of semi-natural land covers with artificial surfaces Population and Human Health Flood related risks remain due to uncertainty with regard to extreme weather events Soil Loss of an extent of soil function arising from the replacement of semi-natural land covers with artificial surfaces Water Flood related risks remain due to uncertainty with regard to extreme weather events Air and Climatic Factors The Draft Plan includes a significant extent of lands zoned for Enterprise and Employment uses in the west and south west of the Plan area. The extent of these lands zoned is significantly in excess of the needs of the town and would lead to unnecessary environmental effects on a variety of environmental components as a result of greenfield development in this edge of town location. Such effects would include a hindrance of efforts to maximise sustainable mobility. Material Assets Residual wastes to be disposed of Architectural Heritage Potential alteration to the context and setting of architectural heritage (Protected Structures) however these will occur in compliance with legislation Archaeological Heritage Potential alteration to the context and setting of archaeological heritage (Recorded Monuments) however this will occur in compliance with legislation Potential loss of unknown archaeology however this loss will be mitigated by measures integrated into the Plan Landscape Designations The landscapes within and surrounding the town will change overtime as a result of natural changes in vegetation cover combined with new developments. The Plan contributes towards the protection of landscape designations. CAAS for Carlow County Council 66 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 8.8 Detailed Evaluation 8.8.1 Chapter 3 Vision and Development Strategy & Chapter 12 Land Use Zoning and Matrix Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Vision To provide a focused approach to planning for the future growth of Tullow in a coherent and spatial fashion which B1 B2 B3 PHH1 B1 B2 B3 PHH1 seeks to deliver high levels of employment and balances future sustainable development with the conservation and S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 enhancement of the town’s natural and built environment. M1 M2 M3 CH1 M1 M2 M3 CH1 CH2 L1 CH2 L1 Strategic Objectives The following are the Strategic Objectives for Tullow: B1 B2 B3 PHH1 B1 B2 B3 PHH1 1. To create vibrant integrated communities in a more consolidated urban form. S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 2. To create a thriving town which contributes to the natural and built heritage amenities of the town and M1 M2 M3 CH1 M1 M2 M3 CH1 provides a vibrant and vital mixed-use environment. CH2 L1 CH2 L1 3. To facilitate the creation of a sustainable vibrant economy which maximises the unique attributes of the town. Land Use Zoning and Matrix Land Use Zoning Objectives, Matrix & Map as detailed in Chapter 12 of the Plan B1 B2 B3 PHH1 B1 B2 B3 PHH1 S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 M1 M2 M3 CH1 M1 M2 M3 CH1 CH2 L1 CH2 L1 Commentary: The Plan’s high-level Vision, Strategic Object Environmental Objectives (SEOs) that is provided above is consistent with the evaluation of the preferred scenario that is prov and provide for the limited expansion of Tullow on the outskirts of the town in a phased manner. Consolidation of the town cent public spaces are all provided for. ives and Land Use Zoning are consistent with and contribute towards the preferred ided inalternative Section 7. scenario The Draft for Planthe consolidatesDraft Plan. The and evaluationstrengthens against the town Strategic centre re, phasing of residential development, CAAS for Carlow County Council 67 improvement of pedestrian links and SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 8.8.2 Chapter 4 Economic Development Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Economic Policies EC 1: To accelerate the sustainable development of Tullow through sustainable employment creation, in a structured B1 B2 B3 PHH1 B1 B2 B3 PHH1 and cohesive way, recognising its importance as a key driver of economic growth for south Carlow. S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 EC 2: To facilitate development agencies such as IDA Ireland, in partnership with Carlow County Council, to promote M1 M2 M3 CH1 M1 M2 M3 CH1 development of foreign-owned and indigenous sector higher value-added, knowledge based industrial and CH2 L1 CH2 L1 internationally traded activities. EC 3: To foster and support industry and enterprise in Tullow, including indigenous businesses. EC 4: To ensure the availability of lands for employment uses, allied to defined development needs and to develop same in conjunction with the relevant Development Agencies. EC 5: To promote innovative economic sectors and encourage clustering which positively exploits synergies between interconnected companies. EC 6: To facilitate and encourage the development of the alternative energy sector and to recognise its potential in the creation of Enterprise and opportunities. EC 7: To support and facilitate the development of start up enterprise units for local indigenous enterprises in Tullow. EC 8: To facilitate innovative work practices such as ‘live–work’ units where they do not negatively impact on residential amenity. EC 9: To improve access to major areas of employment through sustainable transport modes. EC 10: To support childcare facilities in appropriate locations thereby promoting labour market participation among parents and supporting parents in accessing employment, training and education. EC 11: To actively encourage the redevelopment of brownfield sites and re-use of disused buildings for enterprise and employment creation, subject to meeting Development Management Criteria as presented in the County Development Plan. EC 12: To encourage and facilitate at appropriate designated locations, small indigenous industries in recognition of their increasing importance in providing local employment and helping to stimulate economic activity. EC 13: To promote, protect, improve, encourage and facilitate the development of tourism in Tullow as an important contributor to job creation in the town. Economic Objectives ECO 1: To promote and facilitate the development of light industry, manufacturing, warehousing and logistics on lands B1 B2 B3 PHH1 B1 B2 B3 PHH1 zoned industry and warehousing. Developments must achieve a high standard of layout and design including S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 landscaping and screening and the delivery of a high quality working environment which is attractive to both customers M1 M2 M3 CH1 M1 M2 M3 CH1 and employees. CH2 L1 CH2 L1 ECO 2: To facilitate and promote the growth of the Industrial Estate on the south western side of the town, with a mix of employment uses within a high-quality landscaped development including office-based industry, enterprise and incubator units, business, science and technology. Commentary: These provisions provide a planning framework for economic develo of the preferred scenario that is provided in Section 7. The provision of all necessary to the provision of water services (and associated positive effects on the status of waters, ecology and human health - integrated with land use planning – and infrastructure in advance of sustainable development would facilitate both of the following appropriate levels of environmental Development that contributes towards the consolidation of the town (including the redevelopment of brownfield sites and re-use CAAS for Carlow County Council pment in Tullow. The 68 associated interactions with sustainabl evaluation against Strategic Environmental e mobility, emissions and energy usage ( Objectives (SEOs) that is provided above is consistent with the evaluation SEOs M1 M2 W1 W2 B1 B2 B3 PHH1 SEOs C1 PHH1 ). protection and management especially with respect of disused buildings) would: ) and the provision of transport infrastructure SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated x Help to maximise the uptake in smarter, more sustainable modes of transport and minimise transport related emissions (including SEOs C1 PHH1 x Contribute towards the protection of many environmental components outside of the town that would otherwise occur as a result o biodiversity and );flora and fauna, soil, water (including interactions with population and human health), landscape designations M2 M3 CH1 CH2 L1 x Make most use of existing wat fauna, soil and human health) ( The construction and operation); economic and developments has the potential to result in adverse effects upon all environmental comp been integrated into the Draft Plan, including those which are identified in Section 9 of this report. The potential adverse ef er services and drainage infrastr SEOs M1 M2 W1 W2 W3 B1 B2 B3 S1 PHH1 x Loss of biodiversity with regard to Natura 2000 Sites and Annexed habitats and species ( x Loss of biodiversity with regard to ecological connectivity and stepping stones ( x Loss of biodiversity with regard to designated ucture, subject to capacity being provided (including indirect be Spatially concentrated deterioration in human health ( x Damage to the hydrogeological and ecological function of the soil resource ( Adverse impacts upon the status and quality of water bodies ( ). indirect benefits with regard to the protection of human health x Increase in the risk of flooding ( Failure to provide adequate and appropriate waste water treatment ( x Failure to comply with drinking water regulationssites and including serve newWildlife development Sites and listedwith adequate species ( drinking water that is both wholesome and culturalf urban heritage generated ( development. Such components include is needed to ensure the mitigati x Increases in waste levels ( SEO W3 SEO PHH1 nefits with regard to the protection of water, biodiversity and flora and SEO B2 x Failure to contribute towards sustainable )transport and associated impacts) ( SEO B1 SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 M1 x Effects on entries to the Record of Monuments ) ) fects (ifonents unmitigated) however in these effects have been mitigated by provisions which have x Effects on entries to the Records onof Protectedof potential Structures conflicts) and otherSEOs architectural W1 W2 heritage ( SEO M3 SEO S1 x Occurrence of adverse visual impacts ( SEO B3 ) ) Policies in relation to Retail ) ) SEO M1 clude the following: EC 14: To protect and strengthen the retail primacy of Tullow within the County and more specifically within Eastern B1 B2 B3 PHH1 B1 B2 B3 PHH1 ; water services infrastructure and capacity is needed to ensure the mitigation of potential conflicts) Carlow. S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 EC 15: To encourage the development of the retail and serviceand Places role of and Tullow other as archaeological a self-sustaining heritage centre ( in accordance M1 M2 M3 CH1 M1 M2 M3 CH1 SEO L1 with the policies contained in the Carlow County Development Plan 2015-2021 and the Retail Planning Guidelines 2012. CH2 L1 CH2 L1 ) EC 16: To protect the retail function of the Core Shopping Area. SEO C1 EC 17: To sustain the vitality and viability of the main shopping area and to encourage measures; transport to infrastructureimprove its investment is needed to ensure the mitigation of potential conflicts) attractiveness. EC 18: To adhere to the provisions of the Sequential Approach in the consideration of retail applications located outside SEO CH1 of Core Retail Area. SEO CH2 ) and clean ( EC 19: To promote and facilitate the development of local markets devoted to the sale of local agricultural and) craft produce and support their role as visitor attractions. SEO M2 EC 20: To ensure that best quality of design is achieved for all proposed retail developments and that design respects ; water services infrastructure and capacity and enhances the specific characteristics of the town. EC 21: To pursue all avenues of funding to secure resources for the continued enhancement, renewal and regeneration of the public realm of the Town Centre. EC 22: To discourage non retail and excessive lower grade retail uses, such as, take-away’s and betting offices in the core retail area and other principal streets in the town centre, in the interests of maintaining and sustaining the retail attraction of the town centre. EC 23: To improve the public realm and support boutique style retailing in the town centre. CAAS for Carlow County Council 69 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated EC 24: To secure the continued consolidation of Tullow Town Centre through progressing the regeneration of backland and brown field areas in the town centre. EC 25: To encourage and facilitate the delivery of tourism related retail developments and initiatives in and around the Town Centre. Objectives in relation to Retail ECO 3: To maintain the role of Tullow’s town core area as the primary retail centre for convenience and local B1 B2 B3 PHH1 B1 B2 B3 PHH1 comparison shopping through continuing to develop the retail environment, the quality of the public realm, the range S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 of retail uses and to facilitate complementary uses to retail. M1 M2 M3 CH1 M1 M2 M3 CH1 ECO 4: To actively promote from a planning perspective, the range of specialist shops within the town core, which will CH2 L1 CH2 L1 contribute to the character of the town and attractiveness of the area as a destination for shopping. ECO 5: To seek to secure funding to implement environmental improvements for the town core area such as improving facilities for pedestrians, provision of a high quality streetscape, improved connectivity with adjoining residential areas and tourist attractions. Commentary: These retail development provisions from the Draft Plan set out the overall strategy for the future development of retailing in brownfield areas in the town. By providing for the development of retail (wh conflict with the full range of environmental components ( integrated into the Draft Plan (see Section 9). The evaluation against Strategic Environmental Objectives (SEOs) that is provid in Section 7. This scenario would contribute towards the protection of many environmental components ( PoliciesRetail in relation provisions to willTown contribute Centre towards Opportunity maximisingich would Sites encompasssustainable newmobility built and development associated an interactions with emissions to air, en EC 26: To promote the redevelopment and generation of strategic sites and vacant areas within and adjacent to the B1 B2 B3 PHH1 B1 B2 B3 PHH1 town centre to achieve a consolidated town with an intensity of development from the core to the edge. S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 M1 M2 M3 C1 CH1 CH2 L1 EC 27: To promote quality in architecture and urban design. M1 M2 M3 CH1 M1 M2 M3 CH1 EC 28: To encourage and facilitate the reuse and regeneration of vacant/ derelict land / buildings. The Council will use CH2 L1 CH2 L1 its powers, where appropriate, to consider such sites for inclusion in the Register of Derelict Sites. d the construction and operation of inf Commentary: the town and provide a focus on consolidation and regeneration of backland and These provisions in relation to Town Centre Opportunity Sites are consistent with and contribute towards the preferred alternat Objectives (SEOs) that is provi the limited expansion of Tullow on the outskirts of the town in a phased manner. Consolidation of the town centre,SEOs phasingB1 B2 B3 of PHH1r rastructureS1 W1 W2 to W3 service M1 M2this M3development), CH1 CH2 L1 these provisions would potentially all provided for. ). Potential adverse effects would be mitigated by measures that have been Policies in relation to Rural and Agricultural Development ed above is consistent with the evaluation of the preferred scenario that is provided EC 29: To promote an environmentallyded above sustainable is consistent agricultural with the evaluation/ horticultural of the sector, preferred which scenario contributes that tois aprovided dynamic in SectioB1 B2 B3 PHH1 B1 B2 B3 PHH1 and successful rural economy. S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 EC 30: To promote the diversification of the rural economy and the development of rural indigenous industry while M1 M2 M3ergy CH1 usage and human health ( M1 M2 M3 CH1 safeguarding the environment and role of the rural area as a strategic asset. CH2 L1 CH2 L1 Commentary: SEO C1 PHH1). Rural and agricultural development cumulatively contributes towards the selected alternative scenario for the Plan. Rural and a ). associated existing sustainable rural management practices that can often sustain biodiversity ( CAAS for Carlow County Council 70 ive scenario for the Draft Plan. The evaluation against Strategic Environmental n 7. The Draft Plan consolidates and strengthens the town centre and provide for esidential development, improvement of pedestrian links and public spaces are SEOs B1 B2 B3 ). The development of agriculture has the potential to adversely affect various environmental gricultural development is essential to the sustenance of rural populations and SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated components including biodiversity and flora and fauna ( heritage ( environmentally sustainable” and “safeguardingSEOs the CH1environment”. CH2 ), the landscape ( 8.8.3 Chapter 5 Housing and Sustainable Neighbourhoods SEO L1SEOs B1 B2 B3 ) and sustainable mobility patterns ( Likely to Improve Probable Conflict Potential Conflict No Likely ), water and human health ( status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Policies in relation to Housing SEO C1SEOs W1 W2 PHH1 HP 1: To monitor the scale, rate and location of newly permitted development to ensure compliance). withBoth theof thesecore provisionsB1 B2 B3 integrate PHH1 reference to the environment:B1 B2 “ B3 PHH1 strategy with regard to population targets in order to achieve the delivery of strategic plan led and coordinated balanced S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 ), the provision of appropriat development within the town. M1 M2 M3 CH1 M1 M2 M3 CH1 HP 2: To operate an order of priority for the release of residential lands to comply with the Core Strategy of the Carlow CH2 L1 CH2 L1 County Development Plan 2015-2021 as follows: (i) The lands identified as “New Residential – Phase 1” land use zoning objective maybe appropriate e water and waste services ( subject to compliance with the core strategy targets for residential development within the lifetime of this plan. (ii) The lands identified as “New Residential – Phase 2” land use zoning objective are not available for residential development within the lifetime of this LAP unless the Plan is reviewed / amended in SEOs M1 M2 M3 accordance with planning legislation. HP 3: To facilitate where appropriate residential development on appropriate infill / regeneration and town centre sites ), cultural in accordance with the principles of proper planning and sustainable development. HP 4: To have regard to the DoECLG Guidelines on ‘Quality Housing for Sustainable Communities – Best Practice Guidelines for Delivering Homes Sustaining Communities (2007); ‘Delivering Homes Sustaining Communities – Statement on Housing Policy’ (2007), ‘Sustainable Urban Housing: Design Standards for New Apartments’ (2007) and Sustainable Residential Development in Urban Areas’ and the accompanying Urban Design Manual: Best Practice Guide (2009). HP 5: To require that all new residential developments comply with the Housing Strategy and Development Management Standards of the Carlow County Development Plan 2015-2021 or as may be amended. HP 6: To encourage and foster the creation of attractive mixed-use sustainable neighbourhoods which contain a variety of housing types and tenures with supporting community facilities, public realm and residential amenities. HP 7: To promote the development of underutilised infill town centre sites and to facilitate high quality development which respects the design of surrounding development and the character of the area. HP 8: To require larger schemes to be developed in a phased manner ensuring that necessary community infrastructure is delivered in tandem with residential development. HP 9: To encourage strong frontages along main thoroughfares creating definite building lines and continuity of the structure of the town centre. HP 10: To ensure that new housing development close to existing houses reflect the character and scale of the existing houses unless there are exceptional design reasons for doing otherwise. HP 11: To require applications for residential development where appropriate to demonstrate the provision of an appropriate mix of dwelling types having regard to the following: x The nature of the existing housing stock and existing social mix in the area; x The desirability of providing mixed communities; CAAS for Carlow County Council 71 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated x The provision of a range of housing types and tenures; x The need to provide a choice of housing, suitable for all age groups and persons at different stages of the life cycle. HP 12: To promote more sustainable development through energy end use efficiency, increasing the use of renewable energy, and improved energy performance of all new development. HP 13: To ensure that all housing is designed in a way that is adaptable and flexible to the changing needs of the homeowner having regard to the Lifetime Homes Guidance contained in Section 5.2 of the Department of Environment, Community and Local Government ‘Quality Housing for Sustainable Communities – Best Practice Guidelines for Delivering Homes Sustaining Communities’ (2007). HP 14: To require compliance with Carlow County Council’s policy on the taking-in charge of residential developments. HP 15: To have regard to the DoECLG’s ‘Stakeholders Code of Practice, between the Representative Bodies Dealing with Unfinished Housing Developments (2011). HP 16: To restrict apartment developments generally to town centre locations or suitably located sites adjoining public transport connections. Apartments will not be permitted where there is an over concentration of this type of development. Higher density schemes will only be considered where they exhibit a high architectural design standard creating an attractive and sustainable living environment. HP 17: To seek the provision of high quality apartments where permitted within sustainable neighbourhoods by achieving appropriate floor area sizes and levels of amenity within each apartment development; and ensuring that suitable social infrastructure and other support facilities are available in the neighbourhood. HP 18: To discourage the demolition of habitable housing unless streetscape, environmental and amenity considerations are satisfied. HP 19: To resist the loss of residential use on upper floors and actively support proposals that retain or bring upper floors above ground floor premises into residential use. HP 20: To secure the implementation of the Carlow Housing Strategy 2011-2017 or any amendment or review thereto during the lifetime of this plan. HP 21: To promote the provision of appropriate accommodation for people with special needs including people with disabilities, students, travellers, the homeless and the elderly in conjunction with voluntary bodies and the private sector in accordance with the Carlow County Development Plan 2011-2017 (or as may be amended). HP 22: To support urban regeneration in order to enhance social cohesion and the potential for positive change. HP 23: To promote sustainable neighbourhoods which cater for the needs of persons of all stages in their lifecycle i.e. children, people of working age, elderly, people with disabilities. HP 24: To promote multi use of community facilities and outdoor shared spaces which are accessible to all. Such developments should be in accordance with the principles of universal design. Commentary: These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. The evaluati consistent with the evaluation of the preferred scenario that is outskirts of the town in a phased manner. Consolidation of the provided in Section 7. The Draft Plan consolidates and strengt town centre, phasing of residential development, improvement of CAAS for Carlow County Council 72 on against Strategic Environmental Objectiv hens the town centre and provide for the limited expansion of Tullow on the pedestrian links and public spaces are all provided for. es (SEOs) that is provided above is SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 8.8.4 Chapter 6 Town Centre, Landscape and Public Realm Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Policies in relation to Character Areas CA 1: To protect the traditional urban structure of streets and lanes in the town by maintaining historic building lines B1 B2 B3 PHH1 B1 B2 B3 PHH1 and minimising road and junction widening and, where appropriate, restoring historic building lines. S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 CA 2: To protect the historic urban fabric of fine plots and subdivisions by avoiding extensive consolidation of the plots M1 M2 M3 CH1 M1 M2 M3 CH1 and to promote narrow, deep plots in redevelopment proposals fronting the main streets. CH2 L1 CH2 L1 CA 3: To protect the integrity and character of important building groups in the town by ensuring that new development and redevelopment is compatible in terms of appearance and scale. CA 4: To protect features and sites of historical interest and their context setting in any development, through appropriate statutory and policy protection. Commentary: These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. The evaluati consistent with the evaluation of the preferred scenario that is the town. Land Uses Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 LU 1: To seek to attract a residential population and commercial activity in the town centre through high quality design S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 with a continuous street frontage with a variety of buildings, well maintained and attractive facades and active ground M1 M2 M3 CH1 M1 M2 M3 CH1 floors providing a pleasant and distinctive place. CH2 L1 CH2 L1 LU 2: To prioritise the use and enjoyment of the town street and spaces by pedestrians and cyclists while providing for all means of travel and increased provision of off-street parking.provided in Section 7. These pr LU 3: To promote the mixed use nature of the town and to preserve its role as the centre of business and commerce in Tullow. LU 4: To secure a broad base of employment and enterprise in the town through small, medium and large scale commercial development. ovisions contribute towards con LU 5: To require the inclusion of opportunities for mixed uses in new development in the town centre. LU 6: To reinforce tourism, related facilities and services and to actively market Tullow. LU 7: To retain and improve the existing housing stock in the town centre and focus on opportunities for a range of on against Strategic Environmental Objectiv solidation of the Plan area in a way that is sympathetic to the cultural heritage of household types in the town. LU 8: To investigate the feasibility of developing of water-related activities, subject to the requirements of the Habitats Directive. LU 9: To encourage town centre services, tourism and living along the river front. Objectives es (SEOs) that is provided above is LUO 1: To extend the existing pedestrian network and facilities and look at the possibility of cycling facilities. LUO 2: To provide small scale leisure / recreation facilities in the town centre, such as for example, a tennis court, basketball court, skate park. LUO 3: To require the integration of off-street car parking facilities in the redevelopment of large sites. Commentary: These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. In addition, and the protection and management of the environment, for example: x “high quality design” (policy LU 1) CAAS for Carlow County Council 73 these land use policies and objectives contribute towards sustainable development SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated x “prioritise the use and enjoyment of the town street x “subject to the requirements of the Habitats Directive” (policy LU 8) x “extend the existing pedestrian network and facilities and look The evaluation against Strategic Environmental Objectives (SEOs) that is provided above is consistent with the evaluation of th Policies in relation to Landscape L1: To contribute towards the protection of county and localand spaceslevel landscape by pedestrians designations and cyclists” from (policy incompatible LU 2) CH1 CH2 L1 B1 B2 B3 PHH1 developments. Proposals for development that have the potential to significantly adversely impact upon these S1 W1 W2 W3 designations shall be accompanied by an assessment of the potential landscape and visual impacts of the proposed C1 M1 M2 M3 development - demonstrating that landscape impacts have been anticipated and avoided to a level consistent with the at the possibility of cycling facilities” (objective LUO 1) sensitivity of the landscape and the nature of the designation. Commentary: This policy focuses on the protection an Streets and Movement Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 SM 1: To ensure that any new development is well connected to the rest of the town and is within a comfortable S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 walking distance. M1 M2 M3 CH1 M1 M2 M3 CH1 d management of visual impacts and would be SM 2: To seek to reduce clutter in the town centre and to make the town centre a pedestrian-friendly place by CH2 L1e preferred scenario that is provided CH2in Section L1 7. improving safety and comfort and improving pedestrian facilities such as street furniture, footpaths and crossings. SM 3: To improve the network of walking routes in and through the town centre and between notable features and attractions. SM 4: To utilise existing features such as the River Slaney as the focus and basis for developing walking routes connecting the town to its wider county context, subject to the requirements of the Habitats Directive. nefit the protection of the landscape ( SM 5: To reduce unnecessary vehicular traffic from the town centre. Objectives SMO 1: To designate off street car parking areas at key sites. SMO 2: To upgrade and resurface Market Square and possibly eliminate some car parking spaces outside the Bank of Ireland and increase pedestrian access to allow for temporary events such as fairs, farmers markets etc. L1) and archaeological and architectural heritage ( Commentary: These provisions are and management of the environment, for example: CH1 CH2 x “developmentconsistent is well connected with and contrito the rest of the town and is within a comfortable walking distance” (Policy SM 1) x “pedestrian-friendly… improving pedestrian facilities” (Policy SM 2) ). x “improve the network of wa x “subject to the requirements of th bute towards the preferred alternative scenario for the Draft Plan. In addition, The evaluation against Strategic Environmental Objectives (SEOs) that is provided above is consistent with the evaluation of th lking routes” (Policy SM 3) e Habitats Directive” (Policy SM 4) CAAS for Carlow County Council 74 these provisions will contribute toward s sustainable mobility and the protection e preferred scenario that is provided in Section 7. SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Public Spaces and Public Realm Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 PR 1: To promote diversity, structure and continuity in the public realm through the creation, maintenance and S1 W1 W2 W3 C1 S1 W1 W2 W3 C1 restoration of urban spaces such as streets and squares and to provide a pleasant sense of place and enclosure. M1 M2 M3 CH1 M1 M2 M3 CH1 PR 2: To prioritise the improvement of, and access to, subject to the requirements of the Habitats Directive, the CH2 L1 CH2 L1 waterfront area and the retail core for the enjoyment of both visitors and residents alike. Objectives PRO 1: To upgrade footpath and roadway surfaces where appropriate and seek removal of overhead wires. PRO 2: To enrich the local streetscape character through the provision of appropriate street paving, furniture and planting of street trees at appropriate locations. Commentary: These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. The evaluati consistent with the evaluation of the preferred 8.8.5 Chapter 7 Transportation and Movement scenario that is provided in Section 7. Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Transport Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 TP 1: To continue to promote a modal shift from private car use towards increased use of more sustainable modes of S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 transport such as cycling, walking and public transport and to implement the initiatives contained in Government’s M2 M3 C1 CH1 M2 M3 C1 CH1 “Smarter Travel, A Sustainable Transport Future 2009-2020”. CH2 L1on against Strategic Environmental ObjectivCH2 L1 TP 2: To improve the pedestrian environment and promote the development of a network of pedestrian routes which link residential areas with recreational, educational, employment and tourist destinations to create a pedestrian environment that is safe and accessible by all. TP 3: To support co-ordination by transport providers to promote linked up transport services enabling complete coverage of Tullow through the creation of an integrated transport hub. This will be developed by providing bus stops beyond Market Square, cycle parking stands at various locations in the town and by providing good pedestrian facilities es (SEOs) that is provided above is throughout Tullow. TP 4: Support the Government’s Electric Transport Programme 2008 – 2020 by facilitating the roll-out of battery charging infrastructure for electric vehicles at various locations throughout Tullow. Objectives TO 1: To provide appropriate facilities for pedestrians and for people with special mobility needs in line with the aims of the European Charter of Pedestrian Rights. TO 2: To promote and facilitate the provision of secure parking areas for bicycles in Tullow town centre and at key tourist attractions throughout the town. CAAS for Carlow County Council 75 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Commentary: The provisions of the Draft Plan relating to transport will primarily contribute towards maximising sustainable mobility and ass C1 PHH1 ). Directly (from the construction and operation of transport infrastructure) and indirectly (from facilitating non-transport deve (including in-combination effects across County borders) upon most environmental components including ecology ( risk ( SEO W3 PHH1 The provisions of the), culturalDraft Plan heritage relating ( to transport would also implementation of the preferred alternative scenario – both benefi Transportthat Infrastructure have been integrated into the Draft Plan (see Section 9) SEOs CH1 CH2 Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 TP 5: To ensure that the road and street network of Tullow is safe and convenient, that it has adequate capacity to S1 W1 W2 W3 M1 S1 W1 W2 W3 M2 ), the landscape ( accommodate motorised traffic and non-motorised movements, that it has a high environmental quality with M2 M3 CH1 CH2 M3 C1 CH1 CH2 appropriate adjacent development and built form, particularly in the case of urban streets and streetscapes, and that L1 L1 adequate parking facilities are provided to serve the needs of the town. SEO L1 contribute towards and support the preferred alternativeociated scena interactions with emissions to air, energy usage and human health ( In this regard, the principles, approaches and standards as set out in relevant national) and policy emissions shall informand energy future usage ( cial and potentially adverse - transport infrastructure and urban development. This shall include the and Spatial any Planningadditional and requirements National Roads Guidelines 2012, the Sustainable Residential Development in Urban Areas Guidelines for Planning Authorities 2009 and SEOs B1lopment) B2 B3 these provisions have the potential to result in significant adverse effects accompanying Urban Design Manual 2009, the Traffic Management Guidelines 2003, the Traffic and Transport Assessment Guidelines 2007, the Design Manual for Urban Roads and Streets (2013), the NRA Design Manual for Roads SEOs C1 PHH1 and Bridges (as appropriate to the regional road network outside areas subject to a reduced urban speedare contributed limit) and towards by the ), soil function ( arising through lower tier assess any updates or forthcoming guidelines in relation to street design and walking / cycling facilities. ). TP 6: To promote road and traffic safety measures in conjunction with relevant Government Departments and other SEO S1 rio (see details and evaluation at Section 7). Therefore, the effects arising from agencies through the provision of appropriate signage, minimising or removing existing traffic hazards and preventing ), the status of water bodies ( se provisions. Potential adverse effects would be mitigated by the measures the creation of additional or new traffic hazards. SEOs Objectives ments or granting of permission. TO 3: To investigate the feasibility of providing the Tullow Relief Road to facilitate by-passable traffic using the N81 SEOs W1 W2 or the R725, R726 or R418. TO 4: To continue to upgrade the condition of road and footpath surfaces in conjunction with the Council’s annual ), flood roads programme. TO 5: To monitor and upgrade, where necessary, the standard of public lighting throughout the town. TO 6: To investigate and seek the improvement of pedestrian facilities throughout the town. TO 7: To improve deficiencies in pavement surface, quality and general alignment and to protect future road lines where required. Commentary: See commentary under ”Transport” above. Public Transport Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 TP 7: To co-operate with public transport service providers to ensure that adequate public transport services are S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 provided to the town. M2 M3 C1 CH1 M2 M3 C1 CH1 TP 8: To support the provision of public transport services by reserving land in suitable locations for public transport CH2 L1 CH2 L1 infrastructure and ancillary facilities such as park-and- ride. Objectives CAAS for Carlow County Council 76 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated TO 8: To investigate the feasibility of providing a bus shelter either or both to the north of the town and to the south of the town. Commentary: See commentary under ”Transport” above. Traffic Management and Parking Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 TP 9: To monitor traffic movements in the town and to provide passive traffic calming measures at appropriate S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 locations as the need arises. M2 M3 C1 CH1 M2 M3 C1 CH1 TP 10: To ensure that new entrances are located in such a manner as to provide effective visibility for both users of CH2 L1 CH2 L1 the entrance and users of the public roads and footpaths throughout the town and its environs, so that opportunities for conflicting traffic movements are avoided, in the interests of public safety. Objectives TO 9: To examine the feasibility of providing additional off street car parking within and in close proximity to the town centre and to seek the provision of same following identification of suitable sites. TO 10: To provide accessible car parking spaces at appropriate locations throughout the town. Commentary: See commentary under ” Transport” above. 8.8.6 Chapter 8 Community, Social and Recreational Development Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Community Facilities Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 CF 1: To support and nurture intergenerational and cross cultural relationships through the development of community S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 initiatives such as community gardens / allotments. M2 M3 C1 CH1 M2 M3 C1 CH1 CF 2: To promote the development of sustainable communities on the basis of a high quality of life where people can CH2 L1 CH2 L1 live, work and enjoy access to a wide range of community, health and educational facilities suitable for all ages, needs and abilities. CF 3: To encourage high standards in the design and finishes of community facilities. CF 4: To optimise existing and proposed physical resources / infrastructure by supporting multi-functional building / facility use and provision. CF 5: To encourage the siting of community facilities in suitable locations, close to existing facilities / services and public transport routes. CF 6: To recognise the importance of community participation in the improvement of existing community and recreational facilities, and encourage increased involvement of local groups, both independently and in association with the relevant statutory bodies, in the future provision of such facilities. Carlow PPN structures are a vital source in terms of progressing community participation. CF 7: To consider the accommodation of small-scale community enterprise developments within existing and proposed community facilities, subject to appropriate design, layout and servicing. CAAS for Carlow County Council 77 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Objectives CFO 1: To endeavour to ensure that all community, social and recreational facilities are inclusive and accessible to all. CFO 2: To assist as far as possible in the provision of community facilities by reserving suitably located land and / or by the use of the development management process to ensure provision is made for such facilities as the Council considers appropriate. CFO 3: To continue to support and facilitate voluntary organisations in the town and environs. CFO 4: To advance social inclusion and community development by developing the co-ordinated delivery of services and facilities in Tullow. Commentary: These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. The evaluati consistent with the evaluation of the preferred Educational Facilities Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 EU 1: To facilitate and co-operate in the provision of schools, crèches and other education and childcare facilities. S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 EU 2: To facilitate the provision of continuing educational facilities which provide for lifelong learning for all, including M2 M3 C1 CH1 M2 M3 C1 CH1 the elderly. CH2 L1 CH2 L1 Objective scenario that is provided in Section 7. EUO 1: To actively assist and liaise with the Department of Education and Skills in the provision of new and additional school places as may be required. Commentary: These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. The evaluati consistent with the evaluation of the preferr Sports, Recreation and Play Policies B1 B2on B3 against PHH1 Strategic Environmental ObjectivB1 B2 B3 PHH1 SP 1: To maintain and enhance existing recreational facilities. S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 SP 2: To continue to co-operate with community and sports bodies in the development of recreational areas in the M2 M3 C1 CH1 M2 M3 C1 CH1 town. ed scenario that is provided in Section 7. CH2 L1 CH2 L1 SP 3: To prohibit the loss of existing public and private recreational open space unless alternative recreational facilities are provided at a suitable location. SP 4: To seek the provision of children’s play facilities in new residential developments where deemed appropriate. es (SEOs) that is provided above is SP 5: To seek that all sports halls and pitches/ community halls and centres are multi-functional. Objectives SPO 1: To endeavour to provide play spaces throughout the town. SPO 2: To encourage and facilitate the provision of adult amenities in parks such as table tennis, outdoor gyms, basketball courts, bowling greens and associated facilities etc. SPO 3: To involve children and young people in greening initiatives and biodiversity projects, having regard to their on against Strategic Environmental Objectiv need to interact with and be educated by nature. Commentary: These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. The evaluati consistent with the evaluation of the preferred es (SEOs) that is provided above is CAAS for Carlow County Council 78 scenario that is provided in Section 7. on against Strategic Environmental Objectiv es (SEOs) that is provided above is SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Policies in relation to Recreational Potential of the River Slaney RC 1: To facilitate where practicable the provision of cycle-ways / walkways along the River Slaney in co-operation B1 B2 B3 PHH1 B1 B2 B3 PHH1 with landowners, Waterways Ireland and government departments. Any proposed cycling or walking routes along the S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 River will be subject to Appropriate Assessment in accordance with the Habitats Directive. M2 M3 C1 CH1 M2 M3 C1 CH1 RC 2: To support the conservation of local angling waters and investigate the feasibility of developing these waters CH2 L1 CH2 L1 and associated infrastructure required to advance the sport in the town, subject to the requirements of the Habitats Directive. RC 3: To continue to co-operate with community and sports bodies in the development of the River Slaney for recreational uses. Projects shall have regard to the requirement for Appropriate Assessment in accordance with the Habitats Directive. Commentary: These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. In addition, x “Any proposed cycling or walking routes al x “, subject to the requirements of the Habitats Directive.” (Policy RC 2) x “Projects shall have regard to the requirement for Appropriate Assessment in accordance with the Habitats Directive.” (Policy R The evaluation against Strategic Environmental Objectives (SEOs) that is provided above is consistent with the evaluation of th ong the River and Canal will be such subject to Appropriate Assessment in accordance 8.8.7 Chapter 9 Utilities Infrastructure, Climate Change and Environmental Management Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs these provisions willbe contributemitigated towards mitigatedthe protection of Natura 2000 sites: Water Supply and Quality Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 with the Habitats Directive.” (Policy RC 1) WSP 1: To contribute towards the protection of existing and potential water resources, and their use by humans and S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 wildlife, including rivers, streams, groundwater and associated habitats and species in accordance with the M2 M3 C1 CH1C 3) M2 M3 C1 CH1 requirements and guidance in the EU Water Framework Directive 2000 (2000/60/EC), the European Union (Water CH2 L1e preferred scenario that is provided CH2in Section L1 7. Policy) Regulations 2003 (as amended), the European Communities Environmental Objectives (Surface Waters) Regulations 2009 (SI No. 272 of 2009), the Groundwater Directive 2006/118/EC and the European Communities Environmental Objectives (groundwater) Regulations, 2010 (S.I. No. 9 of 2010) and other relevant EU Directives, including associated national legislation and policy guidance (including any superseding versions of same). To also support the application and implementation of a catchment planning and management approach to development and conservation, including the implementation of Sustainable Drainage System techniques for new development. WSP 2: To support the implementation of the relevant recommendations and measures as outlined in the relevant River Basin Management Plan, and associated Programmes of Measures, or any such plans that may supersede same during the lifetime of the plan, as well as relevant recommendations contained in the Water Quality in Ireland 2010 – 2012 (EPA, 2015, and any updated/superseding document). Proposals for development would not have an unacceptable impact on the water environment, including surface waters, groundwater quality and quantity, river corridors and associated woodlands. Also to have cognisance of, where relevant, the EU’s Common Implementation CAAS for Carlow County Council 79 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Strategy Guidance Document No. 20 which provides guidance on exemptions to the environmental objectives of the Water Framework Directive. WSP 3: To facilitate Irish Water in providing water, sufficient in quantity and quality to serve the needs of the existing and future population of Tullow and to promote the sustainable management of the town’s water supply. WSP 4: To maximise the potential for beneficial re-use of water through rainwater harvesting systems and to reduce leakage to the minimum possible level in the water supply system through operational leak detection measures. WSP 5: To ensure that in the case of all new developments where public mains are available or likely to be available, the development will be required to connect into them subject to an agreement with Irish Water. WSP 6: To ensure that development will not be permitted in instances where there is insufficient capacity in the public water infrastructure. WSP 7: To ensure that development proposals comply with the standards and requirements of Irish Water in relation to water to facilitate proposed developments and to encourage all developers requiring a connection to the public water supply to contact Irish Water prior to submitting a planning application. WSP 8: To protect surface water and ground water resources and their associated habitats and species including fisheries and in particular Annex II listed species. Objectives WSO 1: To collaborate with Irish Water in contributing towards compliance with the European Communities (Drinking Water) Regulations (No.2) 2007 and ensure, that the water supply serving Tullow complies with the 48 parameters identified in these regulations. WSO 2: To facilitate the implementation of water conservation projects, which reduce consumption and leakage in existing water distribution systems, in co-operation with Irish Water. WSO 3: To require the adoption of water saving measures in new development proposals. Such measures may include: • Water butts to collect rainwater • Low flush and dual flush toilets • Low water use appliances • Rainwater harvesting. WSO 4: To have regard to the EPA publication ‘The Provision and Quality of Drinking Water in Ireland – A Report for the year 2014’ (and any subsequent update) in the maintenance of Tullow’s water source in conjunction with Irish Water. WSO 5: To seek the implementation of recommendations made by the EPA arising from any failure to meet drinking water standards and any enlistment on the EPA’s Remedial Action List in conjunction with Irish Water. WSO 6: To protect and safeguard the integrity of water supply facilities, installations and pipes. WSO 7: To facilitate the identification and securing of service corridors for any future new water supply for Tullow. WSO 8: To ensure that all proposals for the development of an upgrade to the water supply system will be screened for Appropriate Assessment in accordance with Article 6(3) of the Habitats Directive and where potential impacts to the integrity of the Natura 2000 network are identified, a Natura Impact Statement will be prepared. WSO 9: To implement the Water Services Investment Programme 2016 - 2021 and all subsequent Water Services Investment Programmes. Commentary: These provisions cover drinking water, wate soil ( SEO S1 ), human health ( In addition to facilitating the orderly development of the town water ( SEO PHH1 adverseSEO environmental M2 effects ( r quality, drainage infrastructure and waste water infrastructure and would benefit: For drinking water,) would abstraction contribute of towards water) and co theecology protection ( of human health ( CAAS for Carlow County Council SEOs B1 B2 B3 80 SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 M1 M2 M3 C1 CH1 CH2 L1 ); the provision of infrastructure ( as part of the preferred alternative scenario for the Plan (see uld conflict with the status of water bodi SEO PHH1 SEOs M1 M2 M3 ), ecology ( the protection of the environment including water resources ( es and aquatic ecology,SEO B1 forB2 example.B3 For); and w improvements in flood risk management ( ) upon various environmental components to arise during both construction – if required – and operation. ), status Sectionof waters 7), (the provision of waste water treatment ( SEO W1 W2 astewater, outflow could conflict with various components including the status of ), soil ( SEO W3 SEO S1 ). SEOs W1 W2 ). There would be potential for significant SEO M1 ), ) and safe drinking SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated water bodies, aquatic ecology and human health, for example. Such arising through lower tier assessments. Implementation of the River Basin Management Plans and their associated Programmes of Measures (including those relating to var to result in significant adverse environmental effects during construction and operation on most environmental components ( infrastructure are often constructed in ecologically and visually sensitive areas adjacent to the banks of rivers and streams. Wasteintegrated Water into the Draft Plan (see Section 9) Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 effects could be mitigated by me WW 1: To collaborate with Irish Water to ensure that public wastewater collection and treatment infrastructure fully S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 complies with the requirements of the Urban Waste Water Treatment Regulations 2001 and 2004, the Waste Water M2 M3 C1 CH1 M2 M3 C1 CH1 Discharge Regulations 2007 and the EC Surface Water Regulations 2009. CH2 L1 CH2 L1 WW 2: To promote, as appropriate, specific provisionsand by for measures the implementation arising from of lower the relevanttier assessments recommendations set out in the recent Urban Waste Water Treatment in 2014 Report (EPA, 2015), in conjunction with Irish Water.asures including those that h WW 3: Not to permit the development of zoned land unless sufficient waste water treatment capacity is available to conform to the objectives of the South East River Basin Management Plan. WW 4: To ensure the changeover from septic tanks to mains connections in all cases where this is feasible, and that ave been integrated into the Draft Plan and any additional requirements all new developments utilise and connect to the existing wastewater infrastructure. The provision of individual septic tanks and treatment plants within the Plan boundary will be strongly discouraged to minimise the risk of groundwater pollution. Where such facilities are permitted, full compliance with the 2009 EPA Code of Practice - Code of Practice ious types of infrastructure and management initiatives) have the potential Wastewater treatment and Disposal Systems serving single houses (p.e. 10), is required. SEOs B1 WW 5: To facilitate Irish Water in providing additional and improved wastewater treatment capacity by the upgrading Potential adverseB2 B3 PHH1effects S1would W1 be W2 mitiga W3 M2 M3 CH1 CH2 L1 of the Tullow Treatment Plant and to facilitate the provision and safeguarding of infrastructure corridors required to facilitate the sustainable development of the town. Objectives WWO 1: To co-operate with Irish Water in the provision of an improved sewerage network and sewage treatment capacity for Tullow. ted both by measures which have been WWO 2: To investigate the possible extension of the public sewerage system to any un-serviced areas within the Local Area Plan Boundary, in co-operation with Irish Water. ). These types of WWO 3: To ensure that any proposals for the development and /or upgrade of the Tullow waste water treatment plant and waste water network will be subject to Appropriate Assessment in accordance with Article 6(3) and 6(4) of the EU Habitats Directive. WWO 4: To ensure that all new developments shall be provided with separate foul and surface water networks. In redevelopments, combined systems shall be separated where feasible. Commentary: In addition to facilitating the orderly development of the town as part of the preferred alternative scenario for the Plan (see towards the protection of various environmental components including: o Human health ( o Biodiversity, flora and fauna ( There would be potentialo The for status signific of watersSEO PHH1( construction and operationo Soil ((outflow could conflict with various components including the status of water bodies, aquatic ecolog SEO S ); including those which have been integrated into the Draft Plan. 1). SEO W1SEO W2 B1 B2 B3 ant adverse environmental); and effects ( ); CAAS for Carlow County Council 81 SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 M1 M2 M3 C1 CH1 CH2 L1 Section 7), the appropriate treatment of waste water ( y and human health for example). Such effects could be mitigated by measures ) upon various environmental componentsSEO M1 to arise during both ) would contribute SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Flooding and SUDs Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 FL 1: To support, in co-operation with the OPW, the implementation of the EU Flood Risk Directive (2007/60/EC), the S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 Flood Risk Regulations (SI No. 122 of 2010) and the DoEHLG/OPW publication The Planning System and Flood Risk M2 M3 C1 CH1 M2 M3 C1 CH1 Management Guidelines for Planning Authorities 2009 and Departmental Circular PL2/2014 (or any CH2 L1 CH2 L1 updated/superseding legislation or policy guidance). Carlow County Council will also take account of the OPW Catchment Flood Risk Management Plans (CFRAMS) as appropriate, the Preliminary Flood Risk Assessment (PFRA) and the Strategic Flood Risk Assessment for County Carlow 2015 – 2021. FL 2: To have regard to the findings and recommendations of the current Strategic Flood Risk Assessment carried out for the Tullow Local Area Plan area. FL 3: To implement the use of the sequential approach and application of the Justification Tests for Development Management and Development Plans, during the period of this plan, as set out in the Flood Risk Management Guidelines as follows: 1) Avoid development that will be at risk of flooding or that will increase the flooding risk elsewhere, where possible; 2) Substitute less vulnerable uses, where avoidance is not possible; and 3) Justify, mitigate and manage the risk, where avoidance and substitution are not possible. Development should only be permitted in areas at risk of flooding when there are no alternative, reasonable sites available in areas at lower risk that also meet the objectives of proper planning and sustainable development. FL 4: To ensure that all developments have regard to the surface water management conditions contained within the SFRA and appropriate section of the Local Area Plan / County Development Plan. SW 1: To require the use of Sustainable Urban Drainage Systems in all new developments where appropriate. The following measures will apply; - The infiltration into the ground through the development of porous paving, swales and detention basins. - The holding of water in storage areas through the construction of green roofs, rainwater harvesting, detention basins, ponds and wetlands. - The slowdown of the movement of water. Objectives FLO 1: To ensure the implementation of the DoEHLG/OPW publication The Planning System and Flood Risk Management Guidelines for Planning Authorities 2009 (including its accompanying Technical Appendices) and including the Department of the Environment, Community and Local Government’s Circular PL 2/2014 (or any updated/superseding document) in relation to flood risk management within the plan area. FLO 2: To undertake a review of the SFRA following any subsequent alteration of flood mapping produced as part of the CFRAM. FLO 3: To ensure that Flood Risk Assessments are carried out for any development proposal, in accordance with the “Planning System and Flood Risk Management – Guidelines for Planning Authorities (DoECLG/OPW 2009). This assessment shall be appropriate to the scale and nature of risk to the potential development. FLO 4: To protect water bodies and watercourses within the plan area from inappropriate development, including the river, canal, streams, associated undeveloped riparian strips, wetlands and natural floodplains. A 10 metre strip on either side of such channel will be retained, where required, to facilitate access thereto. In addition, promote the sustainable management and uses of water bodies and avoid culverting or realignment of these features. SWO 1: To improve and extend where technically feasible and economically viable the surface water disposal infrastructure to serve all zoned land, in order to facilitate development. Commentary: Appropriate management of both storm and surface water and flood risk ( x Human health ( x Biodiversity, flora and fauna and cultural heritage ( SEO PHH1 CAAS for Carlow County Council 82 ); SEOs B1 B2 SEOB3 CH1 W3 CH2 ) would contribute towards the protection of various environmental components including: ); and SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated x Existing infrastructure and services ( Flood risk management infrastructure and the implementation of the CFRAM Study recommendations may have the potential to result operation on most environmental components ( into the Draft Plan (see Section 9) and by measures arising from lower tier assessments. SEOs M1 M2 M3 Policies and Objectives in relation to Climate Change Policies ) with resultant protection of the status of waters, soils, B1human B2 healthB3 PHH1 and ecology during flood eventsB1 ( B2 B3 PHH1 CCP 1: To recognise European and national objectivesSEOs for B1 climateB2 B3 adaptationPHH1 S1 andW1 workW2 W3with M2the M3EPA, CH1 the SouthernCH2 L1 S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 Regional Assembly and neighbouring planning authorities in implementing future Guidance for climate change proofing M2 M3 C1 CH1 M2 M3 C1 CH1 of landuse plan provisions as is flagged in the National Climate Change Adaptation Framework (DECLG, 2012). CH2 L1 CH2 L1 CCP 2: To support EU and national legislation and strategies on climate change in its decision making, in order to contribute to a reduction and avoidance of human induced climate change and to assist in achieving the national targets set out under the Kyoto Protocol (as updated). CCP 3: To support the National Climate Change Adaptation Framework 2012 (including any superseding document), the actions contained therein and any future local adaptation plan that relates to the draft plan area. Objectives ). Potential adverse effects would be mitigated both by measures which have been integrated CCO 1: To promote the integration of green infrastructure/networks (e.g. interconnected networks of green spaces /ecosystems) and other physical features on land into new development proposals in order to mitigate and adapt to in significant adverse environmental effects during construction and climate change. Commentary: SEOs W1 W2 S1 PHH1 B1 B2 B3 These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. The evaluati consistent with the evaluation ). The development of green infrastructure would facilitate: contri ( SEO W3 of the preferred scenario that (SEOs CH1) and CH2 protection L1 of human health ( The development of). green infrastructure potentially conflicts with most environmental components ( constructed in ecologically and visually sensitive areas is adjacent provided to in the Section banks 7. of rivers and streams. Potential adverse effects Waste Managementmeasures that have been integrated intoSEO other PHH1 provisions with Policies ); protectionbutions and towards management increases biodiversity in sustainable and mobilitywater quality and B1reduction ( B2 B3 PHH1 B1 B2 B3 PHH1 WMP 1: To support the minimisation of waste creation and to promote and encourage education and awareness on S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 all issues associated with waste prevention, minimisation, reuse, recycling and recovery, at household, industry and M2 M3 C1 CH1 M2 M3 C1 CH1 community level. CH2 L1 CH2 L1 WMP 2: To safeguard the environment by seeking to ensure that residual waste is disposed of appropriately. WMP 3: To seek to ensure that Tullow is served by adequate recycling facilities in the form of kerbside collection, civic on against Strategic Environmental Objectiv site and bring bank-recycling facilities and to adequately maintain existing recycling facilities. in the Draft Plan (see Section 9) WMP 4: To support the implementation of the Southern Waste Management Plan 2015-2021, Carlow County Council’s Litter Management Plan 2014 - 2017, the National Waste Prevention Programme, the EPA’s National Hazardous Waste SEOs B1s in B2 greenhouse B3 W1 W2 gas emissions ( Management Plan 2014-2020 and any superseding versions of these plans over the lifetime of this Local Area Plan. SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 M2 M3 CH1 CH2 L1 WMP 5: To seek to manage and dispose of construction waste in a way that ensures the provisions of the Waste and any additional requirements es (SEOs) that is provided above is Management Acts and new Southern Waste Management Plan 2015-2021. Construction Waste Management Plans will ); and protection cultural heritage and landscape sensitivities be implemented where relevant to minimise waste and ensure correct handling and disposal of construction waste SEO C1 (including in-combination effects across); increases County borders) in flood wouldrisk management be mitigated by CAAS for Carlow County Council arising through lower tier assessments or granting of permission. 83 ). This type of infrastructure is often SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated streams in accordance with the Best Practice Guidelines on the Preparation of Waste Management Plans for Construction and Demolition Projects, Department of the Environment, July 2006. Objectives WMO 1: To eliminate all unauthorised fly tipping and to regulate and control the disposal of all builders spoil and rubble. WMO 2: To assess the feasibility of additional recycling, including composting facilities in the town or environs at a location(s) that will not adversely affect residential amenity or environmental quality. WMO 3: To promote and facilitate communities to become involved in environmental awareness activities and community-based recycling initiatives or environmental management initiatives that will lead to local sustainable waste management practices. Commentary: These provisions provide for waste manageme levels ( by, interSEO alia, M3 measures which have been integrated into the Dr (PHH1 ) at the same time as presenting potential conflicts with various environmental components ( ) and various environmental components in The provision of waste management facilitiesnt. The( implementation of these provisions, including the construction and operation The provisions would contribute towards an Energyscenario and Communications are contributed to cluding air, soil, wa Policies aft Plan and the Regional Waste Management Plan – complianceB1 B2 B3wit PHH1 B1 B2 B3 PHH1 ECP 1: To support the provision of adequate energySEO andM3 communications infrastructure to service developments S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 including gas, electricity, broadband,wards and by telephone these provisions. services.) inIn certain particular, locationster, the and Council couldecology reduce supports ( transport the increased related useemissions of M2 ( M3 C1 CH1 M2 M3 C1 CH1 renewable energy and the aims of sustainable energyd support use and the conservation preferred alternative in building scenario design (seeand construction.details and evaluation CH2at Section L1 7 CH2 L1 Objectives SEOs B1 B2 B3 C1 W1 W2 S1 SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 M2 CH1 CH2 L1 ECO 1: To facilitate the provision of an adequate telecommunications infrastructure within the plan area, including telephone and broadband services, to the requirements of the relevant service providers and in accordance with the of waste management infrastructure, would facilitate the reduction of waste principles of proper planning and sustainable development. ECO 2: To facilitate the provision of an adequate supply of electricity and gas to developments in the plan area, to the ) h these measures would contribute towards the protection of human health requirements of the relevant service provider, and in accordance with the principles of proper planning and sustainable development. SEOs C1 PHH1 ECO 3: To require new buildings to be sustainable in their siting, orientation, design and construction. Passive solar design techniques, high energy efficiency, low impact construction methods and the use of local building materials ). ). These conflicts would be mitigated shall be encouraged to ensure that new developments minimise the environmental impacts and long term costs. ). Therefore, the effects arising from implementation of the preferred alternative ECO 4: To promote and facilitate the development of renewable sources of energy within the plan area and encourage the integration of micro-renewable energy sources into the design and construction of new developments, as appropriate. ECO 5: To seek to provide more public wi-fi zones in Tullow. ECO 6: To liaise with the ESB to investigate and encourage where possible the ducting and underground routing of overhead powerlines in Tullow in tandem with other work programmes, such as road resurfacing and footpath construction works. Commentary: These provisions relate to energy transmission, telecommunicati evaluation at Section 7). Therefore, the effects arising from implementation of the preferred alternative scenario are contribu CAAS for Carlow County Council 84 ons and renewable energy generation. The provisions would contri bute towards and support the preferred alternative scenario (see details and ted towards by these provisions. Energy and telecommunications measures will SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated help to provide a secure supply of energy to existing and new deve related infrastructure and ancillary developments have the potential to result in a variety of impacts including: x Loss of biodiversity with regard to Natura 2000 Sites and Annexed habitats and species ( x Loss of biodiversity with regard to ecological connectivity and stepping stones ( x Loss of biodiversity with regard to designated sites including Wildlife Sites and listed species ( x Spatially concentrated deterioration in human health ( x Damage to the hydrogeological and ecological function of the soil resource ( x Adverse impacts upon the status and quality of water bodies ( x Increase in the risk of flooding ( lopment. They will also contribute towards meeting renewable x Increases in waste levels ( x Effects on entries to the Record of Monuments x Effects on entries to the Records of Protected Structures and other architectural heritage ( SEO PHH1 x Occurrence of adverse visualSEO impacts M3SEO W3( The undergrounding of cables can result in elevated potential for impacts upon environmentalSEO B2 components including archaeologial ) ) ) SEO B1 ) ) SEOs W1 W2 Specific commentary on type and Places and other archaeologicalSEO S1 heritage (SEO B3 SEO L1 ) ) ) energy and greenhouse gas emission targets. Energy and communications Wind Energy ) Positive Effects: Contributions of towards renewable renewable energies: Potential Negative Effects, if unmitigated x Potential impacts include those associated with construction and SEO CH1 x Potential human health impact: shadow flicker, noise, SEO CH2 x Potential impact upon designated and non-designated ) ) x Potential interactions leading to change in stru x Potential impacts on water status during: constructionenergy and- this minimisation of greenhouse gases targets x Potential impacts upon the context of protected archaeological and architectural heritage - including the context of this herit x Potential impacts upon traffic during construction due to transportation of turbine components Changes to the character of areas would be likely to occur howev x and impacts arising from bog bursts and landslides areas and any cumulative effect arising from multiple wind farmsoperation of the turbines and ancillary facilities and infrast heritage and biodiversity. cture of biodiversitysoil and geology and floraand changesand fauna to including drainage birdlife Hydro-Energy Positive Effects: Contribution towards renewable Potential Negative Effects, if unmitigated: could interact with drinking water sources and biodiversity x Depending on the scale and location of the x Potential to impact upon the morphological, biological and chemical status of waters - this could interact with drinking water x Potential interactions leading to change in structure of soil and geologyer visual impacts would depend on various factors includingructure the (including roads and electrical infrastructure) x Operation could impact upon flood risk elsewhereenergy and minimisation of greenhouse gases targets x Potential impacts upon archaeological heritage or nearby architectural heritage, including context x Changes to the character of locations may occurdevelopment however there visual is impacts potential would for impacts depend to upon, inter alia, the size of the installat area Solar Energy age - as well as unknown archaeological heritage Positive Effects: Contribution Potential Negative Effects, if unmitigated: size, number and spacing of the turbines, perception of the relevant x Potential impacts on architectural heritage - including the context of this heritage - at micro occur scale on biodiversit x Potential impacts on habitatstowards and renewable species andenergy micro targets scale CAAS for Carlow County Council y, in particular a 85 quatic biodiversity sources (in freshwater) and biodiversity ion, ancillary facilities and the perc eption and visibili ty of the relevant SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated x Large scale installations may have visual impacts - th Bio Energy Positive Effects: Contribution towards renewable energy and mini Potential Negative Effects, if unmitigated: x Potential impact upon designated and non-designated biodiversity and flora and fauna arising from changes in vegetation. Soil s x Changes in farming practices may lead to changes in esedrainage would an depend on percep biodiversity x Potential human health impact: odour and noise from operation of plants x Potential impacts upon traffic during operation due to transportation of fuel to plants x Fuels derived from bio-mass still produce emissions howevermisation these areof greenhouse less than those tiongases ofderived targthe relevant from fossil area fuels x Changes to the land cover of areas could occur however visual x Biomass plants may have visual impacts - these Geo Thermal d runoff which could impact upon Positive Effects: Contribution towards renewable energy targets ets. Can provide for the use o Potential Negative Effects, if unmitigated: x Potential impacts upon the status of waters and ecology containe the aquifer and any dependent surface waters would- this could depend interact on percepti with drinking water sources biological and chemicalf statusagricultural and other wastes x Potential interactions leading to change in structure of soil and geologyimpacts would depend on perception of the relevant area; x Potential impacts upon archaeology, including unknown underground archaeology tructure may also be impacted upon. x Potential impacts upon on site water services on of the relevant area x Potential impacts upon context of archaeological and a of waters - - this could interact with drinking water sources and Noise, Air and Light Policies B1 B2 B3 PHH1 W3 C1 CH1 CH2 P 1: To promote the preservation of best ambient air quality compatible withd within, sustainable especially development arising from in accordance changes in theS1 temperature W1 W2 W3 of M1 L1 with the EU Ambient Air Quality and Cleaner Air for Europe (CAFE) Directive (2008/50/EC) and ensure that all air M2 M3 emissions associated with new developments are within Environmental Quality Standards as set out in the Air Quality Standards Regulations 2011 (SI No. 180 of 2011) (or any updated/superseding documents). rchitectural heritage arisin P 2: To seek to preserve and maintain good air and noise quality standards in Tullow in accordance with best practice and relevant legislation. P 3: To promote the preservation of best ambient air quality compatible with sustainable development. P 4: To seek the control of lighting of development in particular sensitive locations. g from surface installation groundwater which can impact upon the structure and ecology of P 5: To ensure that adequate soil protection measures are undertaken where appropriate. Appropriate investigations shall be carried out into the nature of any soil and groundwater contamination and the risks associated with site development works. Objectives PO 1: To assess proposals for development in terms of, inter alia, potential impact on existing adjacent developments, existing land uses and/or the surrounding landscape. Where proposed developments would be likely to have a significant adverse effect on the amenities of the area through pollution by noise, fumes, odours, dust, grit or vibration, or cause pollution of air, water and/or soil, the Council shall ensure the introduction of mitigation measures in order to eliminate adverse environmental impacts or reduce them to an acceptable operating level. PO 2: To ensure the implementation of the specific guidance on radon prevention measures for new homes as contained within the existing Building Regulations (including any updated/superseding regulations that may be published within the lifetime of this Plan). CAAS for Carlow County Council 86 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Commentary: These provisions primarily contribute towards the protection of the environment including that relating to human health, soil, management services ( SEOs PHH1 S1 W1 W2 M1 M2 M3 8.8.8 Chapter 10 Built and Natural Heritage ). Control of lighing will benefit ecology ( Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Policies in relation to Archaeological Heritage, Cultural Heritage, Industrial Heritage Archaeological Heritage SEO B1 B2 B3 B1 B2 B3 PHH1 B1 B2 B3 PHH1 HR 1: To contribute, as appropriate, towards the protection and sympathetic enhancement of archaeological heritage, S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 in particular by implementing the relevant provisions of the Planning and Development Act 2000 (as amended) and the ). M2 M3water, C1 emissionsCH1 to air and provision M2of appropriate M3 C1 CH1levels of water and waste National Monuments Act, 1930 (as amended). CH2 L1 CH2 L1 HR 2: To contribute, as appropriate, towards the protection of archaeological sites and monuments and their settings, archaeological objects and underwater archaeological sites that are listed in the Record of Monuments and Places, in the ownership/guardianship of the State, or that are subject of Preservation Orders or have been registered in the Register of Historic Monuments. Contribute, as appropriate, towards the protection and preservation of archaeological sites, which have been identified subsequent to the publication of the Record of Monuments and Places. HR 3: To ensure the implementation of the legislative, statutory and policy provisions relevant to the conservation of the built heritage including the following (and any updated/superseding documents): x Legislative provisions in the Planning and Development Act 2000 (as amended) and the National Monuments Act 1930 (as amended). x Statutory provisions in the Carlow County Development Plan, including the Record of Protected Structures. x Policy guidance in Government Policy on Architecture 2009-2015, the Architectural Heritage Protection Guidelines 2004/2011, the Archaeology and Development: Guidelines for Good Practice for Developers. HR 4: To acknowledge and promote awareness of the origins, historical development and cultural heritage of the town and to generally support high quality developments that relate to local heritage and to ensure that new development respects and is responsive to same. HR 5: To require an appropriate archaeological assessment to be carried out by licenced archaeologist in respect of any proposed development likely to have an impact on a recorded monument or its setting and to consult with the National Monuments Service of the Department of Arts Heritage and the Gaeltacht in relation to proposed developments adjoining archaeological sites. Cultural Heritage HR 6: To support and promote the development of cultural facilities in the town. Commentary: These provisions primarily contribute towards the protection of architectural and archaeological heritage ( By limiting the development of the settings of architectural and fauna, soil, water, human health and flood risk management ( CAAS for Carlow County Council 87 archaeological heritage, these provisions also have the potent SEOs B1 B2 B3 S1 PHH1 W1 W2 W3 SEOs CH1 CH2 ). ). ial to improve other environmental components including biodiversity, flora and SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated The development of cultural heritage facilities would have the potential to conflict with environmental components and would co evaluation at Section 7). Policies in relation to European Directives, Natura 2000 Network, Biodiversity and Designated Species, Trees, Hedgerows Woodlands and Non-Designated habitats and Species and Invasive and Non-Native Species European Directives, Natura 2000 Network, Biodiversity and Designated Species Policies B1 B2 B3 PHH1 M1 M2 M3 C1 HR 7: To contribute, as appropriate, towards the protection of designated ecological sites including candidate Special S1 W1 W2 W3 L1 CH1 CH2 Areas of Conservation (cSACs) and Special Protection Areas (SPAs); Wildlife Sites (including proposed Natural Heritage Areas); and Flora Protection Order sites. HR 8: To contribute towards compliance with relevant EU Environmental Directives and applicable National Legislation, Policies, Plans and Guidelines, including the following and any updated/superseding documents: - EU Directives, including the Habitats Directive (92/43/EEC, as amended)[1], the Birds Directive (2009/147/EC)[2], the Environmental Liability Directive (2004/35/EC)[3], the Environmental Impact Assessment Directive (85/337/EEC, as amended), the Water Framework Directive (2000/60/EC) and the Strategic Environmental Assessment Directive (2001/42/EC). - National legislation, including the Wildlife Act 1976[4], the European Communities (Environmental Impact Assessment) Regulations 1989 (SI No. 349 of 1989) (as amended), the Wildlife (Amendment) Act 2000, the European Union (Water Policy) Regulations 2003 (as amended), the Planning and Development Act 2000 (as ntribute towards and support the preferred alternative scenario (see details and amended), the European Communities (Birds and Natural Habitats) Regulations 2011 (SI No. 477 of 2011) and the European Communities (Environmental Liability) Regulations 2008[5]. - National policy guidelines (including any clarifying Circulars or superseding versions of same), including the Landscape and Landscape Assessment Draft Guidelines 2000, the Environmental Impact Assessment Sub- Threshold Development Guidelines 2003, Strategic Environmental Assessment Guidelines 2004 and the Appropriate Assessment Guidance 2010. - Catchment and water resource management Plans, including the relevant River Basin Management Plan. - Biodiversity Plans and guidelines, including Actions for Biodiversity 2011-2016: Ireland’s 2nd National Biodiversity Plan (including any superseding version of same). - Freshwater Pearl Mussel Regulations (S.I. 296 of 2009) (including any associated designated areas or management plans). - Ireland’s Environment 2014 (EPA, 2014, including any superseding versions of same), and to make provision where appropriate to address the report’s goals and challenges. HR 9: That all projects and plans arising from this plan45 (including any associated improvement works or associated infrastructure) will be screened for the need to undertake Appropriate Assessment under Article 6 of the Habitats Directive. A plan or project will only be authorised after the competent authority has ascertained, based on scientific evidence, Screening for Appropriate Assessment, and a Stage 2 Appropriate Assessment where necessary, that: (a)The Plan or project will not give rise to significant adverse direct, indirect or secondary effects on the integrity of any European site (either individually or in co (b)The Plan or project will have significant adverse effects on the integrity of any European site (that does not host a priority natural habitat type/and or a priority species) but there are no alternative solutions and the plan or project [1] Including Annex I habitats, Annex II species and their habitats and Annex IV species and their breeding sites and resting places (wherever they occur). [2] Including Annex I species and other regularlymbination occurring withmigr atoryother species,plans or andprojects); their habita or ts (wherever they occur). [3] Including protected species and natural habitats. [4] Including species of flora and fauna and their key habitats. [5] Including protected species and natural habitats. 45 Such projects include but are not limited to those relating to: agriculture; amenity and recreation; contaminated sites; electricity transmission; flood alleviation and prevention; forestry; mineral extraction; renewable energy projects; roads; telecommunications; tourism; wastewater and discharges; and water supply and abstraction. CAAS for Carlow County Council 88 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated must nevertheless be carried out for imperative reasons of economic nature. In this case, it will be a requirement to follow procedures set out in legislation and agree and undertake all compensatory measures necessary to ensure the protection of the overall coherence of Natura 2000; or ©The Plan or project will have a significant adverse effect habitat type and/or a priority be carried out for imperative reasons fo safety, to beneficial consequences of primary importance for the environment or, further to an opinion from the overriding public interest, incl Commission, to other imperative species) reasons but there of are no alternative solution procedures set out in legislation and agree and undertake HR 10: protection (a) Not to of permit the overall projects coherence giving rise of toNatura significant 2000. cumulative, direct, indirect or secondary impacts on Natura 2000 sites arising from their size or scale, landr overriding take, prox publicimity,on interest,theresource integrity restricted requirements, of any to European reasons emissions siteof human (that(disposal hosts health to a land,naturalor public uding those of a social or water or air), transportation requirements, duration of construction, operation, decommissioning or from any other on [6] the basis of this plan (either individually or in combination overriding with public other interest.plans or Inprojects this case,). it will be a requirement to follow (b) To require applications for development within the constrained lands and use the zoning plan or objective proj for the Natura 2000 site (Map 13) to undergo Appropriate Assessment and demonstrate that the proposal will not give rise to any effect on the Natura 2000 site in view of its qualification features and conservation objectives. ect must nevertheless HR 11: To facilitate the conservation, protection and enhancement of theall River compensatory Slaney including the measures adjacent wetlands necessary to ensure the and associated habitats and to ensure that development does not significantly adversely affect conservation values. HR 12: To seek the submission of an Ecological Impact Assessment for all development which may have a significant impact on the river and riparian habitats. This assessment should where appropriate suggest a minimum buffer of undisturbed vegetation to be retained to mitigate against pollution risks, reduce flooding potential, maintain habitats and provide an ecological corridor. The buffer zone shall, where possible be maintained free of development and hard surfaces. The assessment shall address protected species i.e. bats, otters including the requirement for derogation licences together with the cumulative impact of the proposed development. HR 13: To ensure that development does not have a significant adverse impact on plant species, animals and birds listed in the Flora Protection Order, Wildlife Act 1976 as amended, those listed in Annex IV of the Habitats Directive and those listed in Annex I of the Birds Directive. Trees, Hedgerows Woodlands and Non-Designated habitats and Species Policy HR 18: To promote the protection of trees, in particular native and broadleaf species, which are of conservation and / or amenity value. Development that requires the felling of mature trees of special interest will be discouraged. HP 19: To promote the protection and preservation of existing hedgerows, where appropriate and encourage planting of native hedgerow species. HP 20: To contribute towards the protection of non-designated habitats and species which are of local biodiversity significance Invasive and Non-Native Species Policy HR 21: To support as appropriate the National Parks and Wildlife Service’s efforts to seek to control the spread of non-native species on land and water and where appropriate seek the submission of an invasive species management plan. [6] Except as provided for in Section 6(4) of the Habitats Directive, viz. There must be: a) no alternative solution available, b) imperative reasons of overriding public interest for the project to proceed; and c) Adequate compensatory measures in place. CAAS for Carlow County Council 89 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Commentary: The provisions contribute towards the protection and management of the environment with interactions with most environmental components including: x Biodiversity, flora and fauna ( x Landscape ( x Waters ( SEO L1 x Soil ( SEOs W1 W2 ); x FloodSEO risk S1management ( SEOs B1 B2 B3 ); ); As there xare aHuman number health of overlaps ( between the area which is design ); zoning objective for the Natura 2000 site (Map 13 – as shown on SEO PHH1SEOs W3 site in view of its qualification features and conservation objectives. This benefits the protection of the River Slaney cSAC. ). ); and Policies in relation to Green Infrastructure HR 14: To encourage and facilitate, in consultation with relevant stakeholders, the development of green infrastructure B1 B2 B3 PHH1 B1 B2 B3 PHH1 M1 that recognises the synergies that can be achieved with regard to the following: S1 W1 W2 W3 S1 W1 W2 M3 • Provision of open space amenities CH1 CH2 L1 C1 CH1 CH2 M2 L1 ated as cSAC and existing land • Sustainable management of water Figure 7.1 overleaf) to undergo Appropriate Assessment and demo • Protection and management of biodiversity • Protection of cultural heritage • Protection of protected landscape sensitivities. use zoning objectives, Policy HR 15: To seek to contribute towards the protection and enhancement of biodiversity and ecological connectivity, including trees, hedgerows, rivers, streams, other landscape features and associated wildlife where these form part of the ecological network and/or may be considered as ecological corridors or stepping stones in the context of Article 10 of the Habitats Directive. HR 10B requires applications for development within the constrained land use HR 16: To explore the feasibility, subject to the requirements of the Habitats Directive, of developing a linear park, along the river Slaney, linking to areas of open space and amenity. Where lands are in private ownership it shall be nstrate that the proposal will not give policy, in any development proposal, to secure public access along the waterway. HR 17: To co-ordinate between open space, biodiversity and flood management, in progressing a green infrastructure network. Commentary: rise to any effect on the Natura 2000 The development of green infrastructure woul (SEO W3 (SEOs CH1) and CH2 protection L1 of human health ( The development of). green infrastructure potentially conflicts with most environmental components ( constructed in ecologically and visually sensitived facilitate: areas contributions adjacent to thetowards banks increase of rivers and streams. Potential adverse effects Built measuresand Natural that Heritagehave been Objectives integrated intoSEO other PHH1 provisions within HO 1: To safeguard and enhance all buildings of intrinsic );heritage protection value and within management Tullow and biodiversity its environs and and water to protect quality (B1 B2 B3 PHH1 B1 B2 B3 PHH1 M1 all existing Protected Structures, as set out in the Record of Protected Structures. S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 HO 2: To encourage the facilitation and active and appropriate reuse of vacant structures within the draft plan area. M2 M3 C1 CH1 M2 M3 C1 CH1 HO 3: To promote the planting of tree species which are suited to the Slaney landscapes in sustainable as part of mobility any public and reductionCH2 L1 CH2 L1 landscaping projects, or planting associated with developments. CAAS for Carlow County Council the Draft Plan (see Section 9) 90 SEOs B1s in B2 greenhouse B3 W1 W2 gas emissions ( SEOs B1 B2 B3 PHH1 S1 W1 W2 W3 M2 M3 CH1 CH2 L1 and any additional requirements ); and protection cultural heritage and landscape sensitivities SEO C1 (including in-combination effects across); increases County borders) in flood wouldrisk management be mitigated by arising through lower tier assessments or granting of permission. ). This type of infrastructure is often SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated HO 4: To promote educational and leisure activities such as bird watching, guided wildlife walks, photography, art etc. which increase awareness and appreciation of the Slaney River Valley but which will not result in significant disturbance to wildfowl and waders and will not have a negative impact on water quality, or on the condition of the protected habitats and species. HO 5: To develop a network of green corridors throughout the town interconnecting open space and extending out to the wider hinterland. HO 6: To assess the possibility of looped pedestrian and cycle routes along the river, the town centre and sites / facilities of interest in the town and its environs. Commentary: See commentary provided for policies above. 8.8.9 Chapter 11 Tourism Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated Policies and Objectives in relation to Tourism Policies B1 B2 B3 PHH1 B1 B2 B3 PHH1 TP 1: To seek to promote the status of Tullow as a popular place to live and visit, by striving to preserve the attributes S1 W1 W2 W3 M1 S1 W1 W2 W3 M1 and assets of the town that make it unique and by endeavouring to enrich the inhabitant/visitor experience by M2 M3 C1 CH1 M2 M3 C1 CH1 contributing positively towards enhancing the overall amenity, ambience and aesthetic of the town. CH2 L1 CH2 L1 TP 2: To promote and foster a growing sense of innovation and entrepreneurship in the tourism sector. TP 3: To encourage and support increased co-ordination, cohesion and linkages between agencies such as Failte Ireland, Carlow Tourism, Waterways Ireland, the Southern Regional Assembly and Transport Infrastructure Ireland. TP 4: To protect the natural resources upon which tourism is based through relevant policy in relation to resource protection, such as landscape character assessment, water quality and biodiversity. TP 5: To encourage, support, facilitate and promote the development and expansion of eco-tourism, geo and green tourism, industrial tourism sites and similar developments in the town, subject to no negative impacts on the environment. TP 6: To capitalise on potential tourist income by seeking to; - Improve the public realm creating a café culture supporting craft and artisan / deli style retailing in the town core and along the riverbank area. - Promote accommodation choices in the town. - Promote and capitalise on the town’s position on the River Slaney and its environs for long distance walking routes. TP7: To seek to manage any increase in visitor numbers to avoid significant effects including loss of habitat and disturbance, any projects are a suitable distance from the water’s edge and legislation relating to habitats, species, connectivity and designated sites is complied with. Objectives TO 1: To provide where feasible, and support the provision of tourism infrastructure and services, subject to the requirements of the Habitats Directive, including, walking, cycling and water based infrastructure and short-term guest accommodation facilities throughout the settlement in appropriate locations. CAAS for Carlow County Council 91 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Likely to Improve Probable Conflict Potential Conflict No Likely status of SEOs with status of with status of interaction with SEOs - unlikely to SEOs- likely to be status of SEOs be mitigated mitigated TO 2: To encourage and assist the sustainable development of the tourism potential of Tullow in a manner that respects, builds on, protects and enhances the cultural, built and natural heritage of the town and the local amenities within the plan area. TO 3: To work with bodies such as Transport Infrastructure Ireland, Failte Ireland and Carlow Tourism to improve signage both to the town itself from all approach routes, and throughout the town, so that all areas of interest are clearly indicated and accessible. TO 4: To support the provision and augmentation, of sporting, kayaking / canoeing and angling facilities, pony trekking routes, adventure centres and associated ancillary uses in appropriate locations subject to the requirements of the Habitats Directive. TO 5: To encourage the proportionate development of individual and multiple holiday home development schemes within existing adequately serviced sites/lands in the town. TO 6: To create a synergy between Tullow and the surrounding tourist attractions. Commentary: These provisions are consistent with and contribute towards the preferred alternative scenario for the Draft Plan. In addition, and the protection and management of the environment, for example: x “To protect the natural resources upon which tourism is based through relevant policy in relation to resource protection, such (Policy TP 4); x “geo and green tourism…subject to no negative x “To seek to manage any increase in visitor numbers to avoid si relating to habitats, species, connectivity and designated sites is complied with” (Policy TP7); and Thex evaluation“sustainable against development Strategic Environmental of the tourism Objectives potential…protects (SEOs) that and is provided e above is consistent with the evaluation of th impacts on the environment” (Policy TP 5); gnificant effects including loss nhances the cultural, built and natural heritage of these the town tourism an policies and objectives contribute towards sustainable development of habitat and disturbance, any as landscape character assessment, water quality and biodiversity” projects are a suitable distance from the water’s edge and legislation e preferredd scenariothe local thatamenities is provided within in the Section plan area”7. (Objective TO 2). CAAS for Carlow County Council 92 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 9 Mitigation Measures 9.1 Introduction Mitigation measures are measures envisaged to prevent, reduce and, as fully as possible, offset any significant adverse impacts on the environment of implementing the Plan. Various environmental sensitivities and issues have been communicated to the Council through the SEA, AA and SFRA processes. By integrating related recommendations into the Plan, the Council have ensured that both the beneficial environmental effects of implementing the Plan have been and will be maximised and that potential adverse effects have been and will be avoided, reduced or offset. 9.2 Integration of Environmental Considerations All recommendations made by the SEA, AA and SFRA processes were integrated into the Plan. Table 9.1 links key mitigation measure(s) - which have been integrated into the Plan - to the potential significant effects of implementing the Plan, if unmitigated. The measures generally benefit multiple environmental components i.e. a measure providing for the protection of biodiversity, flora and fauna could beneficially impact upon the minimisation of flood risk and the protection of human health, for example. CAAS for Carlow County Council 93 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Table 9.1 Integration of Environmental Considerations Topic Potentially Recommendation Details of how incorporated Significant into the Plan Adverse Effect, if Unmitigated All Various below Regulatory framework for environmental protection and management Incorporated into Draft Plan Cumulatively contribute towards – in combination with other users and bodies – the achievement of the objectives of the regulatory (Chapter 10 – Built and Natural framework for environmental protection and management. The Council will contribute towards compliance with EU Directives - including Heritage) through policy HR8. the Habitats Directive (92/43/EEC, as amended), the Birds Directive (2009/147/EC), the Environmental Impact Assessment Directive (85/337/EEC, as amended) and the Strategic Environmental Assessment Directive (2001/42/EC) – and relevant transposing Regulations. All Various below Information to be considered at lower levels of decision making and environmental assessment Incorporated into Draft Plan Lower levels of decision making and environmental assessment should consider the sensitivities identified in Section 4 of the SEA (Chapter 10 – Built and Natural Environmental Report that accompanies the Plan, including the following: Heritage) through policies; HR7, x Candidate Special Areas of Conservation and Special Protection Areas; HR 8, HR15, HR2 and HR3. x Features of the landscape that provide linkages/connectivity to designated sites (e.g. watercourses or areas of semi-natural habitats); x Proposed Natural Heritage Areas; x Entries to the Record of Monuments and Places; x Entries to the Record of Protected Structures Biodiversity Loss of Protection of Biodiversity including Natura 2000 Network Incorporated into Draft Plan and flora and biodiversity with Contribute, as appropriate, towards the protection of designated ecological sites including candidate Special Areas of Conservation (Chapter 10 – Built and Natural fauna regard to (cSACs) and Special Protection Areas (SPAs); Wildlife Sites (including proposed Natural Heritage Areas); and Flora Protection Order sites. Heritage) through policies HR7 designated and HR8. biodiversity and Contribute towards compliance with relevant EU Environmental Directives and applicable National Legislation, Policies, Plans and flora and fauna, Guidelines, including the following and any updated/superseding documents: ecological x EU Directives, including the Habitats Directive (92/43/EEC, as amended)[1], the Birds Directive (2009/147/EC)[2], the connectivity and Environmental Liability Directive (2004/35/EC)[3], the Environmental Impact Assessment Directive (85/337/EEC, as amended), non-designated the Water Framework Directive (2000/60/EC) and the Strategic Environmental Assessment Directive (2001/42/EC). biodiversity and x National legislation, including the Wildlife Act 1976[4], the European Communities (Environmental Impact Assessment) flora and fauna Regulations 1989 (SI No. 349 of 1989) (as amended), the Wildlife (Amendment) Act 2000, the European Union (Water Policy) Regulations 2003 (as amended), the Planning and Development Act 2000 (as amended), the European Communities (Birds and Natural Habitats) Regulations 2011 (SI No. 477 of 2011) and the European Communities (Environmental Liability) Regulations 2008[5]. x National policy guidelines (including any clarifying Circulars or superseding versions of same), including the Landscape and Landscape Assessment Draft Guidelines 2000, the Environmental Impact Assessment Sub-Threshold Development Guidelines 2003, Strategic Environmental Assessment Guidelines 2004 and the Appropriate Assessment Guidance 2010. x Catchment and water resource management Plans, including the relevant River Basin Management Plan. x Biodiversity Plans and guidelines, including Actions for Biodiversity 2011-2016: Ireland’s 2nd National Biodiversity Plan (including any superseding version of same). x Freshwater Pearl Mussel Regulations (S.I. 296 of 2009) (including any associated designated areas or management plans). x Ireland’s Environment 2014 (EPA, 2014, including any superseding versions of same), and to make provision where appropriate to address the report’s goals and challenges. [1] Including Annex I habitats, Annex II species and their habitats and Annex IV species and their breeding sites and resting places (wherever they occur). [2] Including Annex I species and other regularly occurring migratory species, and their habitats (wherever they occur). [3] Including protected species and natural habitats. [4] Including species of flora and fauna and their key habitats. [5] Including protected species and natural habitats. CAAS for Carlow County Council 94 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Topic Potentially Recommendation Details of how incorporated Significant into the Plan Adverse Effect, if Unmitigated Appropriate Assessment Incorporated into Draft Plan All projects and plans arising from this plan46 (including any associated improvement works or associated infrastructure) will be screened (Chapter 10 – Built and Natural for the need to undertake Appropriate Assessment under Article 6 of the Habitats Directive. A plan or project will only be authorised Heritage) through policy HR9. after the competent authority has ascertained, based on scientific evidence, Screening for Appropriate Assessment, and a Stage 2 Appropriate Assessment where necessary, that: 1. The Plan or project will not give rise to significant adverse direct, indirect or secondary effects on the integrity of any European site (either individually or in combination with other plans or projects); or 2. The Plan or project will have significant adverse effects on the integrity of any European site (that does not host a priority natural habitat type/and or a priority species) but there are no alternative solutions and the plan or project must nevertheless be carried out for imperative reasons of overriding public interest, including those of a social or economic nature. In this case, it will be a requirement to follow procedures set out in legislation and agree and undertake all compensatory measures necessary to ensure the protection of the overall coherence of Natura 2000; or 3. The Plan or project will have a significant adverse effect on the integrity of any European site (that hosts a natural habitat type and/or a priority species) but there are no alternative solutions and the plan or project must nevertheless be carried out for imperative reasons for overriding public interest, restricted to reasons of human health or public safety, to beneficial consequences of primary importance for the environment or, further to an opinion from the Commission, to other imperative reasons of overriding public interest. In this case, it will be a requirement to follow procedures set out in legislation and agree and undertake all compensatory measures necessary to ensure the protection of the overall coherence of Natura 2000. Protection of Natura 2000 Sites Incorporated into Draft Plan No projects giving rise to significant cumulative, direct, indirect or secondary impacts on Natura 2000 sites arising from their size or (Chapter 10 – Built and Natural scale, land take, proximity, resource requirements, emissions (disposal to land, water or air), transportation requirements, duration of Heritage) through Policy HR10. construction, operation, decommissioning or from any other effects shall be permitted on the basis of this plan (either individually or in combination with other plans or projects[6]). Biodiversity and Ecological Networks Incorporated into Draft Plan Contribute towards the protection and enhancement of biodiversity and ecological connectivity, including trees, hedgerows, rivers, (Chapter 10 – Built and Natural streams, other landscape features and associated wildlife where these form part of the ecological network and/or may be considered as Heritage) through policy HR15. ecological corridors or stepping stones in the context of Article 10 of the Habitats Directive. Non-Designated Sites Incorporated into Draft Plan Contribute towards the protection of non-designated habitats and species, as appropriate. (Chapter 10 – Built and Natural Heritage) through policy HP 20. Non-native invasive species Incorporated into Draft Plan Support, as appropriate, the National Parks and Wildlife Service’s efforts to seek to control the spread of non-native invasive species on (Chapter 10 – Built and Natural land and water. Heritage) through policy HR21. Protection of Riparian Zone and Waterbodies and Watercourses Incorporated into Draft Plan Planning authorities shall demonstrate that waterbodies and watercourses are protected from inappropriate development, including (Chapter 10 – Built and Natural rivers, streams, associated undeveloped riparian strips and natural floodplains. This will include protection buffers in riverine as Heritage) through policy HR12 appropriate. and also objective FLO4 (Chapter 9). 46 Such projects include but are not limited to those relating to: agriculture; amenity and recreation; contaminated sites; electricity transmission; flood alleviation and prevention; forestry; mineral extraction; renewable energy projects; roads; telecommunications; tourism; wastewater and discharges; and water supply and abstraction. [6] Except as provided for in Section 6(4) of the Habitats Directive, viz. There must be: a) no alternative solution available, b) imperative reasons of overriding public interest for the project to proceed; and c) Adequate compensatory measures in place. CAAS for Carlow County Council 95 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Topic Potentially Recommendation Details of how incorporated Significant into the Plan Adverse Effect, if Unmitigated Constrained Land Use Zoning Incorporated into Draft Plan HR 10B: To require applications for development within the constrained land use zoning objective for the Natura 2000 site (Map 13) to (Chapter 10 – Built and Natural undergo Appropriate Assessment and demonstrate that the proposal will not give rise to any effect on the Natura 2000 site in view of Heritage) through policy HR10B its qualification features and conservation objectives. Visitors Incorporated into Draft Plan To seek to manage any increase in visitor numbers to avoid significant effects including loss of habitat and disturbance, any projects are (Chapter 11 – Tourism) through a suitable distance from the water’s edge and legislation relating to habitats, species, connectivity and designated sites is complied with. policy TP7 Rewording of the following objectives from an earlier draft of the Plan Reworded as detailed. Public Spaces and Public Realm PR 2: To prioritise the improvement of, and access to, subject to the requirements of the Habitats Directive, the waterfront area and the retail core for the enjoyment of both visitors and residents alike. Water Supply and Quality WSO 8: To ensure that all proposals for the development of an upgrade to the water supply system will be screened for Appropriate Assessment in accordance with Article 6(3) of the Habitats Directive and where significant potential impacts to the integrity of the Natura 2000 network are identified, a Natura Impact Statement will be prepared. Policies in relation to Green Infrastructure HR 17: To explore the feasibility, subject to the requirements of the Habitats Directive, of developing a linear park, along the river Slaney, linking to areas of open space and amenity. Where lands are in private ownership it shall be policy, in any development proposal, to secure public access along the waterway. Policies and Objectives in relation to Tourism TO 1: To provide where feasible, and support the provision of tourism infrastructure and services, subject to the requirements of the Habitats Directive, including, walking, cycling and water based infrastructure and short-term guest accommodation facilities throughout the settlement in appropriate locations. TO 4: To support the provision and augmentation, of sporting, kayaking / canoeing and angling facilities, pony trekking routes, adventure centres and associated ancillary uses in appropriate locations subject to the requirements of the Habitats Directive. Population Potential Also see measures under environmental vectors soil, water and air below. and human interactions if Human Health Incorporated into Draft Plan health effects upon Assess proposals for development in terms of, inter alia, potential impact on existing adjacent developments, existing land uses and/or (Chapter 9 – Utilities environmental the surrounding landscape. Where proposed developments would be likely to have a significant adverse effect on the amenities of the Infrastructure, Climate Change vectors such as area through pollution by noise, fumes, odours, dust, grit or vibration, or cause pollution of air, water and/or soil, the Council shall ensure and Environmental Management) water are not the introduction of mitigation measures in order to eliminate adverse environmental impacts or reduce them to an acceptable operating through objective PO1. mitigated level. Radon Incorporated into Draft Plan Ensure the implementation of the specific guidance on radon prevention measures for new homes as contained within the existing (Chapter 9 – Utilities Building Regulations (including any updated/superseding regulations that may be published within the lifetime of this Plan). Infrastructure, Climate Change and Environmental Management) through objective PO2. Soil Adverse impacts Also see measures under water below. on the Soil Protection and Contamination Incorporated into the Draft Plan hydrogeological Ensure that adequate soil protection measures are undertaken where appropriate. Adequate and appropriate investigations shall be (Chapter 9 – Utilities and ecological carried out into the nature of any soil and groundwater contamination and the risks associated with site development work which is Infrastructure, Climate change function of the proposed. and Environmental management) soil resource through policy P5. CAAS for Carlow County Council 96 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Topic Potentially Recommendation Details of how incorporated Significant into the Plan Adverse Effect, if Unmitigated Water Adverse impacts Also see measures under soil above and material assets below. upon the status Water Framework Directive and associated legislation Incorporated into Draft Plan of water bodies Contribute towards the protection of existing and potential water resources, and their use by humans and wildlife, including rivers, (Chapter 9 – Utilities arising from streams, groundwater and associated habitats and species in accordance with the requirements and guidance in the EU Water Framework Infrastructure, Climate Change changes in Directive 2000 (2000/60/EC), the European Union (Water Policy) Regulations 2003 (as amended), the European Communities and Environmental Management) quality, flow Environmental Objectives (Surface Waters) Regulations 2009 (SI No. 272 of 2009), the Groundwater Directive 2006/118/EC and the through policy WSP1. and/or European Communities Environmental Objectives (groundwater) Regulations, 2010 (S.I. No. 9 of 2010) and other relevant EU Directives, morphology including associated national legislation and policy guidance (including any superseding versions of same). To also support the application and implementation of a catchment planning and management approach to development and conservation, including the implementation of Sustainable Drainage System techniques for new development. River Basin Management Plan Incorporated into Draft Plan Support the implementation of the relevant recommendations and measures as outlined in the relevant River Basin Management Plan, (Chapter 9 – Utilities and associated Programmes of Measures, or any such plans that may supersede same during the lifetime of the plan, as well as relevant Infrastructure, Climate Change recommendations contained in the Water Quality in Ireland 2010 – 2012 (EPA, 2015, and any updated/superseding document). Proposals and Environmental Management) for development would not have an unacceptable impact on the water environment, including surface waters, groundwater quality and through policy WSP2. quantity, river corridors and associated woodlands. Also to have cognisance of, where relevant, the EU’s Common Implementation Strategy Guidance Document No. 20 which provides guidance on exemptions to the environmental objectives of the Water Framework Directive. Increase in flood As proposed by the SFRA Incorporated into Draft Plan risk (Chapter 9 – Utilities Infrastructure, Climate Change and Environmental Management) through policies FL1, FL2, FL4 and objective FLO2. Air and Failure to Overall development approach for the Plan, consolidating the town and providing for growth within and adjacent to the town centre Also see measures under human health Climatic contribute CAFE Directive Incorporated into Draft Plan Factors towards Promote the preservation of best ambient air quality compatible with sustainable development in accordance with the EU Ambient Air (Chapter 9 – Utilities sustainable Quality and Cleaner Air for Europe (CAFE) Directive (2008/50/EC) and ensure that all air emissions associated with new developments Infrastructure, Climate Change transport and are within Environmental Quality Standards as out in the Air Quality Standards Regulations 2011 (SI No. 180 of 2011) (or any and Environmental Management) associated updated/superseding documents). through policy P1. impacts (energy National Climate Change Adaptation Framework Incorporated into Draft Plan usage and Recognise European and national objectives for climate adaptation and work with the EPA, the Southern Regional Assembly and (Chapter 9 – Utilities emissions to air neighbouring planning authorities in implementing future Guidance for climate change proofing of landuse plan provisions as is flagged Infrastructure, Climate Change including noise in the National Climate Change Adaptation Framework (DECLG, 2012). and Environmental Management) and greenhouse through policy CCP1. gases) Green Infrastructure Incorporated into Draft Plan Encourage and facilitate, in consultation with relevant stakeholders, the development of green infrastructure that recognises the (Chapters 9 and 10) through synergies that can be achieved with regard to the following: policy HR14 (chapter 10) and • Provision of open space amenities objective CCO1 (chapter 9). • Sustainable management of water • Protection and management of biodiversity • Protection of cultural heritage • Protection of protected landscape sensitivities. CAAS for Carlow County Council 97 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Topic Potentially Recommendation Details of how incorporated Significant into the Plan Adverse Effect, if Unmitigated Material The need to Irish Water Incorporated into Draft Plan Assets provide Collaborate with and support, as relevant and appropriate, Irish Water in its new role as the lead authority for water services. (Chapter 9 – Utilities adequate and Infrastructure, Climate Change appropriate and Environmental Management) water services (it through policies WSP3, WW1 and is the function of objectives WSO1 and WWO1. Irish Water to Sufficient Capacity Incorporated into Draft Plan provide for such Development will only be permitted in instances where there is sufficient capacity in the public water and wastewater infrastructure. (Chapter 9 – Utilities needs) Infrastructure, Climate Change and Environmental Management) through policy WSP6. Focus on Urban Waste Water Discharges in Ireland Incorporated into Draft Plan In conjunction with Irish Water, implement relevant recommendations set out in the EPA (2015) publication Urban Waste Water (Chapter 9 – Utilities Treatment in 2014 (and any subsequent update). Infrastructure, Climate Change and Environmental Management) partly through policy WW2. Urban Waste Water Treatment Regulations Incorporated into Draft Plan Collaborate with Irish Water in contributing towards compliance with the relevant provisions of the Urban Waste Water Treatment (Chapter 9 – Utilities Regulations 2001 and 2004 and the Waste Water Discharge (Authorisation) Regulations 2007 Infrastructure, Climate Change and Environmental Management) through policy WW1. Drinking Water Regulations Incorporated into Draft Plan Collaborate with Irish Water in contributing towards compliance with the European Communities (Drinking Water) Regulations (No. 2) (Chapter 9 – Utilities 2007 and compliance of water supplies comply with the 48 parameters identified in these Regulations. Infrastructure, Climate Change and Environmental Management) through objective WSO1. The Provision and Quality of Drinking Water in Ireland Incorporated into Draft Plan The Council, in conjunction with Irish Water, shall have regard to the EPA (2015) publication The Provision and Quality of Drinking (Chapter 9 – Utilities Water in Ireland - A Report for the Year 2014 (and any subsequent update) in the establishment and maintenance of water sources in Infrastructure, Climate Change the County. and Environmental Management) through objective WSO4. EPA’s Remedial Action List Incorporated into Draft Plan The Council, in conjunction with Irish Water, shall undertake recommendations made by the EPA arising from any failure to meet (Chapter 9 – Utilities drinking water standards and any enlistment on the EPA’s Remedial Action List. Infrastructure, Climate Change and Environmental Management) through objective WSO5. CAAS for Carlow County Council 98 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Topic Potentially Recommendation Details of how incorporated Significant into the Plan Adverse Effect, if Unmitigated Increases in Construction Waste Incorporated into Draft Plan waste levels Construction wastes arising will be managed and disposed of in a way that ensures the provisions of the Waste Management Acts and (Chapter 9 – Utilities new Waste Management Plan. Construction Waste Management Plans will be implemented where relevant to minimise waste and ensure Infrastructure, Climate Change correct handling and disposal of construction waste streams in accordance with the Best Practice Guidelines on the Preparation of Waste and Environmental Management) Management Plans for Construction and Demolition Projects, Department of the Environment, July 2006. through policy WMP5. Waste Creation Incorporated into Draft Plan Support the minimisation of waste creation and promote a practice of reduce, reuse and recycle where possible. (Chapter 9 – Utilities Infrastructure, Climate Change and Environmental Management) through policy WMP1. Waste Disposal Incorporated into Draft Plan Safeguard the environment by seeking to ensure that residual waste is disposed of appropriately. (Chapter 9 – Utilities Infrastructure, Climate Change and Environmental Management) through policy WMP2. Cultural Potential effects Archaeological Heritage Incorporated into Draft Plan Heritage on protected and Contribute, as appropriate, towards the protection and sympathetic enhancement of archaeological heritage, in particular by (Chapter 10 – Built and Natural unknown implementing the relevant provisions of the Planning and Development Act 2000 (as amended) and the National Monuments Act, 1930 Heritage) through policy HR1. archaeology and (as amended). protected Protection of Archaeological Sites Incorporated into Draft Plan architecture Contribute, as appropriate, towards the protection of archaeological sites and monuments and their settings, archaeological objects and (Chapter 10 – Built and Natural arising from underwater archaeological sites that are listed in the Record of Monuments and Places, in the ownership/guardianship of the State, or Heritage) through policy HR2. construction and that are subject of Preservation Orders or have been registered in the Register of Historic Monuments. Contribute, as appropriate, operation towards the protection and preservation of archaeological sites, which have been identified subsequent to the publication of the Record of Monuments and Places. Consultation Incorporated into Draft Plan Consult with the National Monuments Service of the Department of Arts Heritage and the Gaeltacht in relation to proposed developments (Chapter 10 – Built and Natural adjoining archaeological sites. Heritage) through policy HR5. Architectural Heritage Incorporated into Draft Plan Contribute towards the protection of architectural heritage by complying, as appropriate, with the legislative provisions of the Planning (Chapter 10 – Built and Natural and Development Act 2000 (as amended) in relation to architectural heritage and the policy guidance contained in the Architectural Heritage) through policy HR3. Heritage Protection Guidelines 2011 (and any updated/superseding document). Landscape Occurrence of Landscape Designations Incorporated into Draft Plan adverse visual Contribute towards the protection of county and local level landscape designations from incompatible developments. Proposals for (Chapter 6 – Town Centre, impacts development that have the potential to significantly adversely impact upon these designations shall be accompanied by an assessment Landscape and Public Realm) of the potential landscape and visual impacts of the proposed development - demonstrating that landscape impacts have been anticipated through policy L1. and avoided to a level consistent with the sensitivity of the landscape and the nature of the designation. CAAS for Carlow County Council 99 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Section 10 Monitoring Measures 10.1 Introduction Internal monitoring of the environmental effects of grants of permission in the Council The SEA Directive requires that the significant will provide monitoring of various indicators and targets on a grant of permission by grant of environmental effects of the implementation of 47 plans and programmes are monitored. This permission basis. Where significant adverse section details the measures that will be used effects - including positive, negative, in order to monitor the likely significant effects cumulative and indirect - have the potential to of implementing the Plan. occur upon, for example, entries to the RMP, entries to the RPS or ecological networks as a Monitoring can enable, at an early stage, the result of the undertaking of individual projects identification of unforeseen adverse effects and or multiple individual projects such instances the undertaking of appropriate remedial action. should be identified and recorded and should feed into the monitoring evaluation. 10.2 Indicators and 10.4 Reporting Targets A stand-alone Monitoring Report on the Monitoring is based around indicators that allow significant environmental effects of quantitative measures of trends and progress implementing the Plan will be prepared before over time relating to the Strategic in advance of the beginning of the review of the Environmental Objectives identified in Section 4 Plan. This report should address the indicators and used in the evaluation. Each indicator to be set out below. monitored is accompanied by the target(s) that were identified with regard to the relevant The Council is responsible for the ongoing strategic actions. review of indicators and targets, collating existing relevant monitored data, the Table 10.1 overleaf shows the indicators and preparation of monitoring evaluation report(s), targets which have been selected for the publication of these reports and, if monitoring the likely significant environmental necessary, the carrying out of corrective action. effects of implementing the Plan, if unmitigated. 10.5 Thresholds The Monitoring Programme may be updated to deal with specific environmental issues - Thresholds at which corrective action will be including unforeseen effects - as they arise. considered include: Such issues may be identified by the Council or identified to the Council by other agencies. x The occurrence of flood events; x Court cases taken by the Department of Arts, Heritage and the Gaeltacht 10.3 Sources regarding impacts upon archaeological heritage including entries to the RMP; Measurements for indicators generally come x Complaints received from statutory from existing monitoring sources. Existing consultees regarding avoidable monitoring sources include those maintained by environmental impacts resulting from the Council and the relevant authorities e.g. the development which is granted Environmental Protection Agency, the National permission under the Plan; Parks and Wildlife Service and the Central x Boil notices on drinking water; and Statistics Office. x Fish kills. 47 The likely significant effects of development Protected Structure or whether a proposed proposals on environmental sensitivities are further development can be adequately served with water determined during the development management services) while granting permissions, or at a later process. By documenting this determination (e.g. date, the requirement to monitor the effects of whether a proposed development will impact upon a implementing the Plan can be achieved. CAAS Ltd. for Carlow County Council 100 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Table 10.1 Selected Indicators, Targets and Monitoring Sources Environmental Selected Indicator(s) Selected Target(s) Source (Frequency) Component Biodiversity, B1: Conservation status of habitats and species as Maintenance of favourable conservation status for x Internal monitoring of environmental effects of grants of Flora and assessed under Article 17 of the Habitats Directive all habitats and species protected under national permission (grant by grant). Fauna and international legislation to be unaffected by x Department of Arts, Heritage and the Gaeltacht report of the implementation of the Plan48 implementation of the measures contained in the Habitats Directive - as required by Article 17 of the Directive (every 6 years). x Consultations with the NPWS (at monitoring evaluation - see Section 10.4). B2: Percentage loss of functional connectivity without B2: No significant ecological networks or parts x Internal monitoring of environmental effects of grants of remediation resulting from development provided for by thereof which provide functional connectivity to be permission (grant by grant). the Plan lost without remediation resulting from x CORINE mapping resurvey (every c. 5 years). development provided for in the Plan B3i: Number of significant impacts on relevant habitats, B3i: Avoid significant impacts on relevant habitats, x Internal monitoring of environmental effects of grants of species, environmental features or other sustaining species, environmental features or other sustaining permission (grant by grant). resources in designated sites including Wildlife Sites resources in designated sites including Wildlife Sites x Consultations with the NPWS (at monitoring evaluation - see resulting from development provided for by the Plan resulting from development provided for by the Plan Section 10.4). B3ii: Number of significant impacts on the protection of B3ii: No significant impacts on the protection of species listed on Schedule 5 of the Wildlife Act 1976 species listed on Schedule 5 of the Wildlife Act 1976 Population PHH1: Occurrence (any) of a spatially concentrated PHH1: No spatial concentrations of health problems x Consultations with EPA and Health Service Executive (at and Human deterioration in human health arising from arising from environmental factors as a result of monitoring evaluation - see Section 10.4). Health environmental factors resulting from development implementing the Plan provided for by the Plan, as identified by the Health Service Executive and Environmental Protection Agency Soil S1: Soil extent and hydraulic connectivity S1: To minimise reductions in soil extent and x Internal monitoring of environmental effects of grants of hydraulic connectivity permission (grant by grant). Water W1: Classification of Overall Status (comprised of W1: Not to cause deterioration in the status of any x Internal monitoring of environmental effects of grants of ecological and chemical status) under the European surface water or affect the ability of any surface permission (grant by grant). Communities Environmental Objectives (Surface water to achieve ‘good status’49 x Data issued under the Water Framework Directive Monitoring Waters) Regulations 2009 (SI No. 272 of 2009) Programme for Ireland. W2: Groundwater Quality Standards and Threshold W2: Not to affect the ability of groundwaters to x Internal monitoring of environmental effects of grants of Values under Directive 2006/118/EC comply with Groundwater Quality Standards and permission (grant by grant). Threshold Values under Directive 2006/118/EC x Data issued under the Water Framework Directive Monitoring Programme for Ireland (multi-annual). W3: Number of incompatible developments granted W3: Minimise developments granted permission on x Internal monitoring of environmental effects of grants of permission on lands which pose - or are likely to pose lands which pose - or are likely to pose in the future permission (grant by grant). in the future - a significant flood risk - a significant flood risk in compliance with The Planning System and Flood Risk Management Guidelines for Planning Authorities 48 Except as provided for in Section 6(4) of the Habitats Directive, viz. There must be: (a) no alternative solution available; (b) imperative reasons of overriding public interest for the plan to proceed; and (c) adequate compensatory measures in place. 49 Good status as defined by the WFD equates to approximately Q4 in the current national scheme of biological classification of rivers as set out by the EPA. CAAS for Carlow County Council 101 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Environmental Selected Indicator(s) Selected Target(s) Source (Frequency) Component Material M1: Number of new developments granted permission M1: All new developments granted permission to be x Internal monitoring of environmental effects of grants of Assets which can be adequately and appropriately served with connected to and adequately and appropriately permission (grant by grant). waste water treatment over the lifetime of the Plan served by waste water treatment over the lifetime of the Plan M2: Number of non-compliances with the 48 M2: No non-compliances with the 48 parameters x EPA The Provision and Quality of Drinking Water in Ireland parameters identified in the European Communities identified in the European Communities (Drinking reports (multi-annual). (Drinking Water) Regulations (No. 2) 2007 which Water) Regulations (No. 2) 2007 which present a x EPA Remedial Action List (every quarter). present a potential danger to human health as a result potential danger to human health as a result of of implementing the Plan implementing the Plan M3i: Total collected and brought household waste M3i: Minimise increases in and, where possible, x EPA National Waste Reports reduce household waste generation x EPA Ireland’s Environment Reports M3ii: Packaging recovered (t) by self-complying M3ii: Maximise increases in packaging recovered (t) x EPA Ireland’s Environment Reports packagers by self-complying packagers Air and C1: Percentage of population travelling to work, school C1: An increase in the percentage of the population x CSO Population Data (every c. 5 years). Climatic or college by public transport or non-mechanical means travelling to work, school or college by public Factors transport or non-mechanical means Cultural CH1: Percentage of entries to the Record of Monuments CH1: Protect entries to the Record of Monuments x Internal monitoring of environmental effects of grants of Heritage and Places - and the context these entries within the and Places - and the context of these entries within permission (grant by grant). surrounding landscape where relevant - protected from the surrounding landscape where relevant – x Consultation with Department of Arts, Heritage and the adverse effects resulting from development which is protected from adverse effects resulting from Gaeltacht (at monitoring evaluation - see Section 10.4). granted permission under the Plan development which is granted permission under the Plan CH2: Percentage of entries to the Record of Protected CH2: Protect entries to the Record of Protected x Internal monitoring of environmental effects of grants of Structures and their context protected from adverse Structures and their context from adverse effects permission (grant by grant). effects resulting from development which is granted resulting from development which is granted x Consultation with Department of Arts, Heritage and the permission under the Plan permission under the Plan Gaeltacht (at monitoring evaluation - see Section 10.4). Landscape L1: Number of complaints received from statutory L1: No developments permitted which result in x Internal monitoring of environmental effects of grants of consultees regarding avoidable impacts on the avoidable impacts on the landscape resulting from permission (grant by grant). landscape resulting from development which is granted development which is granted permission under the permission under the Plan Plan CAAS for Carlow County Council 102 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Appendix I Relationship with Legislation and Other Plans and Programmes This appendix is not intended to be a full and comprehensive review of EU Directives, the transposing regulations or the regulatory framework for environmental protection and management. The information is not exhaustive and it is recommended to consult the Directive, Regulation, Plan or Programme to become familiar with the full details of each. European Directive/ Protocol/ High Level Aim/ Purpose/ Objective Lower level objectives, actions etc. Relevant legislation Relevance to the CDP Strategy/Programme in Ireland UN Kyoto Protocol and The UN Kyoto Protocol set of policy measures to x The Kyoto Protocol is implemented through the European Climate National Policy Position To cumulatively the Second European reduce greenhouse gas emissions Change Programme (ECCP II) and final Heads of the contribute towards – in Climate Change The Second European Climate Change x EU member states implement measures to improve on or Climate Action and Low- combination with other Programme (ECCP II) Programme (ECCP II) aims to identify and compliment the specified measures and policies arising from the Carbon Development Bill users and bodies – the develop all the necessary elements of an EU ECCP achievement of the strategy to implement the Kyoto Protocol objectives of the regulatory framework for environmental protection and management EU 2020 climate and x Binding legislation which aims to ensure the Four pieces of complimentary legislation: The Framework for To cumulatively energy package European Union meets its climate and x Reform of the EU Emissions Trading System (EU ETS) to include a Climate Change Bill contribute towards – in energy targets for 2020 cap on emission allowances in addition to existing system of combination with other x Aims to achieve a 20% reduction in EU national caps European Communities users and bodies – the greenhouse gas emissions from 1990 levels x Member States have agreed national targets for non-EU ETS (Renewable Energy) achievement of the x Aims to raise the share of EU energy emissions from countries outside the EU Regulations 2011 (S.I. objectives of the consumption produced from renewable x Meet the national renewable energy targets of 16% for Ireland by No. 147/2011) regulatory framework for resources to 20% 2020 environmental protection x Achieve a 20% improvement in the EU's x Preparing a legal framework for technologies in carbon capture and management energy efficiency and storage Habitats Directive x Promote the preservation, protection and x Propose and protect sites of importance to habitats, plant and European Communities The Council is obliged to (92/43/EEC) improvement of the quality of the animal species (Birds and Natural comply with, as relevant Habitats) Regulations and appropriate, the environment, including the conservation of x Establish a network of Natura 2000 sites hosting the natural 2011 (S.I. No. requirements of the natural habitats and of wild fauna and flora habitat types listed in Annex I and habitats of the species listed in 477/2011) Directive and x Contribute towards ensuring biodiversity Annex II, to enable the natural habitat types and the species' transposing regulations through the conservation of natural habitats habitats concerned to be maintained or, where appropriate, The Wildlife Act 1976 and of wild fauna and flora restored at a favourable conservation status in their natural range and the Wildlife x Maintain or restore to favourable x Carry out comprehensive assessment of habitat types and species (Amendment) Act 2000 conservation status, natural habitats and present species of wild fauna and flora of x Establish a system of strict protection for the animal species Community interest and plant species listed in Annex IV x Promote the maintenance of biodiversity, taking account of economic, social, cultural and regional requirements. CAAS for Carlow County Council 103 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Birds Directive x Conserve all species of naturally occurring x Preserve, maintain or re-establish a sufficient diversity and area of European Communities The Council is obliged to (2009/147/EC) birds in the wild state including their eggs, habitats for all the species of birds referred to in Annex 1. (Birds and Natural comply with, as relevant nests and habitats x Preserve, maintain and establish biotopes and habitats to include Habitats) Regulations and appropriate, the x Protect, manage and control these species the creation of protected areas (Special Protection Areas); ensure 2011 (S.I. No. requirements of the and comply with regulations relating to the upkeep and management in accordance with the ecological 477/2011) Directive and their exploitation needs of habitats inside and outside the protected zones, re- transposing regulations x The species included in Annex I shall be the establish destroyed biotopes and creation of biotopes subject of special conservation measures x Measures for regularly occurring migratory species not listed in concerning their habitat in order to ensure Annex I is required as regards their breeding, moulting and their survival and reproduction in their area wintering areas and staging posts along their migration routes. of distribution The protection of wetlands and particularly wetlands of international importance. European Union x Aims to halt or reverse biodiversity loss and x Outlines six targets and twenty actions to aid European in Actions for Biodiversity To cumulatively Biodiversity Strategy to speed up the EU's transition towards a halting the loss to biodiversity and eco-system services 2011-2016 Ireland’s contribute towards – in 2020 resource efficient and green economy x The six targets cover: National Biodiversity combination with other x Halting the loss of biodiversity and the o Full implementation of EU nature legislation to Plan, 2011 users and bodies – the degradation of ecosystem services in the protect biodiversity achievement of the EU by 2020, and restoring them in so far as o Maintaining, enhancing and protecting for objectives of the feasible ecosystems, and green infrastructure regulatory framework for o Ensuring sustainable agriculture, and forestry environmental protection o Sustainable management of fish stocks and management o Reducing invasive alien species o Addressing the global need to contribute towards averting global biodiversity loss The Clean Air for x The CAFE Directive merges existing x Sets objectives for ambient air quality Air Quality Standards The Council is obliged to Europe Directive legislation into a single directive (except for x designed to avoid, prevent or reduce harmful effects on human Regulations 2011 (S.I. comply with, as relevant (2008/50/EC) the fourth daughter directive) health and the environment as a whole No. 180 of 2011) and appropriate, the x Sets new air quality objectives for PM2.5 x Aims to assess the ambient air quality in Member States on the requirements of the (fine particles) including the limit value and basis of common methods and criteria; Arsenic, Cadmium, Directive and exposure related objectives x Obtains information on ambient air quality in order to help Mercury, Nickel and transposing regulations x Accounts for the possibility to discount combat air pollution and nuisance and to monitor long-term Polycyclic Aromatic natural sources of pollution when assessing x trends and improvements resulting from national and Community Hydrocarbons in compliance against limit values x measures; Ambient Air Regulations x Allows the possibility for time extensions of x Ensures that such information on ambient air quality is made 2009 (S.I. No. 58 of three years (PM10) or up to five years available to the public; 2009) (NO2, benzene) for complying with limit x Aims to maintain air quality where it is good and improving it in values, based on conditions and the other cases; assessment by the European Commission. x Aims to promote increased cooperation between the Member States in reducing air pollution. Fourth Daughter x The Fourth Daughter Directive lists Directive pollutants, target values and monitoring (2004/107/EC) requirements for the following: arsenic, cadmium, mercury, nickel and polycyclic aromatic hydrocarbons in ambient air CAAS for Carlow County Council 104 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Noise Directive The Noise Directive - Directive 2002/49/EC The Directive requires competent authorities in Member States to: Environmental Noise The Council is obliged to 2002/49/EC relating to the assessment and management of Regulations 2006 (S.I. comply with, as relevant environmental noise - is part of an EU strategy x Draw up strategic noise maps for major roads, railways, airports No. 140 of 2006) and appropriate, the setting out to reduce the number of people and agglomerations, using harmonised noise indicators and use requirements of the affected by noise in the longer term and to these maps to assess the number of people which may be Directive and provide a framework for developing existing impacted upon as a result of excessive noise levels; transposing regulations Community policy on noise reduction from x Draw up action plans to reduce noise where necessary and source. maintain environmental noise quality where it is good; and x Inform and consult the public about noise exposure, its effects, and the measures considered to address noise. The Directive does not set any limit value, nor does it prescribe the measures to be used in the action plans, which remain at the discretion of the competent authorities. Floods Directive x Establishes a framework for the assessment x Assess all water courses and coast lines at risk from flooding European Communities The Council is obliged to (2007/60/EC) and management of flood risks through Flood Risk Assessment (Assessment and comply with, as relevant x Reduce adverse consequences for human x Prepare flood hazard maps and flood risk maps outlining the Management of Flood and appropriate, the health, the environment, cultural heritage extent or potential of flooding and assets and humans at risk in Risks) Regulations (S.I. requirements of the and economic activity associated with these areas at River Basin District level (Article 3(2) (b)) and 122/2010) Directive and floods in the Community areas covered by Article 5(1) and Article 13(1) (b) in accordance transposing regulations with paragraphs 2 and 3 European Union x Implement flood risk management plans and take adequate and (Environmental Impact coordinated measures to reduce flood risk for the areas covered Assessment) (Flood by the Articles listed above Risk) Regulations 2012 x Inform the public and allow the public to participate in planning (S.I. No. 470/2012) process Water Framework x Establish a framework for the protection of x Protect, enhance and restore all water bodies and meet the European Communities The Council is obliged to Directive (2000/60/EC) water bodies to include inland surface environmental objectives outlined in Article 4 of the Directive (Water Policy) comply with, as relevant waters, transitional waters, coastal waters Regulations 2003 (S.I. and appropriate, the x Achieve "good status" for all waters by December 2015 and groundwater and their dependent No. 722 of 2003) (as requirements of the wildlife and habitats x Manage water bodies based on identifying and establishing river amended) Directive and x Preserve and prevent the deterioration of basins districts transposing regulations water status and where necessary improve x Involve the public and streamline legislation and maintain “good status” of water bodies x Prepare and implement a River Basin Management Plan for each x Promote sustainable water usage river basin districts identified and a Register of Protected Areas x The Water Framework Directive repealed x Establish a programme of monitoring for surface water status, the following Directives: ground water status and protected areas The Drinking Water Abstraction o x Recover costs for water services Directive o Sampling Drinking Water Directive o Exchange of Information on Quality of Surface Freshwater Directive o Shellfish Directive o Freshwater Fish Directive o Groundwater (Dangerous Substances) Directive o Dangerous Substances Directive CAAS for Carlow County Council 105 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Groundwater Directive x Protect, control and conserve groundwater x Meet minimum groundwater standards listed in Annex 1 of European Communities The Council is obliged to (2006/118/EC) x Prevent the deterioration of the status of all Directive Environmental comply with, as relevant bodies of groundwater x Meet threshold values adopted by national legislation for the Objectives and appropriate, the x Implements measures to prevent and pollutants, groups of pollutants and indicators of pollution which (Groundwater) requirements of the control groundwater pollution, including have been identified as contributing to the characterisation of Regulations 2010 (S.I. Directive and criteria for assessing good groundwater bodies or groups of bodies of groundwater as being at risk, also No. 9/2010) (as transposing regulations chemical status and criteria for the taking into account Part B of Annex II amended) identification of significant and sustained upward trends and for the definition of starting points for trend reversals. Bathing Water Directive x Preserve, protect and improve the quality of x Identify all bathing waters and define the length of the bathing Bathing Water Quality The Council is obliged to (2006/7/EC) the environment and to protect human season (Amendment) comply with, as relevant health by complementing the Water x Monitor bathing water quality as per Annex 1, Column A at the Regulations 2008 (S.I. and appropriate, the Framework Directive 2000/60/EC frequency outlined in Annex IV of the Directive No. 79 of 2008) (as requirements of the x Determine the quality status of the bathing water amended) Directive and x Achieve at least ‘sufficient’ standard by 2015 with the aim transposing regulations increase the standard to ‘excellent’ or ‘good’ x Prepare, review and update a bathing water profile of each in accordance with Annex III x Manage bathing water areas in exceptional circumstances to prevent an adverse impact on bathing water quality and on bathers' health x Provide public information on bathing water quality Drinking Water x Improve and maintain the quality of water x Set values applicable to water intended for human consumption European Union The Council is obliged to Directive (98/83/EC) intended for human consumption for the parameters set out in Annex I (Drinking Water) comply with, as relevant x Protect human health from the adverse x Set values for additional parameters not included in Annex I, Regulations 2014 (S.I. and appropriate, the effects of any contamination of water where the protection of human health within national territory or No. 106 of 2007) (as requirements of the intended for human consumption by part of it so requires. The values set should, as a minimum, amended) Directive and ensuring that it is wholesome and clean satisfy the requirements of Article 4(1) (a) transposing regulations x Implement all measures necessary to ensure that regular European Communities monitoring of the quality of water intended for human (Water Policy) consumption is carried out, in order to check that the water Regulations 2003 (S.I. available to consumers meets the requirements of this Directive No. 722 of 2003) and in particular the parametric values set in accordance with Article 5 x Ensure that any failure to meet the parametric values set in accordance with Article 5 is immediately investigated in order to identify the cause x Ensure that the necessary remedial action is taken as soon as possible to restore its quality and shall give priority to their enforcement action x Undertake remedial action to restore the quality of the water where necessary to protect human health x Notify consumers when remedial action is being undertaken except where the competent authorities consider the non- compliance with the parametric value to be trivial CAAS for Carlow County Council 106 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Urban Waste Water x This Directive concerns the collection, x Urban waste water entering collecting systems shall before European Communities The Council is obliged to Treatment Directive treatment and discharge of urban waste discharge, be subject to secondary treatment (Urban Waste Water comply with, as relevant (91/271/EEC) water and the treatment and discharge of x Annex II requires the designation of areas sensitive to Treatment) Regulations and appropriate, the waste water from certain industrial sectors eutrophication which receive water discharges 2001 (S.I. No. requirements of the x The objective of the Directive is to protect x Establishes minimum requirements for urban waste water 254/2001) Directive and the environment from the adverse effects collection and treatment systems in specified agglomerations to transposing regulations of waste water discharges include special requirements for sensitive areas and certain industrial sectors Environmental Liability x Establish a framework of environmental x Relates to environmental damage caused by any of the European Communities The Council is obliged to Directive (2004/35/EC) liability based on the ‘polluter-pays' occupational activities listed in Annex III, and to any imminent (Environmental Liability) comply with, as relevant principle, to prevent and remedy threat of such damage occurring by reason of any of those Regulations, 2008 and appropriate, the environmental damage activities; damage to protected species and natural habitats requirements of the caused by any occupational activities other than those listed in Directive and Annex III, and to any imminent threat of such damage occurring transposing regulations by reason of any of those activities, whenever the operator has been at fault or negligent x Where environmental damage has not yet occurred but there is an imminent threat of such damage occurring, the operator shall, without delay, take the necessary preventive measures x Where environmental damage has occurred the operator shall, without delay, inform the competent authority of all relevant aspects of the situation and take all practicable steps to immediately control, contain, remove or otherwise manage the relevant contaminants and/or any other damage factors in order to limit or to prevent further environmental damage and adverse effects on human health or further impairment of services and the necessary remedial measures, in accordance with Article 7. x The operator shall bear the costs for the preventive and remedial actions taken pursuant to this Directive x The competent authority shall be entitled to initiate cost recovery proceedings against the operator x The operator may be required to provide financial security guarantees to ensure their responsibilities under the directive are met CAAS for Carlow County Council 107 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 SEA Directive x Contribute to the integration of x Carry out and environmental assessment for plans or programmes European Communities The Council is obliged to (2001/42/EC) environmental considerations into the referred to in Articles 2 to 4 of the Directive (Environmental comply with, as relevant Assessment of Certain and appropriate, the preparation and adoption of plans and x Prepare an environmental report which identifies, describes and Plans and Programmes) requirements of the programmes with a view to promoting evaluates the likely significant effects on the environment of Regulations 2004 (S.I. Directive and sustainable development implementing the plan or programme and reasonable alternatives No. 435/ 2004) (as transposing regulations x Provide for a high level of protection of the that consider the objectives and the geographical scope of the amended) environment by carrying out an plan or programme environmental assessment of plans and x Consult with relevant authorities, stakeholders and public allowing Planning and programmes which are likely to have sufficient time to make a submission Development (Strategic significant effects on the environment x Consult other Member States where the implementation of a plan Environmental or programme is likely to have transboundary environmental Assessment) Regulations effects 2004 (S.I. No. x Inform relevant authorities and stakeholders on the decision to 436/2004) (as amended) implement the plan or programme x Issue a statement to include requirements detailed in Article 9 of the Directive x Monitor and mitigate significant environmental effects identified by the assessment EIA Directive x Requires the assessment of the x All projects listed in Annex I are considered as having significant European Communities The Council is obliged to (2011/92/EU as environmental effects of public and private effects on the environment and require an EIA (Environmental Impact comply with, as relevant amended by projects which are likely to have significant x For projects listed in Annex II, a "screening procedure" is required Assessment) Regulations and appropriate, the 2014/52/EU) effects on the environment to determine the effects of projects on the basis of 1989 (S.I. No. requirements of the x Aims to assess and implement avoidance or thresholds/criteria or a case by case examination. This should 349/1989) (as amended) Directive and mitigation measures to eliminate take into account Annex III. transposing regulations environmental effects, before consent is x The environmental impact assessment shall identify, describe and European Union given of projects likely to have significant assess in an appropriate manner, in the light of each individual (Environmental Impact effects on the environment by virtue, inter case and in accordance with Articles 4 to 12, the direct and Assessment) (Flood alia, of their nature, size or location are indirect effects of a project on the following factors: human Risk) Regulations 2012 made subject to a requirement for beings, fauna and flora, soil, water, air, climate and the (S.I. No. 470/2012) development consent and an assessment landscape, material assets and the cultural heritage, the with regard to their effects. Those projects interaction between each factor are defined in Article 4 x Consult with relevant authorities, stakeholders and public allowing sufficient time to make a submission before a decision is made x The information to be provided by the developer in accordance with paragraph 1 shall include at least: o a description of the project comprising information on the site, design and size of the project; o a description of the measures envisaged in order to avoid, reduce and, if possible, remedy significant adverse effects; o the data required to identify and assess the main effects which the project is likely to have on the environment; o an outline of the main alternatives studied by the developer and an indication of the main reasons for his choice, taking into account the environmental effects; o a non-technical summary of the information referred to each of the above. CAAS for Carlow County Council 108 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 National Policy/ Framework / High Level Aim/ Purpose/ Objective Lower level relevant objectives , actions etc. Relevant legislation Relevance to the CDP Initiative / Strategy Infrastructure and x Reviews infrastructure and capital spending The approach identifies four main components of the investment not applicable To cumulatively Capital Investment over a medium timeframe to ensure strategy as follows: contribute towards – in 2012-16: Medium Term investment is made in the best areas x Economic infrastructure – encompassing transport networks, combination with other Exchequer Framework x Identifies gaps in existing infrastructure energy provision and telecommunications capacity users and bodies – the that require addressing to aid economic x Investment in the productive sector and human capital – such as achievement of the recovery, social cohesion and direct supports for enterprise development; science, technology objectives of the environmental sustainability and innovation advancement; supports for tourism, agriculture, regulatory framework for fisheries and forestry; and capital investment in education environmental protection infrastructure and management x Environmental infrastructure – including our waste and water systems and investment for environmental sustainability x Critical social investment – such as the health service and social housing programmes Smarter Travel – A x Outlines a policy for how a sustainable x Others lower level aims include: not applicable In combination with this Sustainable Transport travel and transport system can be o reduce distance travelled by private car and encourage Policy the CDP will Future – A New achieved smarter travel, including focusing population growth in contribute towards Transport Policy for x Sets out five key goals: areas of employment and to encourage people to live in smarter travel and Ireland 2009 – 2020 o To reduce overall travel demand. close proximity to places of employment associated positive (2009) o To maximise the efficiency of the o ensuring that alternatives to the car are more widely environmental effects. transport network. available, mainly through a radically improved public o To reduce reliance on fossil fuels. transport service and through investment in cycling and o To reduce transport emissions. walking o To improve accessibility to o improving the fuel efficiency of motorised transport transport. through improved fleet structure, energy efficient driving and alternative technologies o strengthening institutional arrangements to deliver the targets Ireland’s First National x Outlines objectives and actions aimed at x Sets a target where 10% of all journeys will be made by bike by not applicable In combination with this Cycle Policy Framework developing a strong cycle network in 2020 Framework the CDP will (2009) Ireland x Proposes the planning, infrastructure, communication, education contribute towards x Sets out 19 specific objectives, and details and stakeholder participations measures required to implement smarter travel and the 109 actions, aimed at ensuring that a the initiative associated positive cycling culture is developed environmental effects. Scoping Study for a x Investigated the feasibility of developing a not applicable not applicable In combination with this National Cycle Network National Cycle Network for recreational Study the CDP will (NCN) routes in rural areas, urban areas and contribute towards connecting larger urban areas smarter travel and x The scoping study and subsequent associated positive workshops resulted in a recommended environmental effects. National Cycle Network Strategic Framework for x Presents the findings and conclusions of a Key features of the framework policy include the following: not applicable In combination with this Integrated Land use steering group that was convened and Study the CDP will and Transport (SFILT) – tasked with overseeing the preparation of x Focus on economic growth contribute towards Department of an integrated, evidence-based framework x Principles to frame future investment smarter travel and Transport, Tourism And that would guide key land transport associated positive Sport investment decisions. environmental effects. CAAS for Carlow County Council 109 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 National Climate x Outlines measures to be undertaken to not applicable not applicable To cumulatively Change Strategy 2007 – meet greenhouse gas emission contribute towards – in 2012 (2007) commitments combination with other users and bodies – the achievement of the objectives of the regulatory framework for environmental protection and management Delivering a Sustainable x White paper setting out a framework for The underpinning Strategic Goals are: not applicable To cumulatively Energy Future for delivering a sustainable energy future in x Ensuring that electricity supply consistently meets demand contribute towards – in Ireland – The Energy Ireland x Ensuring the physical security and reliability of gas supplies to combination with other Policy Framework 2007 x Outlines strategic Goals for: Ireland users and bodies – the – 2020 (2007) o Security of Supply x Enhancing the diversity of fuels used for power generation achievement of the o Sustainability of Energy x Delivering electricity and gas to homes and businesses over objectives of the o Competitiveness of Energy Supply efficient, reliable and secure networks regulatory framework for x Creating a stable attractive environment for hydrocarbon environmental protection exploration and production and management x Being prepared for energy supply disruptions National Climate The National Climate Change Adaptation Actions include those relating to: not applicable To cumulatively Change Adaptation Framework provides a strategic policy focus to contribute towards – in Framework (DECLG, ensure adaptation measures are taken across x Research and Knowledge Base combination with other 2012) different sectors and levels of government to x Governance users and bodies – the reduce Ireland's vulnerability to the negative x Local Plans achievement of the impacts of climate change. x Stakeholder Consultation objectives of the regulatory framework for environmental protection and management National Renewable x A strategic approach for Ireland including not applicable Renewable Energy To cumulatively Energy Action Plan measures to meet European targets for Directive 2009/28/EC contribute towards – in 2020 including Ireland’s 16% target of combination with other gross final consumption to come from users and bodies – the renewables by 2020 achievement of the objectives of the regulatory framework for environmental protection and management National Energy x This is the second National Energy x The Plan reviews the original 90 actions outlined in the first Plan not applicable To cumulatively Efficiency Action Plan Efficiency Action Plan for Ireland and updates/renews/removes them as appropriate contribute towards – in for Ireland 2007 – 2020 combination with other (2007) users and bodies – the achievement of the objectives of the regulatory framework for environmental protection and management CAAS for Carlow County Council 110 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Sustainable x Provides an analysis and a strategic not applicable not applicable To cumulatively Development – A framework for sustainable development in contribute towards – in Strategy for Ireland Ireland combination with other (1997) x Identifies the approaches required to users and bodies – the support sustainable development achievement of the objectives of the regulatory framework for environmental protection and management Wildlife Act of 1976 x The act provides protection and x Provides protection for certain species, their habitats and not applicable The Council is obliged to conservation of wild flora and fauna important ecosystems comply with, as relevant Wildlife (Amendment) x Give statutory protection to NHAs and appropriate, the Act, 2000 x Enhances wildlife species and their habitats requirements of this x Includes more species for protection legislation Actions for Biodiversity x Sets out strategic objectives, targets and x To mainstream biodiversity in the decision making process across not applicable To cumulatively 2011-2016 Ireland’s actions to conserve and restore Ireland’s all sectors contribute towards – in National Biodiversity biodiversity and to prevent and reduce the x To substantially strengthen the knowledge base for conservation, combination with other Plan, 2011 loss of biodiversity in Ireland and globally management and sustainable use of biodiversity users and bodies – the x To increase awareness and appreciation of biodiversity and achievement of the ecosystems services objectives of the x To conserve and restore biodiversity and ecosystem services in regulatory framework for the wider countryside environmental protection x To conserve and restore biodiversity and ecosystem services in and management the marine environment x To expand and improve on the management of protected areas and legally protected species x To substantially strengthen the effectiveness of international governance for biodiversity and ecosystem services The Planning System x Sets out comprehensive mechanisms for x Avoid inappropriate development in areas at risk of flooding Planning and The Council is obliged to and Flood Risk the incorporation of flood risk identification, x Avoid new developments increasing flood risk elsewhere, including Development Act 2000 comply with, as relevant Management – assessment and management into the that which may arise from surface water run-off (as amended) and appropriate, the Guidelines for Planning planning process x Ensure effective management of residual risks for development requirements of these Authorities (2009) x Ensures flood risk is a key consideration permitted in floodplains S.I. No. 122/2010 EC Guidelines x in preparing development plans and local x Avoid unnecessary restriction of national, regional or local (Assessment and area plans and in the assessment economic and social growth Management of Flood x of planning applications x Improve the understanding of flood risk among relevant Risks) Regulations 2010 x Implementation of the Guidelines is through stakeholders actions at national, regional, local authority x Ensure that the requirements of EU and national law in relation to S.I. No. 470/2012 and site-specific levels the natural environment and nature conservation are complied European Union with at all stages of flood risk management. (Environmental Impact Assessment) (Flood Risk) Regulations 2012. CAAS for Carlow County Council 111 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 European Communities x Transpose the Water Framework Directive x Implements River basin districts and characterisation of RBDs and Water Framework The Council is obliged to (Water Policy) into legislation River Basin Management Plans Directive 2000/60/EC comply with, as relevant Regulations of 2003 (SI x Outlines the general duty of public x Requires the public to be informed and consulted on the Plan and and appropriate, the 722 of 2003) authorities in relation to water for progress reports to be published on RBDs requirements of this x Identifies the competent authorities in x Implements a Register of protected areas, Classification systems legislation European Communities charge of water policy (amended to Irish and Monitoring programmes for water bodies (Water Policy) Water in 2013) and gives EPA and the CER x Allows the competent authority to recover the cost of Regulations of 2003 (SI the authority to regulate and supervise their damage/destruction of status of water body 350 of 2014) actions x Outlines environmental objectives and programme of measures and environmental quality standards for priority substances x Outlines criteria for assessment of groundwater European Communities x Transpose the requirements of the Water x Outlines environmental objectives to be achieved for surface Water Framework The Council is obliged to Environmental Framework Directive into Irish Legislation water bodies Directive 2000/60/EC comply with, as relevant Objectives (Surface x Outlines surface water quality standards and appropriate, the waters) Regulations of x Establishes threshold values for the classification and protection requirements of this 2009 (SI 272 of 2009) of surface waters against pollution and deterioration in quality legislation European Communities x Transpose the requirements of the x Outlines environmental objectives to be achieved for groundwater Water Framework The Council is obliged to Environmental Groundwater Directive 2006/118/EC into bodies of groundwater against pollution and deterioration in Directive 2000/60/EC comply with, as relevant Objectives Irish Legislation quality Groundwater Directive and appropriate, the (Groundwater) x Sets groundwater quality standards (2006/118/EC) requirements of this Regulations of 2010 (SI x Outlines threshold values for the classification and protection of legislation 9 of 2010) groundwater European Communities Environmental Objectives (Groundwater) Regulations 2010 (S.I. No. 9/2010) (as amended) Water Pollution Acts x The Water Pollution Acts allow Local The Water Pollution Acts enable local authorities to: Water Services Act 2013 The Council is obliged to 1977 to 1990 Authorities the authority regulate and x prosecute for water pollution offences; comply with, as relevant supervise actions relating to water in their x attach appropriate pollution control conditions in the licensing of and appropriate, the division effluent discharges from industry, etc., made to waters; requirements of this x issue notices ("section 12 notices") to farmers, etc., specifying legislation measures to be taken within a prescribed period to prevent water pollution; x issue notices requiring a person to cease the pollution of waters and requiring the mitigation or remedying of any effects of the pollution in the manner and within the period specified in such notices; x seek court orders, including High Court injunctions, to prevent, terminate, mitigate or remedy pollution/its effects; x prepare water quality management plans for any waters in or adjoining their functional areas European Communities x Transpose the Urban Waste Water x Sets out the legislative requirements for urban waste water Urban Waste Water The Council is obliged to (Urban Waste Water Treatment Directive into Irish Legislation collection and treatment systems Treatment Directive comply with, as relevant Treatment) Regulations x Aims to protect receiving waters from x Provides for monitoring programmes of discharges (91/271/EEC) and appropriate, the 2001 (S.I. No. environmental damage arising from Urban x Specifies threshold values and minimum standards for water requirements of this 254/2001) Wastewater quality legislation CAAS for Carlow County Council 112 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Water Services Act x Provides the water services infrastructure Key strategic objectives include: not applicable The Council is obliged to 2007 x Outlines the responsibilities involved in x Ensuring Irish Water delivers infrastructural projects that meet comply with, as relevant delivering and managing water services key public health, environmental and economic objectives in the and appropriate, the Water Services x Identifies the authority in charge of water services sector. requirements of this (Amendment) Act 2012 provision of water and waste water supply x Ensuring the provision of adequate water and sewerage services legislation x Irish Water was given the responsibility of in the gateways and hubs listed in the National Spatial Strategy, Water Services Act (No. the provision of water and wastewater and in other locations where services need to be enhanced. 2) 2013 services in the amendment act during 2013, x Ensuring good quality drinking water is available to all consumers therefore these services are no longer the of public and group water supplies, in compliance with national responsibility of the 34 Local Authorities in and EU drinking water standards Ireland x Ensuring the provision of the remaining infrastructure needed to provide secondary wastewater treatment, for compliance with the requirements of the EU Urban Wastewater Treatment Directive. x Promoting water conservation through Irish Water’s Capital Investment Plan, the Rural Water Programme and other measures. x Monitoring the on-going implementation of septic tanks inspection regime and the National Inspection Plan for Domestic Waste Water Treatment Systems. x Ensuring a fair funding model to deliver water services. x Overseeing the establishment of an economic regulation function under the CER. Irish Water’s Water x This Water Services Strategic Plan sets out Six strategic objectives as follows: The Water Services (No. To cumulatively Services Strategic Plan strategic objectives for the delivery of water 2) Act (2013) contribute towards – in (Draft 2015) and services over the next 25 years up to 2040. x Meet Customer Expectations. combination with other associated Proposed It details current and future challenges x Ensure a Safe and Reliable Water Supply. users and bodies – the Capital Investment Plan which affect the provision of water services x Provide Effective Management of Wastewater. achievement of the 2014-2016 and identifies the priorities to be tackled in x Protect and Enhance the Environment. objectives of the the short and medium term. x Support Social and Economic Growth. regulatory framework for x Invest in Our Future. environmental protection and management National Spatial x Planning framework for Ireland x Proposes that areas of sufficient scale and critical mass will be Planning and To cumulatively Strategy 2002-2020 x Aims to achieve a better balance of social, built up through a network of gateways, hubs and key town Development Act 2000 contribute towards – in (2002) economic and physical development across (as amended) combination with other Ireland, supported by effective planning users and bodies – the achievement of the objectives of the regulatory framework for environmental protection and management Grid25 Implementation x Framework for the development of the x Seeks to implement the provisions of the 2007 Government White not applicable To cumulatively Programme electricity transmission grid in the short, Paper on Energy -“Delivering a Sustainable Energy Future for contribute towards – in medium and long terms, to support a Ireland” in terms of development of electricity transmission combination with other long-term sustainable and reliable electricity infrastructure users and bodies – the supply achievement of the objectives of the regulatory framework for environmental protection and management CAAS for Carlow County Council 113 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 National Landscape x Aims to implement the European Landscape The objectives of the National Landscape Strategy are to: not applicable To cumulatively Strategy 2015 Convention in Ireland by providing for x Recognise landscapes in law contribute towards – in specific measures to promote the x Develop a National Landscape Character Assessment; combination with other protection, management and planning of x Develop Landscape Policies; users and bodies – the the landscape. x Increase Landscape Awareness; achievement of the x Identity Education, Research and Training Needs; and objectives of the x Strengthen Public Participation. regulatory framework for environmental protection and management National Rural x The National Rural Development At a more detailed level, the programme also: not applicable To cumulatively Development Programme, prepared by the Department of contribute towards – in Programme (draft/in Agriculture, Fisheries and Food, sets out a x Supports structural change at farm level including training combination with other preparation) national programme based on the EU young farmers and encouraging early retirement, support for users and bodies – the framework for rural development and restructuring, development and innovation; achievement of the prioritises improving the competitiveness of x Aims to improve the environment, biodiversity and the objectives of the agriculture, improving the environment and amenity value of the countryside by support for land regulatory framework for improving the quality of life in rural areas management through funds such as Natura 2000 payments environmental protection etc.; and and management x Aims to improve quality of life in rural areas and encouraging diversification of economic activity through the implementation of local development strategies such as non- agricultural activities National Forestry x Represents Ireland’s proposals for 100% Measures include the following: not applicable To cumulatively Programme 2014-2020 State aid funding for a new Forestry contribute towards – in Programme for the period 2014 – 2020. x Afforestation and Creation of Woodland combination with other x NeighbourWood Scheme users and bodies – the x Forest Roads achievement of the x Reconstitution Scheme objectives of the x Woodland Improvement Scheme regulatory framework for x Native Woodland Conservation Scheme environmental protection x Knowledge Transfer and Information Actions and management x Producer Groups x Innovative Forest Technology x Forest Genetic Reproductive Material x Forest Management Plans National Peatlands x This Draft Strategy, prepared by the not applicable not applicable To cumulatively Strategy (draft/in National Parks and Wildlife Service, will, contribute towards – in preparation) when finalised, establish principles in combination with other relation to Irish peatlands in order to guide users and bodies – the Government policy. The Draft Strategy aims achievement of the to provide a framework for which all of the objectives of the peatlands within the State can be managed regulatory framework for responsibly in order to optimise their social, environmental protection environmental and economic contribution. and management CAAS for Carlow County Council 114 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 National Biodiversity x This Action Plan sets out an integrated Includes detailed actions for the electricity sector, transport fuel sector, not applicable To cumulatively Action Plan strategy for collective delivery of the heat sector, research and development sector. contribute towards – in potential benefits of bioenergy resources combination with other across the agriculture, enterprise, transport, users and bodies – the environment and energy sectors. achievement of the objectives of the regulatory framework for environmental protection and management Flood Risk Management x The national Catchment Flood Risk CFRAM Studies are being undertaken for all River Basin Districts. not applicable To cumulatively Plans arising from Assessment and Management (CFRAM) contribute towards – in National Catchment programme commenced in Ireland in 2011 The studies are focusing on areas known to have experienced flooding combination with other Flood Risk Assessment and is being overseen by the Office of in the past and areas that may be subject to flooding in the future users and bodies – the and Management Public Works. The CFRAM Programme is either due to development pressures or climate change. In 2014, draft achievement of the Programme (draft/in intended to deliver on core components of Flood Maps will be published. The final output from the studies will be objectives of the preparation) the National Flood Policy, adopted in 2004, CFRAM Plans, to be published in or after 2016. The Plans will define regulatory framework for and on the requirements of the EU Floods the current and future flood risk in the River Basin Districts and set out environmental protection Directive. how this risk can be managed. and management Food Harvest 2020 x Sets out a vision and recommendations for x Seeks for the improvement of all agricultural sectors at all levels in not applicable To cumulatively the agri-food industry based on factual terms of sustainability, environmental consideration and contribute towards – in information, figures and trends in order to marketing development. combination with other allow for further productivity, prosperity users and bodies – the and sustainability within this sector. achievement of the objectives of the regulatory framework for environmental protection and management Regional and Inter-County Plan / Programme / High Level Aim/ Purpose/ Objective Lower level relevant objectives , actions etc. Relevant legislation Relevance to the CDP Guidelines in Ireland Regional Planning x The Guidelines provide a planning x Aim to give regional effect to the National Spatial Strategy Requirement of the To cumulatively Guidelines for the South framework for the future physical, economic x Guide the Development Plans and lower tier plans of planning Planning and contribute towards – in East Region 2010 -2022 and social development of the South East authorities Development Act combination with other Region which includes County Carlow (2000), as amended users and bodies – the achievement of the objectives of the regulatory framework for environmental protection and management CAAS for Carlow County Council 115 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 The South East River x Establish a framework for the protection of x Aim to protect and enhance all water bodies in the RBD and meet Requirement of the To cumulatively Basin Management Plan water bodies at River Basin District (RBD) the environmental objectives outlined in Article 4 of the Water Water Framework contribute towards – in and associated level Framework Directive Directive (2000/60/EC) combination with other Programmes of x Preserve, prevent the deterioration of water x Identify and manages water bodies in the RBD users and bodies – the Measures status and where necessary improve and x Establish a programme of measures for monitoring and improving European Communities achievement of the maintain “good status” of water bodies in water quality in the RBD (Water Policy) objectives of the that RBD x Involve the public through consultations Regulations, 2003 (SI regulatory framework for x Promote sustainable water usage No. 722) (as amended) environmental protection and management Guidelines for the Establishment of River Basin District Advisory Councils (RBDAC) Water Quality x Ensure that the quality of waters covered x Monitoring of water bodies against quality standards Water Pollution Acts To cumulatively Management Plans by the plan is maintained x Outlines management programmes for water catchments 1977 to 1990 contribute towards – in x Maintain and improve the quantity and x Purpose is to maintain and improve the quantity and quality of combination with other quality of water included in the Plan scope groundwater users and bodies – the achievement of the objectives of the regulatory framework for environmental protection and management Management Plans for Article 6(1) of the Habitats Directive requires that Integrated Management Plans can be practical, achievable and Habitats Directive To cumulatively Natura 2000 sites Member States establish the necessary sustainable and have regard to all relevant ecological, cultural, social contribute towards – in (note that no conservation measures for Special Area of and economic considerations and with special regard to local combination with other Management Plans Conservation involving, if need be, appropriate communities. users and bodies – the which have been management plans specifically designed for the achievement of the prepared for Natura sites or integrated into other development plans. objectives of the 2000 sites relevant to regulatory framework for the Plan) environmental protection and management Outputs from the South x The national Catchment Flood Risk CFRAM Studies are being undertaken for all River Basin Districts. The not applicable To cumulatively Eastern Catchment Assessment and Management (CFRAM) studies are focusing on areas known to have experienced flooding in contribute towards – in Flood Risk Assessment programme commenced in Ireland in 2011 the past and areas that may be subject to flooding in the future either combination with other and Management and is being overseen by the Office of due to development pressures or climate change. In 2014, draft Flood users and bodies – the Programme Public Works. The CFRAM Programme is Maps will be published. The final output from the studies will be achievement of the intended to deliver on core components of CFRAM Plans, to be published in or after 2016. The Plans will define objectives of the the National Flood Policy, adopted in 2004, the current and future flood risk in the River Basin Districts and set out regulatory framework for and on the requirements of the EU Floods how this risk can be managed. environmental protection Directive. The Programme is being and management implemented through CFRAM Studies which are being undertaken for each of the six river basin districts in Ireland. CAAS for Carlow County Council 116 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 Southern Region Waste The regional plan provides the framework for Strategic objectives: European Directive To cumulatively Management Plan waste management for a period of six years and x Policy & Legislation (2008/98/EC) on Waste contribute towards – in 2015-2021 sets out a range of policies and actions in order x Prevention (Waste Framework combination with other to meet specified mandatory and performance x Resource Efficiency Directive); users and bodies – the targets. The strategic vision of the regional x Coordination Council Decision achievement of the waste plan is to rethink our approach to x Infrastructure Planning (200/532/EC) objectives of the managing waste, by viewing our waste streams x Enforcement & Regulations establishing a list of regulatory framework for as valuable material resources, leading to a x Protection wastes; and environmental protection healthier environment and sustainable x Other Wastes Regulation (1013/2006) and management commercial opportunities for our economy. on the shipments of waste Freshwater Pearl Mussel x Identifies the current status of the species x Identifies pressures on Freshwater Pearl Mussels for each of the Requirement of Water To cumulatively Basin Management and the reason for loss or decline designated populations in Ireland Framework Directive contribute towards – in Plans x Identifies measure required to improve or x Outlines restoration measures required to ensure favourable (2000/60/EC) and combination with other restore current status conservation status Habitats Directive users and bodies – the (92/43/EEC) achievement of the European Communities objectives of the (Water Policy) regulatory framework for Regulations 2003 (S.I. environmental protection No. 722 of 2003) and management European Communities (Birds and Natural Habitats) Regulations 2011 (S.I. No. 477/2011) The Wildlife Act 1976 and the Wildlife (Amendment) Act 2000 County and Local Plan / Programme / High Level Aim/ Purpose/ Objective Lower level relevant objectives , actions etc. Relevant legislation Relevance to the CDP Guidelines in Ireland County Development x Statutory documents which provide detailed x Identify issues of relevance to the area and outlines principles for Planning and To cumulatively Plans, Local Area Plans planning policies to ensure proper planning future development of area Development Act 2000 contribute towards – in and associated (as amended) combination with other and sustainable development of area x Is consistent with relevant County/Town Development Plans, documents in the users and bodies – the x Set out objectives for future planning and National Spatial Strategy and Regional Planning Guidelines following authorities: achievement of the development Carlow, Kilkenny, objectives of the Wexford, Wicklow, x County Development Plans provide the key regulatory framework for Kildare and Laois. parameters for lower tier plans such as the environmental protection future population and housing targets and and management sets out the broad strategy for the future economic and social development of these towns. CAAS for Carlow County Council 117 SEA Environmental Report for the draft Tullow Local Area Plan 2016-2022 County Carlow 2021 The LECP is to set out, for a six year period, the The LECP and County Development Plan are closely linked. The LECP Local Government To cumulatively Local Economic & objectives and actions needed to promote and must be consistent with the Core Strategy of the development plan and Reform Act 2014 contribute towards – in Community Plan support the economic development and the local the development plan will need to underpin the aims of the LECP where combination with other 2016-2021 and community development of the local there are ‘land use’ or ‘development’ related objectives contained in the users and bodies – the authority area, both by itself directly and in LECP. The development plan gives effect to the objectives of the LECP. achievement of the partnership with other economic and community objectives of the development stakeholders. regulatory framework for environmental protection and management CAAS for Carlow County Council 118 SEA ENVIRONMENTAL REPORT APPENDIX II – NON-TECHNICAL SUMMARY FOR THE DRAFT TULLOW LOCAL AREA PLAN 2016 - 2022 for: Carlow County Council Athy Road Carlow County Carlow by: CAAS Ltd. 2nd Floor, The Courtyard 25 Great Strand Street Dublin 1 JULY 2016 Includes Ordnance Survey Ireland data reproduced under OSi Licence Number 2014/21/CCMA/CarlowCountyCouncil. Unauthorised Reproduction infringes Ordnance Survey Ireland and Government of Ireland Copyright. © Ordnance Survey Ireland Appendix II: Non-Technical Summary Table of Contents Section 1 Introduction and Terms of Reference ...... 1 Section 2 The Local Area Plan ...... 2 2.1 Vision and Strategic Aims ...... 2 2.2 Relationship with other relevant Plans and Programmes ...... 2 Section 3 The Environmental Baseline ...... 4 3.1 Introduction ...... 4 3.2 Likely Evolution of the Environment in the Absence of the Plan ...... 4 3.3 Biodiversity and Flora and Fauna ...... 5 3.4 Population and Human Health ...... 9 3.5 Soil ...... 9 3.6 Water ...... 9 3.7 Air and Climatic Factors ...... 12 3.8 Material Assets ...... 13 3.9 Cultural Heritage ...... 13 3.10 Landscape ...... 15 3.11 Overlay of Environmental Sensitivities ...... 15 3.12 Appropriate Assessment and Strategic Flood Risk Assessment ...... 18 3.13 Strategic Environmental Objectives ...... 18 Section 4 Alternatives ...... 20 4.1 Introduction ...... 20 4.2 Description of Alternatives ...... 20 4.3 Evaluation of Alternatives ...... 24 Section 5 Evaluation of Plan Provisions ...... 29 5.1 Overall Findings ...... 29 5.2 Potential Adverse Effects and their Determination ...... 29 5.3 Residual Adverse Effects ...... 29 Section 6 Mitigation and Monitoring Measures ...... 31 6.1 Mitigation ...... 31 6.2 Monitoring ...... 31 CAAS for Carlow County Council i Appendix II: Non-Technical Summary Section 1 Introduction and Terms of Reference This is the Non-Technical Summary of the Environmental Report for the Tullow Local Area Plan 2016- 2022. The purpose of the Environmental Report is to provide a clear understanding of the likely environmental consequences of decisions regarding the adoption and implementation of the Plan. What is an SEA? SEA is a systematic process of predicting and evaluating the likely environmental effects of implementing a proposed plan, or other strategic action, in order to ensure that these effects are appropriately addressed at the earliest appropriate stage of decision-making on a par with economic, social and other considerations. Why is it needed? The SEA has been carried out in order to comply with the provisions of the SEA Regulations and in order to improve planning and environmental management within Tullow. The output of the process is an Environmental Report that should be read in conjunction with the Plan. How does it work? All of the main environmental issues in the area were assembled and presented to the team who prepared the Plan. This helped them to devise a Plan that protects whatever is sensitive in the environment. It also helped to identify wherever potential conflicts between the Plan and the environment exist and enabled these conflicts to be mitigated. The SEA was scoped in consultation with designated environmental authorities. What is included in the Environmental Report that accompanies the Plan? The Environmental Report contains the following information: o A description of the environment and the key environmental issues; o A description and assessment of alternatives for the Plan; o An assessment of the provisions of the Plan; and, o Mitigation measures which set out to aid compliance with important environmental protection legislation - e.g. the Water Framework Directive, the Habitats Directive - and which will avoid/reduce the environmental effects of implementing the Plan. What happens at the end of the process? An SEA Statement has been prepared which summarises, inter alia, how environmental considerations have been integrated into the Plan. CAAS for Carlow County Council 1 Appendix II: Non-Technical Summary Section 2 The Local Area Plan 2.1 Vision and Strategic Aims Carlow County Council’s Vision for the town included in the Draft Plan is as follows: To provide a focused approach to planning for the future growth of Tullow in a coherent and spatial fashion which seeks to deliver high levels of employment and balances future sustainable development with the conservation and enhancement of the town’s natural and built environment. The main Strategic Objectives for the town included in the Draft Plan are as follows: 1. To create vibrant integrated communities in a more consolidated urban form. 2. To create a thriving town which contributes to the natural and built heritage amenities of the town and provides a vibrant and vital mixed-use environment. 3. To facilitate the creation of a sustainable vibrant economy which maximises the unique attributes of the town. The Council is committed to delivering this vision of the town through working in partnership with the local community and local organisations, and through promoting the policies and objectives contained in the LAP, and future, LAPs. 2.2 Relationship with other relevant Plans and Programmes Introduction The Plan sits within a hierarchy of land use forward planning strategic actions. The Plan must comply with relevant higher-level strategic actions and may, in turn, guide lower level strategic actions. The following sections identify a number of these strategic actions, further details of which are contained in the main Plan document. The Plan is at the lower level of the hierarchy in the context of national, regional and county level plans. The preparation of the Local Area Plan has also been informed and influenced by various local government, national and international policy documents including (but not limited to) the following: International x Agenda 2000 x Local Agenda 21 x The European Spatial Development Perspective (ESDP) x Various EU Directives National x Infrastructure and Capital Investment 2012-16: Medium Term Exchequer Framework, 2011 x Sustainable Development: A Strategy for Ireland, 1997 x National Spatial Strategy 2002 – 2020 (NSS) x Ministerial Guidelines issued under Section 28 of the Planning and Development Act 2000-2011 Regional x Regional Planning Guidelines for the South East Region 2010-2022 CAAS for Carlow County Council 2 Appendix II: Non-Technical Summary County x Carlow County Development Plan 2015-2021 Regional Planning Guidelines County Carlow, including Tullow, is subject to the Regional Planning Guidelines for the South Eastern Regional 2010-2022 that provide a framework for the long-term strategic development of the South- Eastern Region. The Guidelines do this through setting out goals, policies and objectives in relation to population targets, housing, infrastructure, economic development, environment, amenities, social infrastructure and community development, ensuring the successful implementation of the NSS at regional, county and local level. Carlow County Development Plan 2015-2021 The Carlow County Development Plan 2015-2021 sets out the strategic planning and sustainable development of County Carlow over its lifetime and is consistent with the Regional Planning Guidelines. Environmental Protection Objectives The Local Area Plan is subject to a number of high-level environmental protection policies and objectives with which it must comply. Examples of Environmental Protection Objectives include the aim of the EU Habitats Directive - which is to contribute towards ensuring biodiversity through the conservation of natural habitats and of wild fauna and flora in the European territory of Member States - and the purpose of the Water Framework Directive - which is to establish a framework for the protection of inland surface waters, transitional waters, coastal waters and groundwater which, among other things, prevents deterioration in the status of all water bodies and protects, enhances and restores all waters with the aim of achieving a good status. CAAS for Carlow County Council 3 Appendix II: Non-Technical Summary Section 3 The Environmental Baseline 3.1 Introduction The environmental baseline of Tullow is described in this section. This baseline together with the Strategic Environmental Objectives, which are identified further in the document, is used in order to identify, describe and evaluate the likely significant environmental effects of implementing the Draft Plan and in order to determine appropriate monitoring measures. The environmental baseline is described in line with the legislative requirements encompassing the following components – biodiversity, flora and fauna, population, human health, soil, water, air and climatic factors, material assets, cultural heritage, landscape and the interrelationship between these components. The lack of a centralised data source that could make all environmental baseline data for the Plan area both readily available and in a consistent format posed a challenge to the SEA process. This difficulty is one that has been encountered while undertaking SEAs at local authorities across the Country and was overcome by investing time in the collection of data from various sources and through the use of Geographical Information Systems. 3.2 Likely Evolution of the Environment in the Absence of the Plan The 2010-2016 Tullow Local Area Plan contains provisions that contribute towards environmental protection and sustainable development within Tullow. If the current Plan was to expire and not be replaced by the new 2016 Plan, this would result in a deterioration of the town’s planning and environmental protection framework. Although higher-level environmental protection objectives – such as those of the new 2015-2021 County Development Plan and various EU Directives and transposing Irish Regulations – would still apply, the deterioration of this framework would mean that new development would be less coordinated and controlled. Such development would have the potential to result in an increase in the occurrence of adverse effects on all environmental components, especially those arising cumulatively. Cumulative effects occur as a result of the addition of many small impacts to create one larger, more significant, impact. Such adverse effects could include: x Loss of biodiversity with regard to Natura 2000 Sites and Annexed habitats and species; x Loss of biodiversity with regard to ecological connectivity and stepping stones; x Loss of biodiversity with regard to designated sites including Wildlife Sites and species listed on Schedule 5 of the Wildlife Act 1976; x Spatially concentrated deterioration in human health; x Adverse impacts on the hydrogeological and ecological function of the soil resource; x Adverse impacts upon the status of water bodies arising from changes in quality, flow and/or morphology; x Increase in the risk of flooding; x Failure to provide adequate and appropriate waste water treatment; x Failure to comply with drinking water regulations and serve new development with adequate drinking water that is both wholesome and clean; x Increases in waste levels; x Failure to contribute towards sustainable transport and associated impacts; x Effects on entries to the Record of Monuments and Places and other archaeological heritage; x Effects on entries to the Records of Protected Structures and other architectural heritage; and x Occurrence of adverse visual impacts. CAAS for Carlow County Council 4 Appendix II: Non-Technical Summary 3.3 Biodiversity and Flora and Fauna Natura 2000 Candidate Special Areas of Conservation (cSACs) have been selected for protection under the European Council Directive on the conservation of natural habitats and of wild fauna and flora (92/43/EEC) by the (former) Department of the Environment, Heritage and Local Government due to their conservation value for habitats and species of importance in the European Union. Special Protection Areas (SPAs) have been selected for protection under the 1979 European Council Directive on the Conservation of Wild Birds (79/409/EEC) due to their conservation value for birds of importance in the European Union. SPAs, along with SACs, comprise Ireland’s Natura 2000 network – part of an EU-wide network of protected areas established under the Habitats Directive. There is one Natura 2000 site occurring inside the Plan boundary, which is the River Slaney Valley cSAC. This site has been designated due to the presence of a number of habitats and species including Floating River Vegetation, Old Oak Woodlands, Alluvial Forests, Freshwater Pearl Mussel, Sea Lamprey, Brook Lamprey, River Lamprey, Atlantic Salmon and Otter. cSACs and SPAs in the vicinity of the Plan area are shown on Table 3.1 The River Slaney cSAC transects the Plan area and is shown on Figure 3.1. Table 3.1 Natura 2000 Sites within 15km of the Plan area Natura 2000 Sites Designation Code Site Name SAC 0770 Blackstairs Mountains SAC 0781 Slaney River Valley SAC 1757 Holdenstown Bog SAC 2162 River Barrow and River Nore SAC Proposed Natural Heritage Areas Natural Heritage Areas (NHAs) are designated due to their national conservation value for ecological and/or geological/geomorphological heritage. They cover nationally important semi-natural and natural habitats, landforms or geomorphological features, wildlife plant and animal species or a diversity of these natural attributes. NHAs are designated under the Wildlife (Amendment) Act 2000. Proposed NHAs (pNHA) were published on a non-statutory basis in 1995, but have not since been statutorily proposed or designated. There are no NHAs or pNHAs occurring inside the Plan boundary. pNHAs within 15km of the Plan area are listed on Table 3.2 and mapped on Figure 3.2. There are no NHAs located within the 15km buffer zone of the plan area. Table 3.2 pNHAs in the vicinity of the Plan area Proposed Natural Heritage Areas Designation Code Site Name pNHA 770 Blackstairs Mountains 781 River Slaney Valley 788 Ardristen Fen 792 Baggot’s Wood 797 Ballymoon Esker 806 Cloghristick Wood 808 John’s Hill 810 Oakpark 1389 Corballis Hill 1757 Holdenstown Bog 1852 Tomnafinnoge Wood CAAS for Carlow County Council 5 Appendix II: Non-Technical Summary Ecological Networks and Connectivity Ecological networks are important in connecting areas of local biodiversity with each other and with nearby designated sites so as to prevent islands of habitat from being isolated entities. They are composed of linear features, such as treelines, hedgerows and rivers/streams, which provide corridors or stepping-stones for wildlife species moving within their normal range. They are important for the migration, dispersal and genetic exchange of species of flora and fauna particularly for mammals, especially for bats and small birds and facilitate linkages both between and within designated ecological sites, the non-designated surrounding countryside and the town. Important ecological networks comprise a variety of features including the Slaney River that flows through the Plan area, various agricultural lands, stands of trees and hedgerows. CAAS for Carlow County Council 6 Appendix II: Non-Technical Summary Figure 3.1 River Slaney Valley cSAC Source: NPWS (datasets downloaded February 2016) CAAS for Carlow County Council 7 Appendix II: Non-Technical Summary Figure 3.2 NHAs and pNHAs in the vicinity of the Plan area Source: NPWS (datasets downloaded February 2016) CAAS for Carlow County Council 8 Appendix II: Non-Technical Summary 3.4 Population and Human Health Population The population of Tullow was recorded as being 3,972 in 2011. Human Health Human health has the potential to be impacted upon by environmental vectors (i.e. environmental components such as air, water or soil through which contaminants or pollutants, which have the potential to cause harm, can be transported so that they come into contact with human beings). Hazards or nuisances to human health can arise as a result of exposure to these vectors arising from incompatible adjacent land uses for example. These factors have been considered with regard to: the description of the baseline of each environmental component; and the identification and evaluation of the likely significant environmental effects of implementing the Plan. 3.5 Soil Soil can be considered as a non-renewable natural resource because it develops over very long timescales. It is an extremely complex, variable and living medium and performs many vital functions including: food and other biomass production, storage, filtration and transformation of many substances including water, carbon, and nitrogen. Soil has a role as a habitat and gene pool, serves as a platform for human activities, landscape and heritage and acts as a provider of raw materials. Such functions of soil are worthy of protection because of their socio-economic as well as environmental importance. Soils in any area are the result of the interaction of various factors, such as parent material, climate, vegetation and human action. The Geological Survey of Ireland (GSI) completed an audit of County Geological Sites in County Carlow in 2004. This audit identified six Geological Heritage Sites. Three of the County Geological Sites identified (Aclare, Ballymoon Esker and Morrisey’s Quarry) are located within 15km of the Plan area. 3.6 Water Potential Pressures on Water Quality and the Water Framework Directive Human activities, if not properly managed, can cause deterioration in water quality. Pressures exerted by human activities include the following: sewage and other effluents discharged to waters from point sources, e.g. pipes from treatment plants; discharges arising from diffuse or dispersed activities on land; abstractions from waters; and structural alterations to water bodies. Since 2000, Water Management in the EU has been directed by the Water Framework Directive 2000/60/EC (WFD). The WFD requires that all Member States implement the necessary measures to prevent deterioration of the status of all waters - surface, ground, estuarine and coastal - and protect, enhance and restore all waters with the aim of achieving “good status”. All public bodies are required to coordinate their policies and operations so as to maintain the good status of water bodies that are currently unpolluted and improve polluted water bodies to a good status. Ireland has been divided into eight river basin districts or areas of land that are drained by a large river or number of rivers and the adjacent estuarine / coastal areas. The management of water resources is on these River Basin Districts (RBDs). Tullow falls within the South Eastern RBD. Surface Water The WFD defines ‘surface water status’ as the general expression of the status of a body of surface water, determined by the poorer of its ecological status and its chemical status. Ecological status is an expression of the structure and functioning of aquatic ecosystems associated with surface waters. Such waters are classified as of “good ecological status” when they meet Directive requirements. Good surface water chemical status means that concentrations of pollutants in the water body do not exceed the environmental limit values specified in the Directive. CAAS for Carlow County Council 9 Appendix II: Non-Technical Summary Stretches of water bodies upstream and running through the town are currently identified by the EPA as having a Moderate status with while Good status is attributed to stretches of water bodies downstream, to the south of Ford Tullow Bridge. Groundwater For groundwater bodies, the approach to classification is different from that for surface water. For each body of groundwater, both the chemical status and the quantitative must be determined. Both have to be classed as either good or poor. The WFD sets out a series of criteria that must be met for a body to be classed as good chemical and quantitative status. The status of the groundwater underlying the area of Tullow is identified as being of good status. The Geological Survey of Ireland (GSI) rates aquifers according to both their productivity and vulnerability to pollution. Much of the Plan area is underlain by two overlapping aquifers – A locally important aquifer and a Bedrock Aquifer. A gravel aquifer (Burren Basin) occurs to the west and south-west of the Plan area, while as another bedrock aquifer lies to the east. Aquifer vulnerability refers to the ease with which pollutants of various kinds can enter underground water. Figure 3.3 maps aquifer vulnerability for the Plan and surrounding area – much of the area is identified as being of high vulnerability with pockets of extreme vulnerability or ‘rock at or near surface or Karst’ in the surrounding environs of the town. Medium vulnerability exists in small patches to the north, south and east of the town. Flooding A Strategic Flood Risk Assessment (SFRA) has been undertaken alongside the preparation of the Plan. The requirement for SFRA is provided under ‘The Planning System and Flood Risk Management Guidelines for Planning Authorities’ (DEHLG and OPW, 2009). The main source of historic and potential flood risk to development in Tullow is the River Slaney with the river Derreen presenting a low risk. The River Slaney has been subject to a Flood Relief Scheme (FRS). In addition to the River Slaney and Derreen there are three smaller tributaries that drain into the aforementioned rivers. The tributaries do not cause significant impacts and present a low risk. Areas at risk of flooding adjacent to these watercourses are mapped on Figure 3.4. The preparation of the Plan, SEA and SFRA has taken place concurrently and the findings of the SFRA have informed both the Plan and the SEA. The SFRA has facilitated the integration of flood risk management considerations into the Plan. Further detail on lands that are at elevated levels of flood risk within the Plan area can be found within the SFRA that accompanies the Plan. CAAS for Carlow County Council 10 Appendix II: Non-Technical Summary Figure 3.3 Aquifer Vulnerability Source: GSI (2006) Figure 3.4 SFRA Flood Mapping Source: SFRA (2016) CAAS for Carlow County Council 11 Appendix II: Non-Technical Summary 3.7 Air and Climatic Factors Ambient Air Quality In order to protect human health, vegetation and ecosystems, EU Directives set down air quality standards in Ireland and the other Member States for a wide variety of pollutants. These pollutants are generated through fuel combustion, in space heating, traffic, electricity generation and industry and, in sufficient amounts, could affect the well-being of the areas inhabitants. The EU Directives include details regarding how ambient air quality should be monitored, assessed and managed. In order to comply with air quality standards directives, the EPA measures the levels of a number of atmospheric pollutants. For the purposes of monitoring in Ireland, four zones are defined in the Air Quality Standards Regulations 2002 (SI No. 271 of 2002). Tullow is located within Zone D where air quality is currently identified as being “good”. The EPA’s (EPA, 2015) Air Quality in Ireland 2014 identifies that air quality in Ireland continues to be good, with no exceedances for the pollutants measured. Noise - The Environmental Noise Directive Noise is unwanted sound. The Environmental Noise Regulations (SI No. 140 of 2006) transpose into Irish law the EU Directive 2002/49/EC relating to the assessment and management of environmental noise, which is commonly referred to as the Environmental Noise Directive or END. The END defines a common approach intended to avoid, prevent or reduce on a prioritised basis the harmful effects, including annoyance, due to exposure to environmental noise. The END does not set any limit value, nor does it prescribe the measures to be used in the action plans, which remain at the discretion of the competent authorities. Limit values are left to each member state. At this point in time, Ireland does not have any statutory limit values. Climatic Factors The key issue involving the assessment of the effects of implementing the plan on climatic factors relates to greenhouse gas emissions arising from transport. It is noted that the Plan contains a number of actions that respond to potential threats to environmental components arising from a changing climate. Flooding (see Section 3.6) is influenced by climatic factors and the implications of climate change with regard to flood risk in relevant locations have been considered by the SFRA that has been undertaken for the Plan. There are emerging objectives relating to climate adaptation and that there is likely to be future Guidance for climate change proofing of land use plan provisions as is flagged in the National Climate Change Adaptation Framework (DECLG, 2012). In 2009, Ireland's greenhouse gas emissions decreased across all sectors due to the effects of the economic downturn with a decline in total emissions of 7.9 per cent. In 2010, Ireland's emissions fell by a further 0.7 per cent. Ireland’s emissions profile has changed considerably since 1990, with the contribution from transport more than doubling and the share from agriculture reducing since 1998. Travel is a source of: 1. Noise; 2. Air emissions; and 3. Energy use (41.7% of Total Final Energy Consumption in Ireland in 2014 was taken up by transport, the largest take up of any sector)1. Land-use planning contributes to what number and what extent of journeys occur. By addressing journey time through land use planning and providing more sustainable modes and levels of mobility, noise and other emissions to air and energy use can be minimised. Furthermore, by concentrating 1 Sustainable Energy Ireland (2014) Energy in Ireland 1990 – 2014 CAAS for Carlow County Council 12 Appendix II: Non-Technical Summary populations, greenfield development - and its associated impacts - can be minimised and the cost of service provision can be reduced. Maximising sustainable mobility will also help Ireland meet its emission target for greenhouse gases under the 2020 EU Effort Sharing target that commits Ireland to reducing emissions from those sectors that are not covered by the Emissions Trading Scheme (e.g. transport, agriculture, residential) to 20% below 2005 levels. 3.8 Material Assets Waste Water The EPA’s most recent report on waste water treatment performance ‘Urban Waste Water Treatment in 2014’, EPA 2015, identifies that the Tullow Waste Water Treatment Plant (WWTP) failed the water quality standards set down under requirements of the Urban Waste Water Treatment Directive. This is a drop in standards as the WWTP passed the water quality standards in 2013. The development of the town’s wastewater drainage system is essential to facilitate growth. The current Tullow wastewater treatment plant, located on the Bunclody Road, was originally designed with a treatment capacity of 4,000 population equivalent (PE). Recent upgrades to the plant including new intake works, new aeration system and tertiary treatment have allowed for an increase in the organic treatment capacity of the plant. The current loading on the plant is determined at 5,100 PE equivalent. Irish Water have acknowledged that the existing plant is overloaded and have committed to including this plant in Irish Waters Emerging Investment Plan for inclusion in the next Capital Investment Plan. Preliminary works have commenced regarding the design phase of the upgrade works to both the treatment plant and the network. Drinking Water Both the Tullow Water Supply Scheme and the North Regional Water Supply Scheme (both supplying Tullow) are not listed on the EPA’s most recent (Q1 2016) Remedial Action List (a list of public water supplies where remedial action is required to ensure compliance with drinking water standards). The current water supply, between both schemes, is considered to have adequate (headroom) capacity available and would cater for any future development growth during the lifetime of this plan. Water supplied to the town is tested regularly and is consistently of the highest quality. 3.9 Cultural Heritage Archaeological Heritage Tullow’s archaeological heritage is protected under the National Monuments Acts (1930-2004), Natural Cultural Institutions Act 1997 and the Planning Acts. The Record of Monuments and Places (RMP) is an inventory, established under Section 12 of the National Monuments (Amendment) Act 1994, of sites and areas of archaeological significance, numbered and mapped. The RMP includes all known monuments and sites of archaeological importance dating to before 1700 AD, and some sites that date from after 1700 AD. Figure 3.5 shows the spatial distribution of entries to the RMP in Tullow. Architectural Heritage The term architectural heritage is defined in the Architectural Heritage (National Inventory) and Historic Monuments Act 1999 as meaning: all structures and buildings together with their settings and attendant grounds, fixtures and fittings; groups of structures and buildings; and, sites which are of technical, historical, archaeological, artistic, cultural, scientific, social, or technical interest. The Record of Protected Structures (RPS) included in the Plan is legislated for under Section 12 and Section 51 of the Planning and Development Act 2000 as amended. Protected Structures are defined as structures, or parts of structures that are of special interest from an architectural, historical, archaeological, artistic, cultural, scientific, social or technical point of view. Current entries to the RPS in Tullow are mapped on Figure 3.6. Examples include Tullow Monastery National School, St. Columba’s National School, the Bridge House, the Coachhouse on the Dublin Road, the Courthouse and the Museum. CAAS for Carlow County Council 13 Appendix II: Non-Technical Summary Figure 3.5 Archaeological Heritage Source: Carlow County Council (2016) Figure 3.6 Architectural Heritage Source: Carlow County Council (2016) CAAS for Carlow County Council 14 Appendix II: Non-Technical Summary 3.10 Landscape A Landscape Character Assessment (LCA) is a study of a given landscape to determine its ‘character’. Landscape character is the combination of physical, as well as, perceived aspects of the landscape. The Carlow LCA was produced as part of the Carlow County Development Plan 2015-2021. The LCA divides the County into Landscape Character Areas i.e. unique, geographically specific areas of a particular landscape type. The aim of the County Carlow LCA is to provide a tool for decision making regarding development control and to influence landscape policy at local level. In considering landscape character in the area, the Council acknowledges the importance of taking into account adjoining landscape character, landscape features and designations, including those in adjoining counties. There are five Principal Landscape Character Areas. Tullow falls within three character areas, which are as follows: x Central Lowlands Landscape Character Area; x Blackstairs and Mount Leinster Uplands Landscape Character Area, and; x River Slaney – East Rolling Farmland Landscape Character Area. Components of the landscape within and adjacent to Tullow which contribute towards landscape character include the River Slaney, hedgerows and lines of trees. Landscape sensitivity mapping was prepared for the Carlow LCA by according sensitivity rating to the existing adopted Principal Landscape Character Areas. These boundaries were based on extensive LCA fieldwork augmented by ensuring conformity with a number of ‘mappable’ and natural factors such as landcover, soils, geology and slope. A large portion of the built area in Tullow is identified as having the least sensitivity rating, a rating of ‘1’. However, areas to the south and east of the Plan area have been attributed with a higher rating, a rating of ‘4’, while as land to the north-west of the town has the highest sensitivity rating of ‘5’. Other lands to the north and west of the town are attributed with a sensitivity rating of ‘2’. The Plan area itself does not contain protected scenic views or routes. However, there is a protected viewpoint to the south of the Plan area, which provides a view of typical rolling farmland near Mount Wolseley. 3.11 Overlay of Environmental Sensitivities In order to identify where most sensitivities within Tullow occur, a number of the environmental sensitivities described above were weighted and mapped overlapping each other. Figure 3.7 provides an overlay of environmental sensitivities for the town. It is emphasised that the occurrence of environmental sensitivities does not preclude development; rather it flags at a strategic level that the mitigation measures - which have already been integrated into the Plan - will need to be complied with in order to ensure that the implementation of the Plan contributes towards environmental protection. Environmental sensitivities are indicated by colours which range from acute vulnerability (brown) extreme vulnerability (red) to high vulnerability (dark orange) to elevated vulnerability (light orange) to moderate vulnerability (yellow) to low vulnerability (green). Only low, moderate and elevated levels of vulnerability occur within and adjacent to the Plan area. Where the mapping shows a concentration of environmental sensitivities there is an increased likelihood that development will conflict with these sensitivities and cause environmental deterioration. CAAS for Carlow County Council 15 Appendix II: Non-Technical Summary A weighting system applied through Geographical Information System (GIS) software was used in order to calculate the vulnerability of all areas in the town. Environmental considerations are given equal weight as follows, with a slight differentiation is made in certain layers: x Ecological designations (candidate Special Areas of Conservation - 10 points - and proposed Natural Heritage Areas - 5 points); x Cultural heritage (Entries to the Record of Protected Structures and entries to the Record Monuments and Places - 10 points); x Landscape character areas of very high (10 points) and high value (5 points); x Scenic routes and views (10 points); x Sensitive landcover categories (Inland marshes and water bodies - 10 points); x Surface and groundwaters with bad and poor (10 points) and moderate, good and high (5 points) status; x Aquifers which are highly (5 points) or extremely (10 points) vulnerable to pollution; and x Indicative flood zones A (10 points) and B (5 points) from the Strategic Flood Risk Assessment. The most sensitive areas within Tullow are located along the watercourses through the Plan area (on account of the sensitivity of the River Slaney, fluvial flood risk and Natura 2000 site designations). Sensitivity ratings vary along the watercourse from medium to extreme. Other sensitive areas are also identified within the town (these largely relate to cultural heritage designations), however, these are of a comparatively lower rating in comparison to the sensitivities along the river. CAAS for Carlow County Council 16 Appendix II: Non-Technical Summary Figure 3.8 Overlay of Environmental Sensitivities Source: CAAS (2016) CAAS for Carlow County Council 17 Appendix II: Non-Technical Summary 3.12 Appropriate Assessment and Strategic Flood Risk Assessment A Stage 2 Appropriate Assessment (AA) and a Strategic Flood Risk Assessment (SFRA) have both been undertaken alongside the preparation of the Plan. The requirement for AA is provided under the EU Habitats Directive (Directive 1992/43/EEC). The requirement for SFRA is provided under ‘The Planning System and Flood Risk Management Guidelines for Planning Authorities’ (DEHLG and OPW, 2009). The AA concluded that the Plan will not affect the integrity of the Natura 2000 network2 and the SFRA has facilitated the integration of flood risk management considerations into the Plan. The preparation of the Plan, SEA, AA and SFRA has taken place concurrently and the findings of the AA and SFRA have informed both the Plan and the SEA. All recommendations made by the AA and SEA were integrated into the Plan. 3.13 Strategic Environmental Objectives Strategic Environmental Objectives (SEOs) are methodological measures against which the environmental effects of the Plan can be tested. If complied with in full, SEOs would result in an environmentally neutral impact from implementation of the Plan. The SEOs are set out under a range of topics and are used as standards against which the provisions of the Plan can be evaluated in order to help identify areas in which potential adverse impacts may occur. SEOs are distinct from the objectives of the Plan and are developed from international and national policies that generally govern environmental protection objectives. Such policies include those of various European Directives which have been transposed into Irish law and which are intended to be implemented within the Plan area. 2 Except as provided for in Section 6(4) of the Habitats Directive, viz. There must be: (a) no alternative solution available; (b) imperative reasons of overriding public interest for the plan to proceed; and (c) adequate compensatory measures in place. CAAS for Carlow County Council 18 Appendix II: Non-Technical Summary Table 3.3 Strategic Environmental Objectives SEO Code SEO B1 To ensure compliance with the Habitats and Birds Directives with regard to the protection of Natura 2000 Sites and Annexed habitats and species3 B2 To ensure compliance with Article 10 of the Habitats Directive with regard to the management of features of the landscape which - by virtue of their linear and continuous structure or their function act as stepping stones - are of significant importance for wild fauna and flora and/or essential for the migration, dispersal and genetic exchange of wild species B3 To avoid significant impacts on relevant habitats, species, environmental features or other sustaining resources in designated sites including Wildlife Sites and to ensure compliance with the Wildlife Acts 1976-2010 with regard to the protection of species listed on Schedule 5 of the principal Act PHH1 To protect populations and human health from exposure to incompatible landuses S1 To avoid damage to the hydrogeological and ecological function of the soil resource W1 To maintain and improve, where possible, the quality and status of surface waters W2 To prevent pollution and contamination of ground water W3 To comply as appropriate with the provisions of the Flood Risk Management Guidelines M1 To serve new development with adequate and appropriate waste water treatment M2 To serve new development with adequate drinking water that is both wholesome and clean M3 To reduce waste volumes, minimise waste to landfill and increase recycling and reuse C1 To reduce travel related emissions to air and to encourage modal change from car to more sustainable forms of transport CH1 To protect archaeological heritage including entries to the Record of Monuments and Places and/or their context CH2 To protect architectural heritage including entries to the Record of Protected Structures and their context L1 To avoid significant adverse impacts on the landscape 3 ‘Annexed habitats and species’ refer to those listed under Annex I, II & IV of the EU Habitats Directive and Annex I of the EU Birds Directive. CAAS for Carlow County Council 19 Appendix II: Non-Technical Summary Section 4 Alternatives 4.1 Introduction The SEA Directive requires that reasonable alternatives (taking into account the objectives and the geographical scope of the plan or programme) are identified, described and evaluated for their likely significant effects on the environment. The description of the environmental baseline (both maps and text) and Strategic Environmental Objectives (SEOs) are used in the evaluation of alternative development strategies. 4.2 Description of Alternatives Carlow County Council in preparing the Local Area Plan 2016-2022 developed three Development Strategy Options for Tullow. These are detailed on Table 4.1 below and mapped on Figure 4.1, Figure 4.2 and Figure 4.3. Table 4.1 Description of Alternative Development Strategies Alternative Development Alternative Development Alternative Development Strategy 1 Strategy 2 Strategy 3 Development Scenario 1: A Development Scenario 2: Development Scenario 3: To Summary general continuation in Directs new development to consolidate and strengthen accordance with the vacant and infill sites in the the town centre and provide development objectives of town only. for the limited expansion of the current 2010 – 2016 Plan Tullow on the outskirts of the town in a phased sustainable manner. CAAS for Carlow County Council 20 Appendix II: Non-Technical Summary Figure 4.1 Alternative Development Strategy 1 CAAS for Carlow County Council 21 Appendix II: Non-Technical Summary Figure 4.2 Alternative Development Strategy 2 CAAS for Carlow County Council 22 Appendix II: Non-Technical Summary Figure 4.3 Alternative Development Strategy 3 CAAS for Carlow County Council 23 Appendix II: Non-Technical Summary 4.3 Evaluation of Alternatives A number of potentially significant adverse environmental effects that are common to all alternatives and are described on the Table below. Environmental Component Likely Significant Effect, if unmitigated Biodiversity and Flora and Fauna o Loss of biodiversity with regard to designated biodiversity and flora and fauna (including Natura 2000 Sites, proposed Natural Heritage Areas and Annexed habitats and species), ecological connectivity and stepping stones and non-designated biodiversity and flora and fauna (see baseline Section 4.2) Population and Human Health o Spatially concentrated deterioration in human health Soil o Adverse impacts on the hydrogeological and ecological function of the soil resource (especially soil on greenfield lands) Water o Adverse impacts upon the status of water bodies arising from changes in quality, flow and/or morphology o Increase in flood risk (including the River Barrow and its tributaries and underlying groundwater) Material Assets o Failure to provide adequate and appropriate waste water treatment o Failure to comply with drinking water regulations and serve new (it is the function of Irish Water to development with adequate drinking water that is both wholesome and provide for water services needs) clean o Increases in waste levels Air and Climatic Factors o Failure to contribute towards sustainable transport and associated impacts (energy usage and emissions to air including noise and greenhouse gases) Cultural Heritage o Effects on entries to the Record of Monuments and Places and other archaeological heritage o Effects on entries to the Records of Protected Structures and other architectural heritage Landscape o Occurrence of adverse visual impacts Table 4.2 Potentially Significant Adverse Environmental Effects common to all alternatives Alternative Development Strategy 1 would contribute towards efforts to improve sustainable mobility (and associated effects on energy, air, noise and human health) by improving existing pedestrian access and the development of a proposed relief road, however: such a contribution would be outweighed by the overall direction of the Strategy which prefers an expansion of peripheral areas for residential, mixed use, industrial and commercial uses, some of which have no direct link to the town centre. The extent of development provided for would have to be served by infrastructure and could affect flood risk. By providing significant expansion of suburbs of the town and peripheral areas, this alternative would be likely to result in the greatest number and extent of residual adverse effects across the widest area. Such effects include loss of ecology (including non-designated ecology and ecological corridors and stepping-stones), the sealing of greenfield soils and threats to the status of waters. This Scenario would provide for various uses on greenfield lands in the peripheries of the plan area, adversely impacting upon the consolidation of the town and sustainable mobility. The visual appearance of peripheral greenfield areas within the LAP area would be most likely to change under this scenario. Alternative Development Strategy 2 directs new development to vacant and infill sites in the town only. By consolidating the existing town centre and improving connectivity, this alternative would contribute towards efforts to both improve sustainable mobility (and associated effects on CAAS for Carlow County Council 24 Appendix II: Non-Technical Summary energy, air, noise and human health), protect cultural heritage and improve the residential fabric within the town centre. However, by restricting new development to high density to vacant and infill sites, this alternative would be likely to result in an increase of applications for development outside the LAP area thereby weakening the town centre. It would be a challenge to serve peripheral areas with the necessary infrastructure. The increase in applications for development within the periphery to the LAP area would provide for the greatest number and extent of residual adverse effects beyond the LAP area as a result of greenfield development. Such effects include loss of ecology (including non-designated ecology and ecological corridors and stepping-stones), the sealing of greenfield soils and threats to the status of waters and changes to the visual appearance of lands. By encouraging an extent of development within the town centre, this alternative would somewhat contribute towards the protection and management of the environment elsewhere, however the higher densities of development would have the potential to adversely impact upon the character of the town including cultural heritage and its context. This alternative provides a significant amount of lands zoned primarily for Enterprise and Employment uses in the west and south west of the Plan area. The extent of lands zoned would be in significantly in excess of the needs of the town and would lead to unnecessary environmental effects on a variety of environmental components as a result of greenfield development in this edge of town location. Such effects would include a hindrance of efforts to maximise sustainable mobility as well as adverse effects on non-designated biodiversity and visual impacts. Alternative Development Strategy 3 consolidates and strengthens the town centre and provides for the limited expansion of Tullow on the outskirts of the town in a phased sustainable manner. Consolidation of the town centre, phasing of residential development, improvement of pedestrian links and public spaces are all provided for. By providing for development in this manner, this alternative would maximise sustainable mobility (and associated effects on energy, air, noise and human health) and protect cultural heritage within the town centre. Overall, new development would be best served by existing and planned infrastructure under this scenario. By limiting development within the Plan area and on the periphery of the development envelope, this alternative would benefit the protection of various environmental components (e.g. ecology, water, visual sensitivities etc.) beyond the LAP area that could otherwise be threatened. Potential conflicts with all environmental components (detailed under Table 7.3) would still have to be mitigated to ensure that significant adverse residual environmental effects do not occur. This scenario provides for a greenbelt along the River Slaney that would contribute towards the protection of the status of the river including associated biodiversity, however, provisions of the plan to maximise the potential of the River Slaney through the creation of a number of uses could potentially have adverse effects on the biodiversity for which the site is designated for Table 4.3 provides a comparative evaluation of the environmental effects of alternative development strategies against Strategic Environmental Objectives. This is supported by the narrative above and by effects that are common to all alternatives detailed on Table 4.2. CAAS for Carlow County Council 25 Appendix II: Non-Technical Summary Table 4.3 Comparative Evaluation of Alternative Development Strategies Likely to Likely to Least More Probable No Alternative Improve Improve Potential Potential Conflict with significant Development status of SEOs status of SEOs Conflict with Conflict with status of SEOs- interaction Strategy to a greater to a lesser status of SEOs status of SEOs unlikely to be with status of degree degree - likely to be - likely to be mitigated SEOs mitigated to mitigated to greater an degree, intermediate significant degree, adverse significant effects less adverse likely effects more likely Alternative Development ض ض Strategy 1 Alternative Development ض ض Strategy 2 Alternative Development ض ض Strategy 3 4.3.1 The Selected Alternative Development Strategy for the Draft Plan 4.3.2 Overview The Draft Plan has been developed by the Planning Team and placed on public display by the Council having regard to both: 1. The environmental effects which were identified by the SEA and are detailed above; and 2. Planning - including social and economic - effects that also were considered by the Council. Potential adverse effects will be mitigated by various provisions that have been integrated into the Draft Plan (see Section 6). 4.3.3 Selected Alternative Development Strategy The Alternative Development Strategy that was selected and developed for the Draft Plan was Strategy 3 - to consolidate and strengthen the town centre and provide for the limited expansion of Tullow on the outskirts of the town in a phased manner. However, the emerging Draft Plan was amended to include a significant extent of lands zoned for Enterprise and Employment uses in the west and south west of the Plan area. The extent of these lands zoned is significantly in excess of the needs of the town and would lead to unnecessary environmental effects on a variety of environmental components as a result of greenfield development in this edge of town location. Such effects would include a hindrance of efforts to maximise sustainable mobility as well as adverse effects on non-designated biodiversity and visual impacts. The alternative development strategy that has been placed on public display therefore is a mixture between Alternative Strategies 2 and 3. CAAS for Carlow County Council 26 Appendix II: Non-Technical Summary 4.3.4 Land Use Zoning Map including Constrained Land Use Zoning The Land Use Zoning map from the Draft Plan that evolved from and which is consistent with Alternative Development Strategy 3 is shown on Figure 4.4 overleaf. Also shown on this map is the constrained land use zoning objective (Policy HR 10B) for the River Slaney cSAC. This Policy has been integrated into the Plan as there are a number of overlaps between the area that is designated as cSAC and existing land use zoning objectives. Policy HR 10B requires applications for development within the constrained land use zoning objective for the Natura 2000 site (Map 13 – as shown on Figure 4.4 overleaf) to undergo Appropriate Assessment and demonstrate that the proposal will not give rise to any effect on the Natura 2000 site in view of its qualification features and conservation objectives. CAAS for Carlow County Council 27 Appendix II: Non-Technical Summary Figure 4.4 The Draft Plan Land Use Zoning Map CAAS for Carlow County Council 28 Appendix II: Non-Technical Summary Section 5 Evaluation of Plan Provisions 5.1 Overall Findings The overall findings are that: x The Draft Plan includes a significant extent of lands zoned for Enterprise and Employment uses in the west and south west of the Plan area. The extent of these lands zoned is significantly in excess of the needs of the town and would lead to unnecessary environmental effects on a variety of environmental components as a result of greenfield development in this edge of town location. Such effects would include a hindrance of efforts to maximise sustainable mobility as well as adverse effects on non-designated biodiversity and visual impacts. x The Council have integrated all recommendations arising from the SEA, Appropriate Assessment (AA) and Strategic Flood Risk Assessment (SFRA) processes into the Plan, facilitating compliance of the Plan with various European and National legislation and Guidelines relating to the environment and sustainable development. x Plan provisions would be likely to result in significant positive effects upon the protection and management of the environment (including all environmental components; biodiversity, fauna, flora, population, human health, soil, water, air, climatic factors, material assets, cultural heritage including architectural and archaeological heritage, landscape). x Some Plan provisions would have the potential to result in significant negative environmental effects (these will be described in the reports) however these effects will be mitigated by the mitigation measures that have been integrated into the Plan (see Section 6). 5.2 Potential Adverse Effects and their Determination Environmental impacts which occur, if any, will be determined by the nature and extent of multiple or individual projects and site-specific environmental factors. The potentially significant adverse environmental effects arising from implementation of the Plan are detailed on Table 4.2. 5.3 Residual Adverse Effects Residual adverse effects likely to occur - considering the extent of detail provided by the Plan and assuming that all mitigation measures are complied with by development - are identified for each of the environmental components on Table 5.1. CAAS for Carlow County Council 29 Appendix II: Non-Technical Summary Table 5.1 Residual Adverse Effects Environmental Component Residual Adverse Effects Biodiversity and Flora and Fauna Loss of an extent of non-protected habitats arising from the replacement of semi- natural land covers with artificial surfaces Population and Human Health Flood related risks remain due to uncertainty with regard to extreme weather events Soil Loss of an extent of soil function arising from the replacement of semi-natural land covers with artificial surfaces Water Flood related risks remain due to uncertainty with regard to extreme weather events Air and Climatic Factors The Draft Plan includes a significant extent of lands zoned for Enterprise and Employment uses in the west and south west of the Plan area. The extent of these lands zoned is significantly in excess of the needs of the town and would lead to unnecessary environmental effects on a variety of environmental components as a result of greenfield development in this edge of town location. Such effects would include a hindrance of efforts to maximise sustainable mobility. Material Assets Residual wastes to be disposed of Architectural Heritage Potential alteration to the context and setting of architectural heritage (Protected Structures) however these will occur in compliance with legislation Archaeological Heritage Potential alteration to the context and setting of archaeological heritage (Recorded Monuments) however this will occur in compliance with legislation Potential loss of unknown archaeology however this loss will be mitigated by measures integrated into the Plan Landscape Designations The landscapes within and surrounding the town will change overtime as a result of natural changes in vegetation cover combined with new developments. The Plan contributes towards the protection of landscape designations. CAAS for Carlow County Council 30 Appendix II: Non-Technical Summary Section 6 Mitigation and Monitoring Measures 6.1 Mitigation Mitigation measures are measures envisaged to prevent, reduce and, as fully as possible, offset any significant adverse impacts on the environment of implementing the Plan. Various environmental sensitivities and issues have been communicated to the Council through the SEA, AA and SFRA processes. By integrating related recommendations into the Plan, the Council have ensured that both the beneficial environmental effects of implementing the Plan have been and will be maximised and that potential adverse effects have been and will be avoided, reduced or offset. All recommendations made by the SEA, AA and SFRA processes have been integrated into the Draft Plan. Table 6.1 provides a summary table outlining how likely significant effects (if unmitigated) are linked to relevant mitigation measure(s) - which have been integrated into the Plan - and indicator(s) which will be used for monitoring. 6.2 Monitoring The SEA Directive requires that the significant environmental effects of the implementation of plans and programmes are monitored. This section details the measures that will be used in order to monitor the likely significant effects of implementing the Plan. Monitoring can enable, at an early stage, the identification of unforeseen adverse effects and the undertaking of appropriate remedial action. Monitoring is based around indicators that allow quantitative measures of trends and progress over time relating to the Strategic Environmental Objectives (see Section 3.13). Table 6.1 provides a summary table outlining how likely significant effects (if unmitigated) are linked to relevant mitigation measure(s) - which have been integrated into the Plan - and indicator(s) which will be used for monitoring. CAAS for Carlow County Council 31 Appendix II: Non-Technical Summary Table 6.1 SEA Summary Table: Likely Significant Effects, Mitigation Measures and Indicators for Monitoring Likely Significant Effect, if Mitigation Measure Primary Indicator(s) for Monitoring unmitigated Reference(s) Loss of biodiversity with regard to Incorporated into B1: Conservation status of habitats and species as designated biodiversity and flora and Draft Plan through assessed under Article 17 of the Habitats Directive fauna, ecological connectivity and policies HR7 and HR8, B2: Percentage loss of functional connectivity without stepping stones and non-designated HR9, HR10, HR15, HP remediation resulting from development provided for by biodiversity and flora and fauna 21, HR21, HR12, the Plan FLO4, HR10B, TP7, B3i: Number of significant impacts on relevant habitats, LU8, SM4 and RC 2 species, environmental features or other sustaining and Objective SMO3 resources in designated sites including Wildlife Sites resulting from development provided for by the Plan B3ii: Number of significant impacts on the protection of species listed on Schedule 5 of the Wildlife Act 1976 Spatially concentrated deterioration in Objective PO1 and PHH1: Occurrence (any) of a spatially concentrated human health PO2. deterioration in human health arising from environmental factors resulting from development provided for by the Plan, as identified by the Health Service Executive and Environmental Protection Agency Adverse impacts on the Policy P5. S1: Soil extent and hydraulic connectivity hydrogeological and ecological function of the soil resource Adverse impacts upon the status and Policy WSP1 and W1: Classification of Overall Status (comprised of quality of water bodies WSP2. ecological and chemical status) under the European Communities Environmental Objectives (Surface Waters) Regulations 2009 (SI No. 272 of 2009) W2: Groundwater Quality Standards and Threshold Values under Directive 2006/118/EC Increase in flood risk Policies FL1, FL2, FL4 W3: Number of incompatible developments granted and Objectives FLO1, permission on lands which pose - or are likely to pose in FLO2. the future - a significant flood risk The need to provide adequate and Policies WSP3, WW1, M1: Number of new developments granted permission appropriate water services (it is the WSP6, WW2 and which can be adequately and appropriately served with function of Irish Water to provide for Objectives WSO1, waste water treatment over the lifetime of the Plan such needs) WWO1, WSO1, WSO4, M2: Number of non-compliances with the 48 parameters WSO5. identified in the European Communities (Drinking Water) Regulations (No. 2) 2007 which present a potential danger to human health as a result of implementing the Plan Failure to contribute towards Overall development C1: To reduce travel related emissions to air and to sustainable transport and associated approach for the Plan, encourage modal change from car to more sustainable impacts (energy usage and emissions consolidating the town forms of transport to air including noise and greenhouse and providing for gases) growth within and adjacent to the town centre. Also Policy P1, Policy CCP1 and Objective CCO1 Increases in waste levels Policy WMP1, WMP2, M3i: Total collected and brought household waste WMP5. M3ii: Packaging recovered (t) by self-complying packagers Potential effects on protected and Policy HR1, HR2, HR3 CH1: Percentage of entries to the Record of Monuments unknown archaeology and protected and HR5. and Places - and the context these entries within the architecture surrounding landscape where relevant - protected from adverse effects resulting from development which is granted permission under the Plan CH2: Percentage of entries to the Record of Protected Structures and their context protected from adverse effects resulting from development which is granted permission under the Plan Occurrence of adverse visual impacts Policy L1 L1: Number of complaints received from statutory consultees regarding avoidable impacts on the landscape resulting from development which is granted permission under the Plan CAAS for Roscommon County Council 32 NATURA IMPACT REPORT IN SUPPORT OF THE APPROPRIATE ASSESSMENT OF THE DRAFT TULLOW LOCAL AREA PLAN 2016-2022 IN ACCORDANCE WITH THE REQUIREMENTS OF ARTICLE 6(3) OF THE EU HABITATS DIRECTIVE for: Carlow County Council Athy Road Carlow County Carlow by: CAAS Ltd. 2nd Floor, The Courtyard 25 Great Strand Street Dublin 1 JULY 2016 Includes Ordnance Survey Ireland data reproduced under OSi Licence Number 2014/21/CCMA/CarlowCountyCouncil. Unauthorised Reproduction infringes Ordnance Survey Ireland and Government of Ireland Copyright. © Ordnance Survey Ireland Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Table of Contents Section 1 Introduction ...... 1 1.1 Background ...... 1 1.2 Legislative Context ...... 1 1.3 Stages of Appropriate Assessment ...... 2 Section 2 Stage 1 Screening ...... 4 2.1 Tullow Area ...... 4 2.2 Description of the draft Plan ...... 4 2.3 European sites in and within 15 km and those hydrologically linked to the draft Plan Area .. 6 2.4 Assessment Criteria ...... 11 2.5 Other Plans and Programmes ...... 15 2.6 Conclusions ...... 17 Section 3 Stage 2 Appropriate Assessment ...... 18 3.1 Introduction ...... 18 3.2 Potential Significant Effects ...... 18 3.3 Conservation Objectives ...... 20 Section 4 Mitigation Measures ...... 22 4.1 Introduction ...... 22 4.2 Measures to Protect Habitats and Species ...... 22 4.3 Measures to Protect Water Quality ...... 26 4.4 Mitigation by amendments being made to Draft Plan provisions ...... 27 Section 5 Conclusion ...... 28 List of Appendices Appendix I: Summary details of European sites considered during the Appropriate Assessment CAAS for Carlow County Council i Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 List of Tables Table 2.1 European Sites which occur within 15 km of the Plan Area, Relevant Qualifying Features and Site Vulnerability ...... 7 Table 2.2 European Sites which occur beyond 15 km of the Plan Boundary but are Hydrologically Connected to the Plan Area ...... 8 Table 2.3 Elements of the draft Plan and the Potential for Significant Effects on European Sites...... 12 Table 2.4 Screening of European Sites within 15 km of the LAP Boundary ...... 14 Table 2.5 Screening of European Sites which occur outside 15 km of the Draft LAP Boundary but are Hydrologically Linked to the Draft LAP Boundary ...... 15 Table 2.6 Plans & Projects Likely to Cause In-Combination Effects ...... 15 Table 3.1 European Sites Potentially Impacted upon by the Draft Tullow LAP .... 18 Table 3.2: European sites and QIs vulnerable to disturbance to key species from the implementation of the Draft Plan ...... 20 List of Figures Figure 1 European sites within 15 km of the Plan Area...... 9 Figure 2 European sites occurring downstream but beyond 15 km ...... 10 CAAS for Carlow County Council ii Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Section 1 Introduction 1.1 Background This is the Natura Impact Report in support of the Appropriate Assessment of the draft Tullow Local Area Plan (LAP) 2016-2022 in accordance with the requirements of Article 6(3) of the EU Habitats Directive1. This report is divided into the following five sections: Section 1 Introduction Section 2 Stage 1 Screening Section 3 Stage 2 Appropriate Assessment Section 4 Mitigation Measures Section 5 Conclusion 1.2 Legislative Context The Council Directive 92/43/EEC on the Conservation of Natural Habitats and of Wild Fauna and Flora, better known as “The Habitats Directive”, provides legal protection for habitats and species of European importance. Articles 3 to 9 provide the legislative means to protect habitats and species of Community interest through the establishment and conservation of an EU-wide network of sites known as Natura 2000. In Ireland, these are candidate Special Areas of Conservation (cSACs) designated under the Habitats Directive and Special Protection Areas (SPAs) designated under the Conservation of Wild Birds Directive (79/409/ECC), hereafter referred to as European sites. Articles 6(3) and 6(4) of the Habitats Directive set out the decision-making tests for plans and projects likely to affect Natura 2000 sites. Article 6(3) establishes the requirement for AA: “Any plan or project not directly connected with or necessary to the management of the [Natura 2000] site but likely to have a significant effect thereon, either individually or in combination with other plans or projects, shall be subjected to appropriate assessment of its implications for the site in view of the site’s conservation objectives. In light of the conclusions of the assessment of the implications for the site and subject to the provisions of paragraph 4, the competent national authorities shall agree to the plan or project only after having ascertained that it will not adversely affect the integrity of the site concerned and, if appropriate, after having obtained the opinion of the general public. If, in spite of a negative assessment of the implications for the [Natura 2000] site and in the absence of alternative solutions, a plan or project must nevertheless be carried out for imperative reasons of overriding public interest, including those of a social or economic nature, Member States shall take all compensatory measures necessary to ensure that the overall coherence of Natura 2000 is protected. It shall inform the Commission of the compensatory measures adopted. 1 Directive 92/43/EEC CAAS for Carlow County Council 1 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Where the site concerned hosts a priority natural habitat type and/or a priority species the only considerations which may be raised are those relating to human health or public safety, to beneficial consequences of primary importance for the environment or, further to an opinion from the Commission, to other imperative reasons of overriding public interest.” These requirements are implemented in the Republic of Ireland by the European Communities (Birds and Natural Habitats) Regulations 2011. These regulations consolidate the European Communities (Natural Habitats) Regulations 1997 to 2005 and the European Communities (Birds and Natural Habitats) (Control of Recreational Activities) Regulations 2010, as well as addressing transposition failures identified in judgements of the Court of Justice of the European Union (CJEU). 1.3 Stages of Appropriate Assessment This Natura Impact Report has been prepared in accordance with the following guidance: x Appropriate Assessment of Plans and Projects in Ireland. Guidance for Planning Authorities. Department of the Environment, Heritage and Local Government, 2010. x Assessment of plans and projects significantly affecting Natura 2000 sites: Methodological guidance on the provisions of Article 6(3) and (4) of the Habitats Directive 92/43/EEC, European Commission Environment DG, 2002. x Managing Natura 2000 sites: The Provisions of Article 6 of the Habitats Directive 92/43/EEC: European Commission, 2000. AA comprises up to four successive stages: Stage One: Screening The process which identifies the likely impacts upon a European site of a project or plan, either alone or in combination with other projects or plans, and considers whether these impacts are likely to be significant. Stage Two: Appropriate Assessment The consideration of the impact on the integrity of the European site of the project or plan, either alone or in combination with other projects or plans, with respect to the site’s structure and function and its conservation objectives. Additionally, where there are adverse impacts, an assessment of the potential mitigation of those impacts. If adequate mitigation is proposed to ensure no significant adverse impacts on European sites, then the process may end at this stage. However, if the likelihood of significant impacts remains, then the process must proceed to Stage 3. Stage Three: Assessment of Alternative Solutions The process that examines alternative ways of achieving the objectives of the project or plan that avoids adverse impacts on the integrity of the European site. Stage Four: Assessment where no alternative solutions exist and where adverse impacts remain An assessment of compensatory measures where, in the light of an assessment of imperative reasons of overriding public interest (IROPI), it is deemed that the project or plan should proceed. The Habitats Directive promotes a hierarchy of avoidance, mitigation and compensatory measures. First, the plan should aim to avoid any impacts on European sites by identifying possible impacts early in the plan-making process and writing the plan in order to avoid such impacts. Second, mitigation measures should be applied, if necessary, during the AA process to the point where no adverse impacts on the site(s) remain. If the plan is still likely to result in impacts on European sites, and no further practicable mitigation is possible, then it must be CAAS for Carlow County Council 2 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 rejected. If no alternative solutions are identified and the plan is required for imperative reasons of overriding public interest (IROPI test) under Article 6(4) of the Habitats Directive, then compensation measures are required for any remaining adverse effect. In the case of this Natura Impact Report, it was found that the Plan required assessment to Stage 2 AA. CAAS for Carlow County Council 3 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Section 2 Stage 1 Screening 2.1 Tullow Area Tullow is an important urban centre located on the River Slaney in the north east of the County in the midst of a rich, fertile agricultural hinterland. The town provides a range of residential, community, commercial and employment functions. Tullow is located approximately 16km to the south east of Carlow town via the R725. Tullow is approximately 18km to the south of Baltinglass via the N81 and is approximately 78km to the south west of Dublin along the R418. The M9 is located approximately 8km to the west of Tullow and is accessed via the N81 and N80. Tullow is also served by the R725 regional road linking Gorey to Carlow. The town is sited to the east and west of the River Slaney. 2.2 Description of the draft Plan The main aim of the LAP is to set out a framework for the physical development of the Tullow area so that growth may take place in a coordinated, sensitive and orderly manner, while at the same time being sensitive to the environment. Policies and objectives outlined in the draft LAP are in addition to the policies and objectives contained in the Carlow County Development Plan 2015-2021. It is acknowledged that not all strategic objectives will be achieved during the six-year LAP timeframe; however it is important to identify these objectives to ensure commitment to achieving them in the longer term. 2.2.1 Draft Plan Vision Carlow County Council’s Vision for the town is as follows: To provide a focused approach to planning for the future growth of Tullow in a coherent and spatial fashion which seeks to deliver high levels of employment and balances future sustainable development with the conservation and enhancement of the town’s natural and built environment. 2.2.2 Strategic Objectives for the Draft LAP The Strategic Objectives of the draft Tullow LAP are as follows: 1. To create vibrant integrated communities in a more consolidated urban form. 2. To create a thriving town which contributes to the natural and built heritage amenities of the town and provides a vibrant and vital mixed-use environment. 3. To facilitate the creation of a sustainable vibrant economy which maximises the unique attributes of the town. 2.2.3 Relationship with other Relevant Plans and Programmes The draft Tullow LAP sits within a hierarchy of land use forward planning strategic actions. The draft Plan must comply with relevant higher-level strategic actions and may, in turn, guide lower level strategic actions. The draft Plan also forms part of the Carlow County Development Plan along with other Local Area Plans in the County. CAAS for Carlow County Council 4 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 The National Spatial Strategy 2002-2020 The National Spatial Strategy (NSS) is the national planning framework for Ireland to achieve a better balance of social, economic and physical development as well as balanced population growth between the regions. The aim of the Strategy is to utilise urban land sensitively and efficiently, reduce dereliction and encourage refurbishment. Regional Planning Guidelines (South East Region 2010-2022) Ireland was divided into eight regional forward planning regions, Dublin, Midlands, Mid East, Mid-West, South East, South West, West and Border, each with its own regional planning authority composed of Elected Members selected by the constituent local government councils. Regional planning authorities were required, under the Planning and Development (Regional Planning Guidelines) Regulations 2003 (SI No. 175 of 2003), to draw up Regional Planning Guidelines (RPGs), long term strategic planning frameworks, for their relevant region. Since 2015, three new regional assemblies (the Northern and Western, Southern and Eastern and Midland Regional Assemblies) undertake the work previously undertaken by the Regional Authorities, including the implementation of the Regional Planning Guidelines. Carlow County Council was part of the South East Region Authority and is now part of the Southern and Eastern Regional Assembly. County Carlow, including Tullow, is subject to the Regional Planning Guidelines for the South East 2010- 2022 that provide a framework for the long-term strategic development of the South Eastern Region. The Guidelines do this through setting out goals, policies and objectives in relation to population targets, housing, infrastructure, economic development, environment, amenities, social infrastructure and community development, ensuring the successful implementation of the NSS at regional, county and local level. The RPGs have allocated a population target of 63,536 for County Carlow by 2022. This represents a population increase of 4,085 from the 2016 population target of 59,451. Applying an average allocation per annum, this amounts to a population of 680 per annum between 2016-2022. The allocation for Tullow to 2022 is therefore calculated as 4.3 % of the population target (29 pop / average household size (2.7) = 11 units with 75% over zoning = 19 additional units). Adding this to the 2021 housing target (112) gives a revised target of 131 housing units for Tullow for the period 2016-2022. Carlow County Development Plan 2015-2021 The Carlow County Development Plan provides the overall statutory framework for the beneficiary of the town’s influence. Currently Tullow is a district town and is identified as containing well-developed services and community facilities and have the capacity to accommodate additional growth (subject to certain physical infrastructural investments). The Core Strategy and the County Development Plan will reinforce developments in the Tullow area. County Carlow Wind Energy Strategy Carlow County Council recognises the importance of renewable energy. County Carlow has the potential to harness an extensive amount of renewable energy resources, primarily from wind. A Wind Energy Strategy was prepared by Carlow County Council, which explores the potential of wind energy in County Carlow. County Carlow Retail Strategy A Retail Strategy for County Carlow was undertaken as part of the preparation of Carlow County Development Plan 2015-2021. The Retail Planning Guidelines for Planning Authorities, issued by the Department of the Environment, Community and Local Government in April 2012, require Local Authorities to prepare a retail strategy and provide policies for retail development in development plans. Carlow County Council recognises that the retail sector has a key role to play in relation to economic and social activity, employment and the continued vitality of the towns and villages throughout the county. CAAS for Carlow County Council 5 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 County Carlow Housing Strategy A Housing Strategy was prepared for County Carlow as part of the preparation of the Carlow County Development Plan 2015 – 2021. This Strategy is also applicable to the draft Tullow LAP. It sets out a framework for the supply of land to meet the housing needs arising in the county. It outlines what the anticipated social and affordable housing need for County Carlow between 2015 and 2021. Smarter Travel 2009 “Smarter Travel, A Sustainable Transport Future, A New Transport Policy for Ireland 2009 - 2020” is the Government’s action plan to free towns and cities from traffic congestion, substantially cut CO2 emissions, encourage car based commuters to leave their cars at home, and encourage a shift toward walking, cycling and greater public transport usage. 2.2.1 Environmental Protection Objectives The draft Tullow LAP is subject to a number of high-level environmental protection policies and objectives with which it must comply. Examples of Environmental Protection Objectives include the aims of the EU Habitats Directive which is to contribute towards ensuring biodiversity through the conservation of natural habitats and of wild fauna and flora in the European territory of Member States and the purpose of the Water Framework Directive which is to establish a framework for the protection of inland surface waters, transitional waters, coastal waters and groundwater which, among other things, prevents deterioration in the status of all water bodies and protects, enhances and restores all waters with the aim of achieving good status. 2.3 European sites in and within 15 km and those hydrologically linked to the draft Plan Area This section of the screening process describes the European sites within a 15 km potential zone of impact of the Plan Area. The distance of 15 km is currently recommended in the DoE document Appropriate Assessment of Plans and Projects - Guidance for Planning Authorities, however, sites beyond this distance should also be considered where there are hydrological linkages or other pathways that extend beyond 15 km thereby ensuring that all potentially affected European sites are included in the screening process. Those European sites that occur within 15km of the Plan Area are listed in Table 2.1 and illustrated in Figure 1 below while those sites which occur beyond 15km but are located downstream of the Plan Area are listed in Table 2.2 and illustrated in Figure 2 below. Based on the above approach, a total of five European sites, comprising five SACs, require consideration in the AA process. No SPAs require consideration. In order to determine the potential for impacts from the draft Plan, information on the qualifying features, known vulnerabilities and threats to site integrity pertaining to any potentially affected European sites was reviewed and is presented in Appendix I. This information was derived from a number of sources including the following: x Ireland’s Article 17 Report to the European Commission “Status of EU Protected Habitats and Species in Ireland” (NPWS, 2013). x Site Synopses. x NATURA 2000 Standard Data Forms. cSAC sites are selected for a range of different habitats and species listed on Annex I and Annex II of the habitats directive, known as Qualifying Interests (QIs). In summary, those QIs for which cSAC sites are selected are presented in Table 2.1 and Table 2.2. CAAS for Carlow County Council 6 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Since the conservation objectives for the European sites focus on maintaining the favourable conservation condition of the qualifying interests of each site, the screening process concentrated on assessing the potential implications of the Tullow LAP against the qualifying interests of each site. Table 2.1 European Sites which occur within 15 km of the Plan Area, Relevant Qualifying Features and Site Vulnerability Site Site Name Qualifying Features Location and Site Vulnerability Code 770 Blackstairs Wet Heath; This SAC occurs ca 14 km south of Tullow. Grazing is Mountains Dry Heath considered to be one of the main threats to the site. cSAC Lower slopes of the site which contains upland grassland has been heavily grazed. Although sheep numbers are low overall, there are pockets where high numbers are found, which has resulted in patches of bare ground. The site is also vulnerable to the burning of Heather, which appears to carried out on a rotational basis. Bogland present in the area is reduced to fragments bordering improved grassland and forestry. 781 Slaney River Estuaries; This SAC runs through the area of Tullow and continues Valley cSAC Tidal Mudflats and Sandflats; downstream as far as Wexford Harbour. Agriculture is the Floating River Vegetation; main land use. Arable crops are important. Improved Old Oak Woodlands; grassland and silage account for much of the remainder. Alluvial Forests*; The spreading of slurry and fertiliser poses a threat to the Freshwater Pearl Mussel (Margaritifera water quality of this salmonid river and to the populations margaritifera); of E.U. Habitats Directive Annex II animal species within Sea Lamprey (Petromyzon marinus); it. Run-off is undoubtedly occurring, as some of the fields Brook Lamprey (Lampetra planeri); slope steeply directly to the river bank. In addition, cattle River Lamprey (Lampetra fluviatilis); have access to the river bank in places. Fishing is a main Twaite Shad (Alosa fallax); tourist attraction along stretches of the Slaney and its Atlantic Salmon (Salmo salar); tributaries, and there are a number of Angler Otter (Lutra lutra); Associations, some with a number of boats. Fishing stands Common (Harbour) Seal (Phoca vitulina) and styles have been erected in places. Both commercial and leisure fishing takes place. There are some gravel pits along the river below Bunclody and many of these are active. There is a large landfill site adjacent to the river close to Hacketstown and at Killurin. Boating, bait-digging and fishing occur in parts of Wexford Harbour. Waste water outflows, runoff from intensive agricultural enterprises, a meat factory at Clohamon, a landfill site adjacent to the river, and further industrial development upstream in Enniscorthy and in other towns could all have potential adverse impacts on the water quality unless they are carefully managed. The spread of exotic species is also reducing the quality of the woodlands. 1757 Holdenstown Transition Mires This SAC occurs ca. 11 Km north of Tullow. The site is a Bog cSAC small wetland in a kettle hole and is mostly dominated by raised bog but there is some open water. Birch woodland is invading the drier areas of the bog. The area surrounding site is agricultural land. Many of the main threats posed to the site arise from agricultural uses. Threats to the site include grazing, vulnerability to fertilisation and cultivation. Infilling of sites features, such as ditches, ponds and marshes, is also considered to be a highly significant threat. CAAS for Carlow County Council 7 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Site Site Name Qualifying Features Location and Site Vulnerability Code 2162 River Barrow Estuaries; This SAC occurs ca. 12 Km west of Tullow. The main and River Tidal Mudflats and Sandflats; threats to the site and current damaging activities include Nore cSAC Salicornia Mud; high inputs of nutrients into the river system from Atlantic Salt Meadows; agricultural run-off and several sewage plants, over- Mediterranean Salt Meadows; grazing within the woodland areas, and invasion by non- Floating River Vegetation; native species, for example Cherry Laurel (Prunus Dry Heath; laurocerasus) and Rhododendron (Rhododendron Hydrophilous Tall Herb Communities; ponticum). The water quality of the site remains Petrifying Springs*; vulnerable. Good quality water is necessary to maintain Old Oak Woodlands; the populations of the Annex II animal species listed Alluvial Forests* above. Good quality is dependent on controlling Desmoulin's Whorl Snail (Vertigo fertilisation of the grasslands, particularly along the Nore. moulinsiana); It also requires that sewage be properly treated before Freshwater Pearl Mussel (Margaritifera discharge. Drainage activities in the catchment can lead margaritifera); to flash floods which can damage the many Annex II White-clawed Crayfish species present. Capital and maintenance dredging within (Austropotamobius pallipes); the lower reaches of the system pose a threat to Sea Lamprey (Petromyzon marinus); migrating fish species such as lamprey and had. Land Brook Lamprey (Lampetra planeri); reclamation also poses a threat to the salt meadows and River Lamprey (Lampetra fluviatilis); the populations of legally protected species therein. Twaite Shad (Alosa fallax); Atlantic Salmon (Salmo salar); Otter (Lutra lutra); Killarney Fern (Trichomanes speciosum); Nore Freshwater Pearl Mussel (Margaritifera durrovensis) Table 2.2 European Sites which occur beyond 15 km of the Plan Boundary but are Hydrologically Connected to the Plan Area Site Site Name County Qualifying Features Location and Site Vulnerability Code 710 Raven Point Wexford Mudflats and sandflats The cSAC occurs >15km downstream of the Nature Reserve not covered by seawater LAP boundary. Curracloe is a popular summer SAC at low tide; resort and parts of the Raven receive high Annual vegetation of drift recreational pressure. In particular, pony lines; trekking has caused erosion of the embryonic Atlantic salt meadows dunes in some places. It is planned to (GlaucoǦPuccinellietalia gradually remove all the conifers from the maritimae); sand dune system. Some selected areas will Embryonic shifting dunes; be clearfelled, others will be left as scrub Shifting dunes along the pine. After harvesting the conifers, certain shoreline with Ammophila areas behind the dunes will be planted with arenaria ('white dunes'); hardwoods, including Alder (Alnus glutinosa) *Fixed coastal dunes with and Sessile Oak (Quercus petraea). Other herbaceous vegetation areas, in particular the more low-lying areas ('grey dunes'); of former dune slack, will be left to Dunes with Salix repens regenerate naturally. ssp. argentea (Salicion arenariae); Humid dune slacks CAAS for Carlow County Council 8 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Figure 1 European sites within 15 km of the Plan Area CAAS for Carlow County Council 9 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Figure 2 European sites occurring downstream but beyond 15 km CAAS for Carlow County Council 10 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 2.4 Assessment Criteria 2.4.1 Is the Plan Necessary to the Management of European Sites? Under the Habitats Directive, Plans that are directly connected with or necessary to the management of a European site do not require AA. For this exception to apply, management is required to be interpreted narrowly as nature conservation management in the sense of Article 6(1) of the Habitats Directive. This refers to specific measures to address the ecological requirements of annexed habitats and species (and their habitats) present on a site(s). The relationship should be shown to be direct and not a by-product of the plan, even if this might result in positive or beneficial effects for a site(s). The primary purpose of the Tullow LAP is not the nature conservation management of European sites but to provide for development within the Tullow area. Therefore, the draft LAP is not considered by the Habitats Directive to be directly connected with or necessary to the management of European designated sites. 2.4.2 Elements of the Draft Plan with Potential to Give Rise to Significant Effects This screening assessment process identifies whether the changes brought about by the draft LAP are likely to cause any direct, indirect or secondary impacts (either alone or in combination with other plans or projects) on the Natura 2000 network of sites. During this assessment a number of factors were taken into account including the sites’ conservation objectives and known threats. The overall aim of the assessment is to attempt to predict the consequences that can be reasonably foreseen by implementation of a policy or objective. It should be noted that the policies and objectives that make up the draft Plan are strategic in nature and therefore the impact assessment can at best be generalised. No projects giving rise to significant adverse direct, indirect, or secondary impacts on the integrity of any Natura 2000 sites having regard to their conservation objectives, arising from their size or scale, shall be permitted on the basis of the draft Plan (either individually or in combination with other plans or projects). The following provisions could, in the absence of mitigation, potentially give rise to significant effects: x Tourism related development; x The development of cultural facilities in the town; x Improvements to pedestrian access and connectivity throughout the Plan Area, particularly towards community, commercial and recreational lands and facilities; x Recreational and tourism related development including proposed development of recreational and tourism infrastructure and facilities in the area, including the expansion and linkages of existing and new walkways and cycle ways within the town and its surroundings, and wider extent of the county and the development of the recreational potential of the River Slaney; x The upgrading of roads and transport links; x New industrial and local enterprise development; x Wastewater disposal, water supply and surface water disposal developments and upgrades; x The upgrading, maintenance and expansion of waste management facilities in the area; x The development of renewable energy sources; x The extension of telecommunications infrastructure; and x Land use zoning objectives and associated provisions including those relating to: Utilities, Enterprise and Employment, Existing Residential/Infill, Industry & Warehousing Existing Residential / Infill, Town Centre Activities and Amenity and Open Space. CAAS for Carlow County Council 11 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 2.4.3 Identification of Potential Likely Significant Effects This section documents the final stage of the screening process. It has used the information collected on the sensitivity of each European site and describes any likely significant effects resulting from the implementation of the draft LAP. This assumes the absence of any controls, conditions, or mitigation measures. In determining the potential for significant effects, a number of factors have been taken into account. Firstly, the sensitivity and reported threats to the European site. Secondly, the individual elements of the draft Plan and the potential effect they may cause on the site were considered. The elements of the draft Plan with potential to cause adverse impacts on European sites is presented in Table 2.3 below. Sites are screened out based on one or a combination of the following criteria: x where it can be shown that there are no hydrological links between activities in Tullow and the site to be screened; x where the site is located at such a distance from Tullow that impacts are not foreseen; x where it is that known threats or vulnerabilities at a site cannot be linked to potential impacts that may arise from implementation of the draft Plan. The screening of individual European sites within 15km of Tullow is presented in Table 2.4 below (sites sorted by distance from the draft LAP boundary) and screening of those European site which occur outside 15 km of the LAP boundary are presented in Table 2.5. Table 2.3 Elements of the draft Plan and the Potential for Significant Effects on European Sites Element of the draft Plan Potential significant effects Provisions relating to tourism and cultural heritage The provision for the expansion of tourism and associated development including: infrastructure may potentially lead to the run-off of silt and other harmful pollutants to watercourse in the town and its Policies in relation to Tourism environs. This may lead to adverse impacts on those water EC 13 dependant European sites which occur downstream of the town. LU 6 TP 6 Development along the rivers may also potentially lead to Objectives in relation to Tourism disturbance to those habitats and species for which SAC’s in the TO 1 area are designated. TO 4 Policies in relation to Cultural facilities This provision may potentially lead to: HR 6 x Changes in indicators of conservation value (water quality) x Disturbance of key species and habitats Provisions relating to improvements to pedestrian access Works to the pedestrian network in the town may potentially and connectivity throughout the Plan Area, particularly lead to the run-off of silt and other harmful pollutants to towards community, commercial and recreational lands and watercourse within the town. This may potentially lead to facilities, including: adverse impacts on water dependant European sites downstream of the draft Plan. Policies in relation to Land Uses LUO 1 Development along the rivers may also potentially lead to Policies in relation to Public Space and Public Realm disturbance to those habitats and species for which SACs in the PR 2 area are designated. Policies in relation to Transport TP 2 This provision may potentially lead to: x Changes in key indicators of conservation value (water quality) x Disturbance of key species and habitats Proposed development and maintenance of new and The provision to develop recreational facilities and areas in the existing recreational and tourism infrastructure and town may potentially lead to the run-off of silt and other harmful facilities in the area, including the expansion and linkages pollutants to the watercourse within the town. This may lead to of existing and new walkways and cycle ways within the adverse impacts on those waters. town and its surroundings, and wider extent of the county CAAS for Carlow County Council 12 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Element of the draft Plan Potential significant effects Policies in relation to Land Uses Recreational area works may also potentially lead to the LU 82 disturbance to those habitats and species for which SACs in the Policies in relation to Streets and Movement area are designated. SM 3 SM 43 This provision may potentially lead to: Policies in relation to Sports, Recreation and Play x Changes in indicators of conservation value (water quality) SP 1 x Disturbance to key species and habitats SP 2 Policies in relation to Recreational Potential of the River Slaney RC 1 RC 24 RC 3 Policies in relation to Green Infrastructure HR 17 Built and Natural Heritage Objectives HO 6 The upgrading of roads and transport links Roads and transport upgrade works in the area may potentially lead to the run-off of silt and other harmful pollutants into the Objectives in relation to Public Spaces and Public Realm watercourse in the town, potentially leading to adverse impacts PRO 1 on those water dependant European sites which occur Objectives in relation to Transport Infrastructure downstream of the town. TO 4 TO 3 Roads and transport upgrade works may also potentially lead to TO 5 the disturbance of habitats and species for which SACs in the area are designated. This provision may potentially lead to: x Changes in indicators of conservation value (water quality x Disturbance to key species and habitats New industrial development and Local Enterprise The provision for industrial developments may potentially lead to the run-off of silt and other harmful pollutants to watercourse Economic Policies for Tullow in the town and its environs. This may lead to adverse impacts EC 2 on those water dependant European sites which occur Economic Objectives for Tullow downstream of the town. ECO 1 Development along the rivers may also potentially lead to disturbance to those habitats and species for which SACs in the area are designated. This provision may potentially lead to: x Changes in indicators of conservation value (water quality) x Disturbance of key species and habitats Wastewater disposal, water supply and surface water Works to the water supply and wastewater treatment facilities disposal developments and upgrades within the town may potentially lead to the run-off of silt and other harmful pollutants to watercourses within the town. This Policies in relation to Water Supply and Quality may potentially lead to adverse impacts on water dependant WSP 3 European sites which occur downstream of the town. Objectives relating to Water Supply and Quality WSO 2 Development along the rivers may also potentially lead to WSO 7 disturbance to those habitats and species for which SACs in the WSO 9 area are designated. Policies in relation to Waste Water This provision may potentially lead to: WW 5 x Changes in indicators of conservation value (water quality) Objectives in relation to Waste Water x Disturbance of key species and habitats WWO 1 WWO 2 2 Note: Objective LU 8 has been subject to change, resulting from the mitigation process, in order to comply with environmental considerations. 3 Note: Objective SM 4 has been subject to change, resulting from the mitigation process, in order to comply with environmental considerations. 4 Note: Objective RC 2 has been subject to change, resulting from the mitigation process, in order to comply with environmental considerations. CAAS for Carlow County Council 13 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Element of the draft Plan Potential significant effects The upgrading, maintenance and expansion of waste Works to waste management facilities within the town may management facilities in the area potentially lead to the run-off of silt and other harmful pollutants to watercourses within the town. This may potentially lead to Policies in relation to Waste Management adverse impacts on water dependant European sites which WMP 3 occur downstream of the town. This provision may potentially lead to: x Changes in indicators of conservation value (water quality) The development of renewable energy sources Renewable energy development in the town may potentially lead to the run-off of silt and other harmful pollutants into the Economic policies for Tullow watercourse in the town, potentially leading to adverse impacts EC 6 on those water dependant European sites which occur Policies in relation to Energy and Communications downstream of the town. ECP 1 Objectives in relation to Energy and Communications Renewable energy works may also potentially lead to the ECO 4 disturbance of habitats and species for which SACs in the area are designated. This provision may potentially lead to: x Changes in indicators of conservation value (water quality x Disturbance to key species and habitats The extension of energy and communications infrastructure The development of telecommunications infrastructure in the environs of the town may potentially lead to the run-off of silt Policies in relation to Energy and Communications and other harmful pollutants to the watercourse within the ECP 1 town. This may lead to adverse impacts on those water Objectives in relation to Energy and Communications dependant European sites downstream of the town. ECO 1 ECO 2 Telecommunication works may also potentially lead to the ECO 6 disturbance of habitats and species for which SACs in the area are designated. This provision may potentially lead to: x Changes in indicators of conservation value (water quality) x Disturbance to key species and habitats Land use zoning objectives and associated provisions New development throughout the draft Plan Area may including those relating to: including those relating to potentially lead to the potential run-off of silt and / or other Utilities, Enterprise and Employment, Existing harmful pollutants to watercourse within the draft Plan Area. Residential/Infill, Industry & Warehousing Existing The provisions for development may potentially lead to adverse Residential / Infill, Town Centre Activities and Amenity impacts on those European sites which occur downstream of and Open Space the draft Plan Area. This provision may potentially lead to: x Changes in indicators of conservation value (water quality) In addition, there are a number of overlaps between the area which is designated as cSAC and existing land use zoning objectives. If unmitigated, such overlaps could result in the full range of effects including: x Loss / Reduction of Habitat Area x Disturbance to Key Species x Habitat / Species Fragmentation x Reduction in Species Density x Changes in Key Indicators of Conservation Value Table 2.4 Screening of European Sites within 15 km of the LAP Boundary Site Name Potential for likely significant effects Stage 2 Appropriate Assessment required Blackstairs Mountains cSAC Blackstairs Mountains cSAC occurs ca 14 km south of the draft No LAP boundary. Blackstairs Mountain SAC is designated for its Wet Heath and Dry Heath. Given that the site is not directly hydrologically connected to Tullow and the QIs of the cSAC, adverse impacts are not foreseen. CAAS for Carlow County Council 14 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 River Slaney cSAC This River Slaney SAC runs through the area of Tullow and Yes continues downstream as far as Wexford Harbour. The River Slaney SAC is directly hydrologically linked to Tullow and is designated for a wide variety of habitats and species due to the extent of the site. Given that the LAP is directly linked to the SAC it is deemed that these habitats and species may come under influence from the directions outlined in the LAP.Taking a precautionary approach Stage 2 AA is required to be undertaken in order to ensure potential effects are addressed. Holdenstown Bog cSAC This SAC occurs ca. 11 Km north of Tullow. The site is No designated for Transition Mires. Given that the site is not hydrolically linked to the plan area and the distance from the town, adverse impacts are not foreseen. River Barrow and River Nore cSAC The River Barrow and River Nore SAC This SAC occurs ca. 12 No Km west of the plan area. The River Barrow and River Nore SAC is designated for a wide variety of habitats and species due to the extent of the site. Given that the site is not hydrolically linked to the plan area and the distance from the town, adverse impacts are not foreseen. Table 2.5 Screening of European Sites which occur outside 15 km of the Draft LAP Boundary but are Hydrologically Linked to the Draft LAP Boundary Site Name Potential for likely significant effects Stage 2 Appropriate Assessment required Raven Point Nature Reserve SAC Although Raven Point is located a distance downstream of the LAP Yes boundary, impacts via hydrological links between the Plan aera and the site cannot be ruled out at this stage and taking a precautionary approach Stage 2 AA is required to be undertaken in order to ensure potential effects are addressed. 2.5 Other Plans and Programmes Article 6(3) of the Habitats Directive requires an assessment of a plan or project to consider other plans or programmes that might, in combinations with the plan or project, have the potential to adversely impact upon European sites. Table 2.6 outlines plans or projects that may interact with the draft LAP to cause in-combination effects to European sites. The plans or projects are listed according to a spatial hierarchy of International, National, Regional/Local Projects and Plans. Given the uncertainties that exist with regard to the scale and location of developments facilitated by the Draft Plan, it is recognised that the identification of cumulative impacts is limited and that the assessment of in-combination effects will need to be undertaken in a more comprehensive manner at the project-level. Table 2.6 Plans & Projects Likely to Cause In-Combination Effects Directive Purpose Interactions resulting in Cumulative Impacts International EU Water Framework Objectives seek to maintain and No risk of likely significant in-combination effects will Directive (2000/60/EC) enhance the quality of all surface result as the primary purpose of the Directive is to waters in the EU. improve environmental quality. EU Freshwater Fish Directive Objectives seek to protect those fresh No risk of likely significant in-combination effects will (78/659/EEC) water bodies identified by Member result as the primary purpose of the Directive is to States as waters suitable for improve environmental quality. sustaining fish populations. For those waters it sets physical and chemical water quality objectives for salmonid waters and cyprinid waters. EU Groundwater Directive This directive establishes a regime, No risk of likely significant in-combination effects will (2006/118/EC) which sets underground water quality result as the primary purpose of the Directive is to standards and introduces measures improve environmental quality. to prevent or limit inputs of pollutants into groundwater. CAAS for Carlow County Council 15 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Directive Purpose Interactions resulting in Cumulative Impacts EU Floods Directive The Floods Directive applies to river Potential in-combination impacts may arise where (2007/60/EC) basins and coastal areas at risk of there is a requirement to provide for new flooding. With trends such as climate infrastructure such as flood walls or flood defences. change and increased domestic and Avoidance on, or near protected areas should be economic development in flood risk implemented or where this is not possible, favouring zones, this poses a threat of flooding infrastructure that carries a lower risk of damage to in coastal and river basin areas. protected areas should be emphasised in the plan. Nitrates Directive This Directive has the objective of No risk of likely significant in-combination effects will (91/676/EEC) reducing water pollution caused or result as the primary purpose of the Directive is to induced by nitrates from agricultural improve environmental quality. sources and preventing further pollution. The Urban Wastewater The primary objective is to protect No risk of likely significant in-combination effects will Treatment Directive the environment from the adverse result as the primary purpose of the Directive is to (91/271/EEC) effects of discharges of urban improve environmental quality. wastewater, by the provision of urban wastewater collecting systems (sewerage) and treatment plants for urban centres. The Directive also provides general rules for the sustainable disposal of sludge arising from wastewater treatment. Sewage Sludge Directive Objective is to encourage the No risk of likely significant in-combination effects will (86/278/EEC) appropriate use of sewage sludge in result as the primary purpose of the Directive is to agriculture and to regulate its use in improve environmental quality. such a way as to prevent harmful effects on soil, vegetation, animals and man. To this end, it prohibits the use of untreated sludge on agricultural land unless it is injected or incorporated into the soil. The Integrated Pollution Objective is to achieve a high level of No risk of likely significant in-combination effects will Prevention Control Directive protection of the environment result as the primary purpose of the Directive is to (96/61/EC) through measures to prevent or, improve environmental quality. where that is not practicable, to reduce emissions to air, water and land from industrial sources. National National Spatial Strategy Objectives of the NSS are to achieve Potential in-combination impacts may arise where 2002-2020 a better balance of social, economic there is a requirement to provide for new and physical development across infrastructure. Ireland, supported by more effective Provision of infrastructure may result in: planning. x Habitat loss x Alteration of hydrology x Deterioration in water quality x Disturbance during construction / operation. EirGrid Transmission This ten year plan presents those Potential in-combination impacts may arise where Development Plan 2012 - components of the overall long-term there is a requirement to provide for new 2022 development of the transmission infrastructure. system where there is a high level of Provision of infrastructure may result in: certainty. In addition, other likely x Habitat loss areas where development projects x Alteration of hydrology may soon be required are also x Deterioration in water quality discussed. x Disturbance during construction / operation Ireland’s First National Cycle x Outlines objectives and actions Potential for in-combination impacts may arise policy Framework (2009) aimed at developing a strong where there is a requirement to provide for new cycle network in Ireland transport infrastructure, or increase capacity of x Sets out 19 specific objectives, existing infrastructure/services. Provisions for the and details the 109 actions, development of transport infrastructure may aimed at ensuring that a potentially result in: cycling culture is developed x Habitat loss x Alteration of hydrology x Deterioration in water quality x Disturbance during construction / operation Energy Policy framework This policy states that the Potential in-combination impacts may arise where 2007-2020, Governments Government is committed to new wind energy infrastructure is being provided. White Paper delivering a significant growth in Provision of infrastructure may result in: renewable energy as a contribution x Habitat loss to fuel diversity in power generation x Alteration of hydrology x Deterioration in water quality CAAS for Carlow County Council 16 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Directive Purpose Interactions resulting in Cumulative Impacts with a 2020 target of 33% electricity x Disturbance during construction / operation consumption Irish Water’s Water Services This Water Services Strategic Plan Potential in-combination impacts may arise where Strategic Plan 2015 and sets out strategic objectives for the there is a requirement to provide for new water and associated Proposed Capital delivery of water services over the waste water infrastructure and capacity. Meeting Investment Plan 2014-2016 next 25 years up to 2040. It details additional potable water demands and waste water current and future challenges which treatment demands arising from the proposed affect the provision of water services increase in population has the potential to adversely and identifies the priorities to be affect, in the case of abstractions from and effluent tackled in the short and medium discharges to surface waters, the ecological status of term. surface waters and, in the case of groundwater abstractions, the quantitative status of groundwaters. Such demands would occur in-combination with those in adjoining counties. Adverse effects on the ecological status of surface waters and on the quantitative status of groundwaters would have the potential to impact upon protected species and habitats. Provision of infrastructure and increases in capacity may result in: x Habitat loss x Alteration of hydrology x Deterioration in water quality x Disturbance during construction / operation Regional Regional Planning Guidelines Policy document which aims to direct Potential in-combination impacts may arise where For the South Eastern Region the future growth of the South there is a requirement to provide for new 2010 – 2022. Eastern Area over the medium to infrastructure. long term and works to implement Provision of infrastructure may result in: the strategic planning framework set x Habitat loss out in the National Spatial Strategy x Alteration of hydrology (NSS) x Deterioration in water quality x Disturbance during construction / operation Transport Strategy for the The Strategy outlines transport Potential for in-combination impacts may arise Greater Dublin Area 2016- development objectives for the where there is a requirement to provide for new 2035 Greater Dublin Area over a twenty transport infrastructure, or increase capacity of year period. existing infrastructure/services. Provisions for the development of transport infrastructure may potentially result in: x Habitat loss x Alteration of hydrology x Deterioration in water quality x Disturbance during construction / operation Local Carlow County Development Overall strategies for the proper Provision of infrastructure may result in: Plan (CDP) 2015-2021 planning and sustainable x Habitat loss Wexford CDP 2013-2019 development of the administrative x Alteration of hydrology Kilkenny CDP 2014 – 2020 area of the relevant Local Authorities. x Deterioration in water quality Laois CDP 2011 – 2017 Include provisions relating to x Disturbance during construction / operation Kildare CDP 2011 – 2017 housing, economic (including Wicklow CDP 2016 - 2022 tourism), community, transport (including cycling) and infrastructural development. 2.6 Conclusions The likely impacts that could arise from the draft Plan have been examined in the context of a number of factors that could potentially affect the integrity of the Natura 2000 network of sites. On the basis of the findings of this Screening for AA, it is concluded that the draft Plan: x is not directly connected with or necessary to the management of a European site; and x may have significant impacts on the Natura 2000 network. Therefore, applying the precautionary principle and in accordance with Article 6(3) of the Habitats Directive, a Stage 2 AA is required. That stage is set out in Section 3 of this report. CAAS for Carlow County Council 17 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Section 3 Stage 2 Appropriate Assessment 3.1 Introduction The main objective of this stage (Stage 2) in the AA is to determine whether the proposed Tullow LAP would result in significant adverse impacts on the integrity of any European site with respect to the site’s structure, function, and/or conservation objectives. The Stage 1 Screening presented above has identified two European sites with potential to be affected by the proposed Tullow LAP (see Table 3.1). Therefore, taking a precautionary approach, Stage 2 AA is required. The potential adverse effects considered at this stage will either be effects occurring as a result of the implementation of the draft Plan alone or in-combination with other plans, programmes, and/or projects. Detailed information relevant to the sites that has been reviewed to inform the AA includes the following: • NPWS Site Synopsis • Natura 2000 Standard Data Form • Conservation Objectives and supporting documents Table 3.1 European Sites Potentially Impacted upon by the Draft Tullow LAP cSAC Rivers with associated habitats and species SPAs including downstream aquatic ecological receptors - River Slaney cSAC None - Raven Point Nature Reserve SAC 3.2 Potential Significant Effects As outlined in the European Commission Environment DG document “Assessment of plans and projects significantly affecting Natura 2000 sites: Methodological guidance on the provisions of Article 6(3) and (4) of the Habitats Directive 92/43/EEC”, impacts that could potentially occur through the implementation of the draft Plan can be categorised under a number of headings: x Loss / reduction of habitat area (e.g. due to the development of new projects) x Disturbance to Key Species (e.g. increased public access to protected sites, or during the construction phase of infrastructure projects) x Habitat or species fragmentation x Reduction in species density x Changes in key indicators of conservation value such as decrease in water quality / quantity (e.g. through inadequate wastewater treatment, run-off of pollutants during construction and operation of developments, agricultural runoff) The draft LAP provides a framework for sustainable development within Tullow. The draft Plan also prescribes particular locations (site specific) of developments of infrastructure. Overall, the draft Plan underpins the development of housing, tourism, communities and the town centre with supporting infrastructure and services within the Tullow area including those related to transport, water, energy, and communication infrastructure. 3.2.1 Reduction of Habitat Area There is a potential that the designated site within the functional area of the Plan may be adversely affected through the implementation of the Plan. Development either in isolation or in combination with other similar developments can potentially lead to significant adverse impacts on the environment with CAAS for Carlow County Council 18 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 long term consequences. The development of different land uses and the upgrading of networks could lead to loss of habitats if inappropriately located within the boundaries of the River Slaney cSAC. Indirectly, habitat loss may also occur through draining of development lands adjacent to the cSAC that support wetlands. Although the draft LAP is overlapping with a European site, due to the nature of the likely developments that may arise, direct or indirect habitat loss resulting from the implementation of the draft Plan is not foreseen. There are a number of overlaps between the area which is designated as cSAC and existing land use zoning objectives. If unmitigated, such overlaps could result in the full range of effects including: x Loss / Reduction of Habitat Area x Disturbance to Key Species x Habitat / Species Fragmentation x Reduction in Species Density x Changes in Key Indicators of Conservation Value A constrained land use zoning objective for the Natura 2000 site has been integrated into the LAP which mitigates this potential (mitigation is detailed under Section 4 below). 3.2.2 Fragmentation Habitat and species fragmentation can occur through the breaking up of or loss of habitats resulting in interference with existing ecological units. Fragmentation can also result from impediments to the natural movements of species. This is relevant where important corridors for movement or migration are likely to be disrupted such as along river corridors when construction introduces a barrier to the free movement of species from one area of habitat to another. Installation of linear infrastructure e.g. roads and other transportation links, water and wastewater pipelines, can have a negative impact over a wide distance where such infrastructure crosses designated Sites. 3.2.3 Disturbance to Key Species Disturbance to species supported by a European site is likely to occur where there is an increase in activity levels from recreation and amenity or from developments within or adjacent to designated areas. Sources of disturbance include noise, vibration, light, construction and operation activities or other sources of disturbance arising from recreation and amenity or from the inappropriate timing of works. The Draft Plan supports the development of infrastructural development and the development of tourism and recreation. These projects have the potential to cause disturbance impacts to key species if located in proximity to relevant European sites. The European sites potentially affected include the River Slaney cSAC and Raven Point Nature Reserve SAC, both of which have various designated features as qualifying interests. Species such as Otter are vulnerable to disturbance due to construction works, aquaculture practices, and increased amenity uses along waterways arising from proposed developments as part of the Draft Plan. Other species sensitive to disturbance are included on Table 3.2 below. CAAS for Carlow County Council 19 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Table 3.2: European sites and QIs vulnerable to disturbance to key species from the implementation of the Draft Plan Site Code Site Name QI (s) Key Species potentially affected by disturbance 781 River Slaney cSAC Estuaries; Tidal Mudflats and Sandflats; Floating River Vegetation; Old Oak Woodlands; Alluvial Forests*; Freshwater Pearl Mussel (Margaritifera margaritifera); Sea Lamprey (Petromyzon marinus); Brook Lamprey (Lampetra planeri); River Lamprey (Lampetra fluviatilis); Twaite Shad (Alosa fallax); Atlantic Salmon (Salmo salar); Otter (Lutra lutra); Common (Harbour) Seal (Phoca vitulina) 710 Raven Point Nature Reserve SAC Mudflats and sandflats not covered by seawater at low tide; Annual vegetation of drift lines; Atlantic salt meadows (GlaucoǦPuccinellietalia maritimae); Embryonic shifting dunes; Shifting dunes along the shoreline with Ammophila arenaria ('white dunes'); *Fixed coastal dunes with herbaceous vegetation ('grey dunes'); Dunes with Salix repens ssp. argentea (Salicion arenariae); Humid dune slacks 3.2.4 Changes of Indicators of Conservation Value Key indicators of conservation value for the two sites under consideration include surface water quality and quantity. Impacts on these sites may occur due to the hydrological connection between the sites and the draft Plan Area. Implementation of the draft LAP could result in alterations to the hydrological regime or physical environment of the sites due to drainage, alteration of flow regime, and discharges of pollutants to watercourses. Discharges of waste water or storm water runoff from the Plan Area to the River Slaney could potentially impact on downstream water quality within those sites occurring downstream of the draft Plan Area. Cumulative impacts through waste water discharges from the wider county and surrounding counties could also potentially affect these sites. 3.3 Conservation Objectives The Habitats Directive requires the focus of the assessment at this stage to be on the integrity of the site as indicated by its Conservation Objectives. It is an aim of NPWS to draw up conservation management plans for all areas designated for nature conservation. These plans will, among other things, set clear objectives for the conservation of the features of interest within a site. No Conservation Management Plans have been prepared for any of those sites considered in Stage 2 of this appropriate assessment. SiteǦspecific conservation objectives (SSCOs) have been prepared for a number of European sites. These detailed SSCOs aim to define favourable conservation condition for the qualifying habitats and species at that site by setting targets for appropriate attributes which define the character habitat. The maintenance of the favourable condition for these habitats and species at the site level will contribute to the overall maintenance of favourable conservation status of those habitats and species at a national level. Favourable conservation status of a species can be described as being achieved when: ‘population data on the species concerned indicate that it is maintaining itself, and the natural range of the species is neither being reduced or likely to be reduced for the foreseeable future, and there is, and will probably continue to be, a sufficiently large habitat to maintain its populations on a long-term basis.’ CAAS for Carlow County Council 20 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Favourable conservation status of a habitat can be described as being achieved when: ‘its natural range, and area it covers within that range, is stable or increasing, and the ecological factors that are necessary for its long-term maintenance exist and are likely to continue to exist for the foreseeable future, and the conservation status of its typical species is favourable’. Generic Conservation Objectives for cSACs have been provided as follows: x To maintain or restore the favourable conservation condition of the Annex I habitat(s) and/or the Annex II species for which the SAC has been selected. One generic Conservation Objective has been provided for SPAs as follows: x To maintain or restore the favourable conservation condition of the bird species listed as Special Conservation Interests for this SPA. SSCOs have been prepared for the River Slaney SAC and the Raven Point Nature Reserve SAC considered in Stage 2 of this assessment. CAAS for Carlow County Council 21 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Section 4 Mitigation Measures 4.1 Introduction Where it cannot be demonstrated that there will be no adverse effects from the implementation of the draft LAP, mitigation measures have been devised. The policies and objectives outlined below have been developed with input from the SEA and AA process in order to mitigate against identified potential impacts. The measures that are recommended are compatible with those proposed by the SEA environmental report and with other relevant plans and programmes e.g. Programme of Measures proposed by the River Basin Management Plan. Based on the types of impacts identified above, the mitigation measures presented below are split into two main categories, ‘Measures to Protect Habitats and Species’ and ‘Measures to Protect Water Quality’. The draft Tullow LAP is a lower tier Plan of the Carlow County Development Plan (CCDP), therefore The Tullow LAP sits within a hierarchy of development plans in County Carlow and environmental protection measures included in the Carlow County Development Plan must be adhered to by applications for development under the LAP. 4.2 Measures to Protect Habitats and Species As outlined in Section 3.2 of this assessment a number of significant effects that could impact on habitats and species have been identified. Following mitigation, no zoning or specific projects are proposed by the draft Plan would be likely to result in direct impacts on any European site. Measures have been included in the policies and objectives of the Draft Plan that will ensure these impacts are avoided. The Appropriate Assessment and Strategic Environmental Assessment of the draft Plan have facilitated the integration of a number of policies and objectives into the Plan to strengthen the protection afforded to the Natura 2000 network of sites. Amongst other things, these policies and objectives will ensure that Appropriate Assessments are carried out where development projects are likely to have significant effects on European designated sites. This will ensure that project level effects, which cannot be predicted at the Plan level, will be mitigated and impacts on protected sites through inappropriate development will be avoided. Objectives and policies within the draft Tullow LAP 2016 - 2022 that will act to protect the Natura 2000 network include the following: Policies Relating to Flooding Policy FL 2 To have regard to the findings and recommendations of the current Strategic Flood Risk Assessment carried out for the Tullow Local Area Plan area. Policy FL 3 To implement the use of the sequential approach and application of the Justification Tests for Development Management and Development Plans, during the period of this plan, as set out in the Flood Risk Management Guidelines as follows: 1) Avoid development that will be at risk of flooding or that will increase the flooding risk elsewhere, where possible; 2) Substitute less vulnerable uses, where avoidance is not possible; and 3) Justify, mitigate and manage the risk, where avoidance and substitution are not possible. Development should only be permitted in areas at risk of flooding when there are no alternative, reasonable sites available in areas at lower risk that also meet the objectives of proper planning and sustainable development. CAAS for Carlow County Council 22 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Policies Relating to Recreational Potential Policy RC 1 To facilitate where practicable the provision of cycle-ways / walkways along the extent of the River Barrow and Canal in co-operation with landowners, Waterways Ireland and government departments. Any proposed cycling or walking routes along the River and Canal will be such to Appropriate Assessment in accordance with the Habitats Directive. Policy RC 3 To continue to co-operate with community and sports bodies in the development of the River Slaney for recreational uses. Projects shall have regard to the requirement for Appropriate Assessment in accordance with the Habitats Directive. Policies Relating to Waste Management Policy WMP 2 To safeguard the environment by seeking to ensure that residual waste is disposed of appropriately. Objectives Relating to Waste Management Objective WMO 2 To assess the feasibility of additional recycling, including composting facilities in the town or environs at a location(s) that will not adversely affect residential amenity or environmental quality. Policies Relating to Designated Sites Policy HR 7 To contribute, as appropriate, towards the protection of designated ecological sites including candidate Special Areas of Conservation (cSACs) and Special Protection Areas (SPAs); Wildlife Sites (including proposed Natural Heritage Areas); and Flora Protection Order sites. Policy HR 8 To contribute towards compliance with relevant EU Environmental Directives and applicable National Legislation, Policies, Plans and Guidelines, including the following and any updated/superseding documents: - EU Directives, including the Habitats Directive (92/43/EEC, as amended)[1], the Birds Directive (2009/147/EC)[2], the Environmental Liability Directive (2004/35/EC)[3], the Environmental Impact Assessment Directive (85/337/EEC, as amended), the Water Framework Directive (2000/60/EC) and the Strategic Environmental Assessment Directive (2001/42/EC). - National legislation, including the Wildlife Act 1976[4], the European Communities (Environmental Impact Assessment) Regulations 1989 (SI No. 349 of 1989) (as amended), the Wildlife (Amendment) Act 2000, the European Union (Water Policy) Regulations 2003 (as amended), the Planning and Development Act 2000 (as amended), the European Communities (Birds and Natural Habitats) Regulations 2011 (SI No. 477 of 2011) and the European Communities (Environmental Liability) Regulations 2008[5]. - National policy guidelines (including any clarifying Circulars or superseding versions of same), including the Landscape and Landscape Assessment Draft Guidelines 2000, the Environmental Impact Assessment Sub- Threshold Development Guidelines 2003, Strategic Environmental Assessment Guidelines 2004 and the Appropriate Assessment Guidance 2010. - Catchment and water resource management Plans, including the relevant River Basin Management Plan. - Biodiversity Plans and guidelines, including Actions for Biodiversity 2011-2016: Ireland’s 2nd National Biodiversity Plan (including any superseding version of same). - Freshwater Pearl Mussel Regulations (S.I. 296 of 2009) (including any associated designated areas or management plans). - Ireland’s Environment 2014 (EPA, 2014, including any superseding versions of same), and to make provision where appropriate to address the report’s goals and challenges. Policy HR 9 That all projects and plans arising from this plan (including any associated improvement works or associated infrastructure) will be screened for the need to undertake Appropriate Assessment under Article 6 of the Habitats Directive. A plan or project will only be authorised after the competent authority has ascertained, based on scientific evidence, Screening for Appropriate Assessment, and a Stage 2 Appropriate Assessment where necessary, that: (a)The Plan or project will not give rise to significant adverse direct, indirect or secondary effects on the integrity of any European site (either individually or in combination with other plans or projects); or (b)The Plan or project will have significant adverse effects on the integrity of any European site (that does not host a priority natural habitat type/and or a priority species) but there are no alternative solutions and the plan or project must nevertheless be carried out for imperative reasons of overriding public interest, including those of a CAAS for Carlow County Council 23 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 social or economic nature. In this case, it will be a requirement to follow procedures set out in legislation and agree and undertake all compensatory measures necessary to ensure the protection of the overall coherence of Natura 2000; or ©The Plan or project will have a significant adverse effect on the integrity of any European site (that hosts a natural habitat type and/or a priority species) but there are no alternative solutions and the plan or project must nevertheless be carried out for imperative reasons for overriding public interest, restricted to reasons of human health or public safety, to beneficial consequences of primary importance for the environment or, further to an opinion from the Commission, to other imperative reasons of overriding public interest. In this case, it will be a requirement to follow procedures set out in legislation and agree and undertake all compensatory measures necessary to ensure the protection of the overall coherence of Natura 2000. Policy HR 10 (a) Not to permit projects giving rise to significant cumulative, direct, indirect or secondary impacts on Natura 2000 sites arising from their size or scale, land take, proximity, resource requirements, emissions (disposal to land, water or air), transportation requirements, duration of construction, operation, decommissioning or from any other on the basis of this plan (either individually or in combination with other plans or projects[6]). (b) To require applications for development within the constrained land use zoning objective for the Natura 2000 site (Map 13) to undergo Appropriate Assessment and demonstrate that the proposal will not give rise to any effect on the Natura 2000 site in view of its qualification features and conservation objectives. Policy HR 11 To facilitate the conservation, protection and enhancement of the River Slaney including the adjacent wetlands and associated habitats and to ensure that development does not significantly adversely affect conservation values. Policy HR 12 To seek the submission of an Ecological Impact Assessment for all development which may have a significant impact on the river and riparian habitats. This assessment should where appropriate suggest a minimum buffer of undisturbed vegetation to be retained to mitigate against pollution risks, reduce flooding potential, maintain habitats and provide an ecological corridor. The buffer zone shall, where possible be maintained free of development and hard surfaces. The assessment shall address protected species i.e. bats, otters including the requirement for derogation licences together with the cumulative impact of the proposed development. Policy HR 13 To ensure that development does not have a significant adverse impact on plant species, animals and birds listed in the Flora Protection Order, Wildlife Act 1976 as amended, those listed in Annex IV of the Habitats Directive and those listed in Annex I of the Birds Directive. Policies Relating to Green Infrastructure Policy HR 15 To seek to contribute towards the protection and enhancement of biodiversity and ecological connectivity, including trees, hedgerows, rivers, streams, other landscape features and associated wildlife where these form part of the ecological network and/or may be considered as ecological corridors or stepping stones in the context of Article 10 of the Habitats Directive. Policies Relating to Invasive and Non-Native Species Objective HR 21 To support as appropriate the National Parks and Wildlife Service’s efforts to seek to control the spread of non- native species on land and water and where appropriate seek the submission of an invasive species management plan. [6] Except as provided for in Section 6(4) of the Habitats Directive, viz. There must be: a) no alternative solution available, b) imperative reasons of overriding public interest for the project to proceed; and c) Adequate compensatory measures in place. CAAS for Carlow County Council 24 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Policies Relating to Tourism Policy TP 7 To seek to manage any increase in visitor numbers to avoid significant effects including loss of habitat and disturbance, any projects are a suitable distance from the water’s edge and legislation relating to habitats, species, connectivity and designated sites is complied with. Policies Relating to the Landscape Policy L1 To contribute towards the protection of county and local level landscape designations from incompatible developments. Proposals for development that have the potential to significantly adversely impact upon these designations shall be accompanied by an assessment of the potential landscape and visual impacts of the proposed development - demonstrating that landscape impacts have been anticipated and avoided to a level consistent with the sensitivity of the landscape and the nature of the designation. Policies Relating to Land Use Zoning Policy HR 10B To require applications for development within the constrained land use zoning objective for the Natura 2000 site (Map 13) to undergo Appropriate Assessment and demonstrate that the proposal will not give rise to any effect on the Natura 2000 site in view of its qualification features and conservation objectives. CAAS for Carlow County Council 25 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 4.3 Measures to Protect Water Quality Section 3.2 of this assessment identified that impacts on water quality to a number of downstream European sites have potential to arise through, discharges of wastewater, and possible discharges of sediment and other pollutants from future development and associated works. In addition, any newly proposed or upgraded wastewater treatment plants should fully comply with all Urban Waste Water Regulations requirements 2001 – 2004, and should furthermore comply with all wastewater discharge authorisation requirements as per 2007 Regulations and Urban Wastewater Regulations 2001. Policies and objectives within the draft Plan that will act to protect the water quality and quantity with those European sites against the potential impacts identified include the following: Policies Relating to Water Supply and Quality Policy WSP 1 To contribute towards the protection of existing and potential water resources, and their use by humans and wildlife, including rivers, streams, groundwater and associated habitats and species in accordance with the requirements and guidance in the EU Water Framework Directive 2000 (2000/60/EC), the European Union (Water Policy) Regulations 2003 (as amended), the European Communities Environmental Objectives (Surface Waters) Regulations 2009 (SI No. 272 of 2009), the Groundwater Directive 2006/118/EC and the European Communities Environmental Objectives (groundwater) Regulations, 2010 (S.I. No. 9 of 2010) and other relevant EU Directives, including associated national legislation and policy guidance (including any superseding versions of same). To also support the application and implementation of a catchment planning and management approach to development and conservation, including the implementation of Sustainable Drainage System techniques for new development. Policy WSP 2 To support the implementation of the relevant recommendations and measures as outlined in the relevant River Basin Management Plan, and associated Programmes of Measures, or any such plans that may supersede same during the lifetime of the plan, as well as relevant recommendations contained in the Water Quality in Ireland 2010 – 2012 (EPA, 2015, and any updated/superseding document). Proposals for development would not have an unacceptable impact on the water environment, including surface waters, groundwater quality and quantity, river corridors and associated woodlands. Also to have cognisance of, where relevant, the EU’s Common Implementation Strategy Guidance Document No. 20 which provides guidance on exemptions to the environmental objectives of the Water Framework Directive. Policy WSP 8 To protect surface water and ground water resources and their associated habitats and species including fisheries and in particular Annex II listed species. Objective Relating to Water Supply and Quality Objective WSO 8 To ensure that all proposals for the development of an upgrade to the water supply system will be screened for Appropriate Assessment in accordance with Article 6(3) of the Habitats Directive and where significant impacts are identified, a Natura Impact Statement will be prepared. Policy Relating to Waste Water Policy WW 4 To ensure the changeover from septic tanks to mains connections in all cases where this is feasible, and that all new developments utilise and connect to the existing wastewater infrastructure. The provision of individual septic tanks and treatment plants within the Plan boundary will be strongly discouraged to minimise the risk of groundwater pollution. Where such facilities are permitted, full compliance with the 2009 EPA Code of Practice - Code of Practice Wastewater treatment and Disposal Systems serving single houses (p.e. 10), is required. Objective Relating to Waste Water Objective WWO 3 To ensure that any proposals for the development and /or upgrade of the Tullow waste water treatment plant and waste water network will be subject to Appropriate Assessment in accordance with Article 6(3) and 6(4) of the EU Habitats Directive. CAAS for Carlow County Council 26 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Objective Relating to Flooding Objective FLO 4 To protect water bodies and watercourses within the plan area from inappropriate development, including the river, canal, streams, associated undeveloped riparian strips, wetlands and natural floodplains. A 10 metre strip on either side of such channel will be retained, where required, to facilitate access thereto. In addition, promote the sustainable management and uses of water bodies and avoid culverting or realignment of these features. Policy Relating to Soil Policy P 5 To ensure that adequate soil protection measures are undertaken where appropriate. Appropriate investigations shall be carried out into the nature of any soil and groundwater contamination and the risks associated with site development works. 4.4 Mitigation by amendments being made to Draft Plan provisions The AA and SEA processes facilitated the amendment of the Draft Plan provisions including the following (recommended text which was inserted into the Plan is in bold and recommended deletions which were removed from the Plan are in strikethrough): Public Spaces and Public Realm PR 2: To prioritise the improvement of, and access to, subject to the requirements of the Habitats Directive, the waterfront area and the retail core for the enjoyment of both visitors and residents alike. Water Supply and Quality WSO 8: To ensure that all proposals for the development of an upgrade to the water supply system will be screened for Appropriate Assessment in accordance with Article 6(3) of the Habitats Directive and where significant potential impacts to the integrity of the Natura 2000 network are identified, a Natura Impact Statement will be prepared. Policies in relation to Green Infrastructure HR 17: To explore the feasibility, subject to the requirements of the Habitats Directive, of developing a linear park, along the river Slaney, linking to areas of open space and amenity. Where lands are in private ownership it shall be policy, in any development proposal, to secure public access along the waterway. Policies and Objectives in relation to Tourism TO 1: To provide where feasible, and support the provision of tourism infrastructure and services, subject to the requirements of the Habitats Directive, including, walking, cycling and water based infrastructure and short-term guest accommodation facilities throughout the settlement in appropriate locations. TO 4: To support the provision and augmentation, of sporting, kayaking / canoeing and angling facilities, pony trekking routes, adventure centres and associated ancillary uses in appropriate locations subject to the requirements of the Habitats Directive. CAAS for Carlow County Council 27 Natura Impact Report for the draft Tullow Local Area Plan 2016-2022 Section 5 Conclusion Stage 1 Screening and Stage 2 Appropriate Assessment of the draft Tullow Local Area Plan has been carried out. Implementation of the draft Plan has the potential to result in impacts to the integrity of the Natura 2000 network, if unmitigated. The risks to the safeguarding and integrity of the qualifying interests and conservation objectives of the Natura 2000 network have been addressed by the inclusion of mitigation measures that will prioritise the avoidance of impacts in the first place and mitigate impacts where these cannot be avoided. In addition, all lower level plans and projects arising through the implementation of the draft Plan will themselves be subject to Appropriate Assessment when further details of design and location are known. Having incorporated mitigation measures, it is considered that the draft Plan will not have a significant adverse effect on the integrity of the Natura 2000 network of sites5. 5 Except as provided for in Section 6(4) of the Habitats Directive, viz. There must be: a) no alternative solution available, b) imperative reasons of overriding public interest for the plan to proceed; and c) Adequate compensatory measures in place. CAAS for Carlow County Council 28 NATURA IMPACT REPORT -APPENDIX I SUMMARY DETAILS OF ALL EUROPEAN SITES CONSIDERED DURING THE APPROPRIATE ASSESSMENT IN SUPPORT OF THE APPROPRIATE ASSESSMENT OF THE DRAFT TULLOW LOCAL AREA PLAN 2016-2022 IN ACCORDANCE WITH THE REQUIREMENTS OF ARTICLE 6(3) OF THE EU HABITATS DIRECTIVE for: Carlow County Council Athy Road Carlow County Carlow by: CAAS Ltd. 2nd Floor, The Courtyard 25 Great Strand Street Dublin 1 JULY 2016 Introduction This appendix presents background summary data relating to each European site (cSACs and SPAs) that was considered during the Appropriate Assessment of the Draft Tullow Local Area Plan 2016-2022. Data presented has been collated from various sources made available by the National Parks and Wildlife Service (NPWS) of the Department of Arts, Heritage and the Gaeltacht. All sites within each list are sorted according to NPWS Site Code. The principal sources of information include the following: x Site Synopses x NATURA 2000 Standard Data Forms x Conservation Objective (Generic Versions) x Detailed Site Specific Conservation Objectives and supporting documents (where available)1 Data presented on each site includes: x Site Name x Site Code x County x SSCO Published or not (as of September 2015) x SSCO Version reference used during AA x Location relevant to the Strategy area x Previously reported threats x Qualifying Interests (QIs) in the case of SACs: o Listed Annex I habitats for which site is selected - abbreviated version as used by NPWS (2013)2 o Listed Annex II species for which site is selected - common English name 1SiteͲSpecificDetailedConservationObjectivesListfordesignatedsitesisavailableat: http://www.npws.ie/protectedͲsites/conservationͲmanagementͲplanning/conservationͲobjectives(28/06/2016). 2NPWS(2013).TheStatusofEUProtectedHabitatsandSpeciesinIreland.OverviewVolumeI.Unpublished Report,NationalParksandWildlifeServices. European Sites which occur within 15 Km of the Plan Area Site Name: Blackstairs Mountains cSAC Site Code: 770 County(s): Carlow, Wexford SSCO’s Published: No Location: Occurs ca 14 km south of Tullow. Threats: Grazing is considered to be one of the main threats to the site. Lower slopes of the site which contains upland grassland has been heavily grazed. Although sheep numbers are low overall, there are pockets where high numbers are found, which has resulted in patches of bare ground. The site is also vulnerable to the burning of Heather, which appears to carried out on a rotational basis. Bogland present in the area is reduced to fragments bordering improved grassland and forestry. SSCO Version: NPWS (2015) Conservation objectives for Blackstairs Mountains SAC [000770]. Generic Version 4.0. Department of Arts, Heritage and the Gaeltacht. Habitat QI’s (Annex I Habitats): x Wet Heath; x Dry Heath Species QI’s (Annex II Species): Site Name: Slaney River Valley cSAC Site Code: 781 County(s): Carlow, Wexford, Wicklow SSCO’s Published: Yes Location: Runs through the area of Tullow and continues downstream as far as Wexford Harbour. Threats: Agriculture is the main land use. Arable crops are important. Improved grassland and silage account for much of the remainder. The spreading of slurry and fertiliser poses a threat to the water quality of this salmonid river and to the populations of E.U. Habitats Directive Annex II animal species within it. Run-off is undoubtedly occurring, as some of the fields slope steeply directly to the river bank. In addition, cattle have access to the river bank in places. Fishing is a main tourist attraction along stretches of the Slaney and its tributaries, and there are a number of Angler Associations, some with a number of boats. Fishing stands and styles have been erected in places. Both commercial and leisure fishing takes place. There are some gravel pits along the river below Bunclody and many of these are active. There is a large landfill site adjacent to the river close to Hacketstown and at Killurin. Boating, bait-digging and fishing occur in parts of Wexford Harbour. Waste water outflows, runoff from intensive agricultural enterprises, a meat factory at Clohamon, a landfill site adjacent to the river, and further industrial development upstream in Enniscorthy and in other towns could all have potential adverse impacts on the water quality unless they are carefully managed. The spread of exotic species is also reducing the quality of the woodlands. SSCO Version: NPWS (2011) Conservation Objectives: Slaney River Valley SAC 000781. Version 1.0. National Parks and Wildlife Service, Department of Arts, Heritage and the Gaeltacht. Habitat QI’s (Annex I Habitats): x Estuaries; x Tidal Mudflats and Sandflats; x Floating River Vegetation; x Old Oak Woodlands; x Alluvial Forests*; Species QI’s (Annex II Species): x Freshwater Pearl Mussel (Margaritifera margaritifera); x Sea Lamprey (Petromyzon marinus); x Brook Lamprey (Lampetra planeri); x River Lamprey (Lampetra fluviatilis); x Twaite Shad (Alosa fallax); x Atlantic Salmon (Salmo salar); x Otter (Lutra lutra); x Common (Harbour) Seal (Phoca vitulina) Site Name: Holdenstown Bog cSAC Site Code: 1757 County(s): Wicklow SSCO’s Published: No Location: Occurs ca. 11 Km north of Tullow. Threats: The site is a small wetland in a kettle hole and is mostly dominated by raised bog but there is some open water. Birch woodland is invading the drier areas of the bog. The area surrounding site is agricultural land. Many of the main threats posed to the site arise from agricultural uses. Threats to the site include grazing, vulnerability to fertilisation and cultivation. Infilling of sites features, such as ditches, ponds and marshes, is also considered to be a highly significant threat. SSCO Version: NPWS (2015) Conservation objectives for Holdenstown Bog SAC [001757]. Generic Version 4.0. Department of Arts, Heritage and the Gaeltacht. Habitat QI’s (Annex I Habitats): x Transition Mires Species QI’s (Annex II Species): Site Name: River Barrow and River Nore cSAC Site Code: 2162 County(s): Carlow, Kildare, Kilkenny, Laois, Offaly, Tipperary, Waterford, Wexford SSCO’s Published: Yes Location: Runs through the area of Muine Bheag/ Royal Oak. Threats: The main threats to the site and current damaging activities include high inputs of nutrients into the river system from agricultural run-off and several sewage plants, over-grazing within the woodland areas, and invasion by non-native species, for example Cherry Laurel (Prunus laurocerasus) and Rhododendron (Rhododendron ponticum). The water quality of the site remains vulnerable. Good quality water is necessary to maintain the populations of the Annex II animal species listed above. Good quality is dependent on controlling fertilisation of the grasslands, particularly along the Nore. It also requires that sewage be properly treated before discharge. Drainage activities in the catchment can lead to flash floods which can damage the many Annex II species present. Capital and maintenance dredging within the lower reaches of the system pose a threat to migrating fish species such as lamprey and had. Land reclamation also poses a threat to the salt meadows and the populations of legally protected species therein. SSCO Version: NPWS (2011) Conservation Objectives: River Barrow and River Nore SAC 002162. Version 1.0. National Parks and Wildlife Service, Department of Arts, Heritage and the Gaeltacht. Habitat QI’s (Annex I Habitats): x Estuaries; x Tidal Mudflats and Sandflats; x Salicornia Mud; x Atlantic Salt Meadows; x Mediterranean Salt Meadows; x Floating River Vegetation; x Dry Heath; x Hydrophilous Tall Herb Communities; x Petrifying Springs*; x Old Oak Woodlands; x Alluvial Forests* Species QI’s (Annex II Species): x Desmoulin's Whorl Snail (Vertigo moulinsiana); x Freshwater Pearl Mussel (Margaritifera margaritifera); x White-clawed Crayfish (Austropotamobius pallipes); x Sea Lamprey (Petromyzon marinus); x Brook Lamprey (Lampetra planeri); x River Lamprey (Lampetra fluviatilis); x Twaite Shad (Alosa fallax); x Atlantic Salmon (Salmo salar); x Otter (Lutra lutra); x Killarney Fern (Trichomanes speciosum); x Nore Freshwater Pearl Mussel (Margaritifera durrovensis) European Sites that occur beyond 15 km of the Plan Boundary but are Hydrologically Connected to the Plan Area Site Name: Raven Point Nature Reserve cSAC Site Code: 710 County(s): Wexford SSCO’s Published: Yes Location: Occurs approximately 57 km south-east of the LAP boundary (ca 72 km downstream). Threats: Curracloe is a popular summer resort and parts of the Raven receive high recreational pressure. In particular, pony trekking has caused erosion of the embryonic dunes in some places. It is planned to gradually remove all the conifers from the sand dune system. Some selected areas will be clearfelled, others will be left as scrub pine. After harvesting the conifers, certain areas behind the dunes will be planted with hardwoods, including Alder (Alnus glutinosa) and Sessile Oak (Quercus petraea). Other areas, in particular the more low-lying areas of former dune slack, will be left to regenerate naturally. SSCO Version: NPWS (2011) Conservation Objectives: Raven Point Nature Reserve SAC 000710. Version 1.0. National Parks and Wildlife Service, Department of Arts, Heritage and the Gaeltacht. Habitat QI’s (Annex I Habitats): x Mudflats and sandflats not covered by seawater at low tide; x Annual vegetation of drift lines; x Atlantic salt meadows (GlaucoǦPuccinellietalia maritimae); x Embryonic shifting dunes; x Shifting dunes along the shoreline with Ammophila arenaria ('white dunes'); x *Fixed coastal dunes with herbaceous vegetation ('grey dunes'); x Dunes with Salix repens ssp. argentea (Salicion arenariae); x Humid dune slacks Species QI’s (Annex II Species): SFRA for the Tullow Local Area Plan 2016-2022 Strategic Flood Risk Assessment July 2016 JBA Project Manager 5RVV%U\DQW%6F06F&(QY0&,:(0&:(0 *URYH,VODQG &RUEDOO\ /LPHULFN ,UHODQG Revision History Revision Ref / Date Issued Amendments Issued to 6)5$Y-XQH )LUVW,VVXH &DUORZ&RXQW\&RXQFLO 6)5$Y-XO\ =RQLQJDGMXVWPHQWV &DUORZ&RXQW\&RXQFLO Contract 7KLVUHSRUWGHVFULEHVZRUNFRPPLVVLRQHGE\)LRQD2 1HLOORQEHKDOIRI&DUORZ&RXQW\&RXQFLO E\DOHWWHUGDWHGWKRI)HEUXDU\&DUORZ&RXQW\&RXQFLO¶VUHSUHVHQWDWLYHIRUWKHFRQWUDFW ZDV)LRQD2 1HLOORI&DUORZ&RXQW\&RXQFLO5RVV%U\DQWDQG&RQRU4XLQODQRI-%$&RQVXOWLQJ FDUULHGRXWWKLVZRUN 3UHSDUHGE\5RVV%U\DQW%6F06F&(QY0&,:(0&:(0 &KDUWHUHG6HQLRU$QDO\VW 5HYLHZHGE\-RQDWKDQ&RRSHU%(QJ06F'LS&'&(QJ0,&( 0&,:(0&:(00OR'0,(, 0DQDJLQJ'LUHFWRU Purpose 7KLV GRFXPHQW KDV EHHQ SUHSDUHG DV DQ 6)5$ IRU &DUORZ &RXQW\ &RXQFLO -%$ &RQVXOWLQJ DFFHSWVQRUHVSRQVLELOLW\RUOLDELOLW\IRUDQ\XVHWKDWLVPDGHRIWKLVGRFXPHQWRWKHUWKDQE\WKH &OLHQWIRUWKHSXUSRVHVIRUZKLFKLWZDVRULJLQDOO\FRPPLVVLRQHGDQGSUHSDUHG -%$&RQVXOWLQJKDVQROLDELOLW\UHJDUGLQJWKHXVHRIWKLVUHSRUWH[FHSWWR&DUORZ&RXQW\&RXQFLO V7XOORZ6)5$YGRF[ L Copyright -%$&RQVXOWLQJ(QJLQHHUVDQG6FLHQWLVWV/WG Carbon Footprint $SULQWHGFRS\RIWKHPDLQWH[WLQWKLVGRFXPHQWZLOOUHVXOWLQDFDUERQIRRWSULQWRIJLISRVW FRQVXPHUUHF\FOHGSDSHULVXVHGDQGJLISULPDU\VRXUFHSDSHULVXVHG7KHVHILJXUHVDVVXPH WKHUHSRUWLVSULQWHGLQEODFNDQGZKLWHRQ$SDSHUDQGLQGXSOH[ -%$LVDLPLQJWRUHGXFHLWVSHUFDSLWDFDUERQHPLVVLRQV V7XOORZ6)5$YGRF[ LL Contents 1 Study Background...... 1 6FRSHRI6WXG\ 5HSRUW6WUXFWXUH 2 Tullow Study Area ...... 3 ,QWURGXFWLRQ :DWHUFRXUVHV (QYLURQPHQW 3ODQQLQJ3ROLF\ 3 The Planning System and Flood Risk Management ...... 6 ,QWURGXFWLRQ 'HILQLWLRQRI)ORRG5LVN 'HILQLWLRQRI)ORRG=RQHV 2EMHFWLYHVDQG3ULQFLSOHVRIWKH3ODQQLQJ*XLGHOLQHV 7KH6HTXHQWLDO$SSURDFKDQG-XVWLILFDWLRQ7HVW 6FDOHVDQG6WDJHVRI)ORRG5LVN$VVHVVPHQW 4 Data Collection...... 11 2YHUYLHZ 1DWLRQDO3)5$6WXG\)OXYLDO)ORRG2XWOLQHV 1DWLRQDO&)5$03URJUDPPH 7XOORZSKHOLP)ORRG5HOLHI6FKHPH )56 +LVWRULF)ORRG5HYLHZDQG&RQVXOWDWLRQZLWK$UHD(QJLQHHU 6RXUFHVRI)ORRGLQJ &OLPDWH&KDQJH 5 Approach to Flood Risk Management ...... 21 7KH6WUDWHJLF$SSURDFK $SSOLFDWLRQRIWKH3ODQ0DNLQJ-XVWLILFDWLRQ7HVW )ORRG0DQDJHPHQW$FWLRQ3ODQV 'HYHORSPHQW0DQDJHPHQWDQG)ORRG5LVN 5HTXLUHPHQWVIRUD)ORRG5LVN$VVHVVPHQW )ORRG0LWLJDWLRQ0HDVXUHVDW6LWH'HVLJQ 'UDLQDJHLPSDFWDVVHVVPHQW ,QFRUSRUDWLQJ&OLPDWH&KDQJHLQWR'HYHORSPHQW'HVLJQ 6 Settlement Review ...... 28 5HVLGHQWLDO/DQGV$GMDFHQWWR6ODQH\ 7RZQ&HQWUH /DQGVWRWKHVRXWKRIWKH7RZQ&HQWUH /DQGVDGMDFHQWWR0RXQW:ROVHOH\DQG7XOORZSKHOLP6WUHDPV /DQGVWRHDVWRI7XOORZ 7 SFRA Review and Monitoring ...... 34 V7XOORZ6)5$YGRF[ LLL List of Figures )LJXUH:DWHUFRXUVHVIORZLQJWKURXJK7XOORZ )LJXUH6RXUFH3DWKZD\5HFHSWRU0RGHO )LJXUH6HTXHQWLDO$SSURDFK3ULQFLSOHVLQ)ORRG5LVN0DQDJHPHQW )LJXUH)ORRG=RQHPDSSLQJZLWKZDWHUFRXUVHDQQRWDWLRQ )LJXUH7XOORZ)56/D\RXW (PEDQNPHQWV JUHHQ DQG:DOOV SLQN )LJXUH%\SDVVLQJSRLQWLQGLFDWHGE\6(&)5$0+\GUDXOLFV5HSRUW )LJXUH+LVWRULF)ORRG0DSSLQJ 6SDWLDO5HSUHVHQWDWLRQ )LJXUH7XOORZ)ORRG=RQHVDQG'HIHQGHG$UHDV &)5$0'DWD List of Tables 7DEOH3UREDELOLW\RI)ORRGLQJ 7DEOH'HILQLWLRQRI)ORRG=RQHV 7DEOH0DWUL[RI9XOQHUDELOLW\YHUVXV)ORRG=RQH 7DEOH)ORRG'DWD8VHGWR&RPSLOH)ORRG=RQH0DSSLQJ 7DEOH+LVWRULF)ORRGLQJ,QIRUPDWLRQTXRWHGIURP6RXWK(DVWHUQ&)5$0,QFHSWLRQ 5HSRUWDQGWKHFRQVXOWDWLRQZLWK&DUORZ(QJLQHHULQJVWDII 7DEOH$OORZDQFHVIRU)XWXUH6FHQDULRV Abbreviations ' 2QH'LPHQVLRQDO PRGHOOLQJ ' 7ZR'LPHQVLRQDO PRGHOOLQJ $(3 $QQXDO([FHHGDQFH3UREDELOLW\ $)$ $UHDIRU)XUWKHU$VVHVVPHQW &)5$0 &DWFKPHQW)ORRG5LVN$VVHVVPHQWDQG0DQDJHPHQW 'R(+/* 'HSDUWPHQWRIWKH(QYLURQPHQW+HULWDJHDQG/RFDO *RYHUQPHQW '70 'LJLWDO7HUUDLQ0RGHO (& (XURSHDQ&RPPXQLW\ (3$ (QYLURQPHQWDO3URWHFWLRQ$JHQF\ )5$ )ORRG5LVN$VVHVVPHQW )503 )ORRG5LVN0DQDJHPHQW3ODQ )55 )ORRG5LVN5HYLHZ *'6'6 *UHDWHU'XEOLQ6WUDWHJLF'UDLQDJH6WUDWHJ\ +()6 +LJK(QG)XWXUH6FHQDULR +3: +LJK3ULRULW\:DWHUFRXUVH V7XOORZ6)5$YGRF[ LY /$ /RFDO$XWKRULW\ /$3 /RFDO$UHD3ODQ 05)6 0HGLXP5DQJH)XWXUH6FHQDULR 23: 2IILFHRI3XEOLF:RUNV 26 2UGQDQFH6XUYH\ 3)5$ 3UHOLPLQDU\)ORRG5LVN$VVHVVPHQW 6$& 6SHFLDO$UHDRI&RQVHUYDWLRQSURWHFWHGXQGHUWKH(8 +DELWDWV'LUHFWLYH 6($ 6WUDWHJLF(QYLURQPHQWDO$VVHVVPHQW 6)5$ 6WUDWHJLF)ORRG5LVN$VVHVVPHQW 6, 6LWH,QYHVWLJDWLRQ 635 6WDQGDUGSHUFHQWDJHUXQRII 7S 7LPHWR3HDN V7XOORZ6)5$YGRF[ Y 1 Study Background -%$&RQVXOWLQJZDVDSSRLQWHGE\&DUORZ&RXQW\&RXQFLOWRFDUU\RXWWKH6WUDWHJLF)ORRG5LVN $VVHVVPHQWIRUWKH7XOORZ/RFDO$UHD3ODQ 7KLV UHSRUW GHWDLOV WKH 6)5$ IRU WKLV DUHD DQG KDV EHHQ SUHSDUHG LQ DFFRUGDQFH ZLWK WKH UHTXLUHPHQWVRIWKH'R(+/*DQG23:3ODQQLQJ*XLGHOLQHV7KH3ODQQLQJ6\VWHPDQG)ORRG 5LVN0DQDJHPHQW WKHVHJXLGHOLQHVZHUHLVVXHGXQGHUWKH3ODQQLQJDQG'HYHORSPHQW$FW DQGUHFRJQLVHWKHVLJQLILFDQFHRISURSHUSODQQLQJWRPDQDJHIORRGULVN 1.1 Scope of Study 8QGHUWKH3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQWJXLGHOLQHVWKHSXUSRVHIRUWKH)5$LV GHWDLOHGDVEHLQJ"to provide a broad (wide area) assessment of all types of flood risk to inform strategic land-use planning decisions. SFRAs enable the LA to undertake the sequential approach, including the Justification Test, allocate appropriate sites for development and identify how flood risk can be reduced as part of the development plan process". 7KH&DUORZ&RXQW\'HYHORSPHQW3ODQ &&'3 ZLOOEHWKHNH\GRFXPHQWIRUVHWWLQJRXW DYLVLRQIRUWKHGHYHORSPHQWRI7XOORZGXULQJWKHSODQSHULRG ,WLVLPSRUWDQWWKDWWKH/$3IXOILOVWKHUHTXLUHPHQWVRIWKHGRFXPHQW³7KH3ODQQLQJ6\VWHPDQG )ORRG5LVN0DQDJHPHQW*XLGHOLQHVIRU3ODQQLQJ$XWKRULWLHV´ 23:'R(+/* ZKLFKVWDWHV WKDW IORRG ULVN PDQDJHPHQW VKRXOG EH LQWHJUDWHG LQWR VSDWLDO SODQQLQJ SROLFLHV DW DOO OHYHOV WR HQKDQFHFHUWDLQW\DQGFODULW\LQWKHRYHUDOOSODQQLQJSURFHVV ,QRUGHUWRHQVXUHWKDWIORRGULVNLVLQWHJUDWHGLQWRWKH/$3WKHPDLQUHTXLUHPHQWVRIWKLVGRFXPHQW DUHWR x 3URGXFH)ORRG0DSSLQJ x 3UHSDUHD6WDJH)ORRG5LVN$VVHVVPHQWRI7XOORZLQSDUWLFXODULQUHODWLRQWRORFDWLRQ DQGW\SHRI]RQLQJDQGODQGXVHSURSRVDOV x 3UHSDUH D )ORRG 5LVN 0DQDJHPHQW 3ODQ LQ FRPSOLDQFH ZLWK 23:'R(+/* ± ³7KH 3ODQQLQJ 6\VWHP DQG )ORRG 5LVN 0DQDJHPHQW ±*XLGHOLQHV IRU 3ODQQLQJ $XWKRULWLHV 23:'R(+/* ´DQG&LUFXODU3/ $XJXVW x $GYLVHRQ]RQLQJVODQGXVHSURSRVDOVDVVHVVDQGUHSRUWRQDQ\VXEPLVVLRQVUHFHLYHG DVSDUWRIERWKWKHSUHSDUDWLRQDQGWKHSXEOLFFRQVXOWDWLRQVWDJHRIWKHSODQDVWKH\UHODWH WRIORRGULVN 1.2 Report Structure 7KLVVWXG\FRQVLGHUVWKHGHYHORSPHQWVWUDWHJ\WKDWZLOOIRUPSDUWRIWKH/RFDO$UHD3ODQIRU7XOORZ 7KH FRQWH[W RI IORRG ULVN LQ 7XOORZ DUH FRQVLGHUHG ZLWK VSHFLILF UHIHUHQFH WR WKH SULPDU\ IORRG VRXUFHIOXYLDOIORRGLQJDQGVHFRQGDU\VRXUFHVVXFKDVSOXYLDOJURXQGZDWHUVHZHUDQGDUWLILFLDO UHVHUYRLUV $WZRVWDJHDVVHVVPHQWRIIORRGULVNZDVXQGHUWDNHQDVUHFRPPHQGHGLQ 7KH3ODQQLQJ6\VWHP DQG)ORRG5LVN0DQDJHPHQW JXLGHOLQHVIRUWKHDUHDWKDWOLHVZLWKLQWKHGHYHORSPHQWERXQGDU\RI WKH/RFDO$UHD3ODQ7KHILUVWVWDJHLVWRLGHQWLI\IORRGULVNDQGLVEDVHGSULPDULO\RQWKHILQGLQJV RIWKH6RXWK(DVWHUQ&DWFKPHQW)ORRG5LVN$VVHVVPHQWDQG0DQDJHPHQW6WXG\ 6(&)5$0 +LVWRULFDOUHFRUGVDQGUHFHQWHYHQWVGHPRQVWUDWHWKDW7XOORZKDVDKLVWRU\RIIORRGLQJLQFHUWDLQ DUHDV7KHVHFRQGVWDJHDQGWKHPDLQSXUSRVHRIWKLV6)5$UHSRUWLVWRDSSUDLVHWKHDGHTXDF\ RIH[LVWLQJLQIRUPDWLRQWRSUHSDUHDQLQGLFDWLYHIORRG]RQHPDSEDVHGRQDYDLODEOHGDWDDQGWR KLJKOLJKWSRWHQWLDOGHYHORSPHQWDUHDVWKDWUHTXLUHPRUHGHWDLOHGDVVHVVPHQWRQDVLWHVSHFLILF OHYHO 6HFWLRQRIWKLVUHSRUWSURYLGHVDQLQWURGXFWLRQWRWKHVWXG\DUHDDQG6HFWLRQGLVFXVVHVWKH FRQFHSWVRIIORRGLQJ)ORRG=RQHVDQGIORRGULVNDVWKH\DUHLQFRUSRUDWHGLQWRWKH3ODQQLQJ6\VWHP DQG)ORRG5LVN0DQDJHPHQW ,Q6HFWLRQWKHDYDLODEOHGDWDUHODWHGWRIORRGLQJLVVXPPDULVHGDQGDSSUDLVHGDQGRXWOLQHVWKH VRXUFHVRIIORRGLQJWREHFRQVLGHUHGEDVHGRQWKHUHYLHZRIDYDLODEOHGDWD V7XOORZ6)5$YGRF[ )ROORZLQJWKLV6HFWLRQSURYLGHVJXLGDQFHDQGVXJJHVWHGDSSURDFKHVWRPDQDJLQJIORRGULVNWR GHYHORSPHQW WKHFRQWHQWVRIWKLVVHFWLRQZLOOEHRISDUWLFXODUXVHLQLQIRUPLQJWKHSROLFLHVDQG REMHFWLYHVZLWKLQWKH/RFDO$UHD3ODQ ,Q6HFWLRQWKHSURSRVHG]RQLQJVDUHUHYLHZHGZLWKVSHFLILFUHVSRQVHVWRIORRGULVNLQUHODWLRQWR DQXPEHURINH\GHYHORSPHQWVLWHVLQ7XOORZ )LQDOO\WULJJHUVIRUWKHRQJRLQJPRQLWRULQJDQGIXWXUHUHYLHZRIWKH6)5$DUHGHWDLOHGLQ6HFWLRQ V7XOORZ6)5$YGRF[ 2 Tullow Study Area 2.1 Introduction 7KHSODQDUHDFRPSULVHVRIWKHIXOOH[WHQWRIWKHWRZQRI7XOORZORFDWHGLQWKH6ODQH\&DWFKPHQW 2.2 Watercourses 7KH6ODQH\FDWFKPHQWFRYHUVDQDUHDRINPDQGWKHULYHULVNPLQOHQJWKULVLQJLQWKH /XJQDTXLOOD0RXQWDLQLQ:LFNORZDQGIORZLQJGRZQWKURXJK:LFNORZDQG&DUORZSDVVLQJWKURXJK PDMRUWRZQVVXFKDV%DOWLQJODVVDQGWKHDUHDRIVWXG\7XOORZEHIRUHIORZLQJWKURXJK:H[IRUG ZKHUHLWHQWHUVWKH,ULVK6HDLQ:H[IRUG7RZQZLWKWKH6ODQH\HVWXDU\IRUPLQJ:H[IRUG+DUERXU 7KH ULYHU LV IDVW IORZLQJ URFN\ DQG KDV RYHUJURZQ EDQNV LQ SDUWV DORQJ WKH VWUHWFK EHWZHHQ %DOWLQJODVV DQG7XOORZ )URP7XOORZ RQ WR %XQFORG\ WKH ULYHU IODWWHQV RXW PRUH WKH EDQNV DUH JHQHUDOO\ FOHDU DQGWKH ULYHU LV ZLGHU ZLWKDVWURQJIDVW FXUUHQW+RZHYHU WKHUHDUHDJUHDWHU QXPEHURIZHLUVDORQJWKLVVWUHWFKDQGVRPHVORZHUIORZLQJDUHDV $PDLQWULEXWDU\RIWKH5LYHU6ODQH\7KH5LYHU'HUUHHQDOVRIORZVWKURXJKWKHVWXG\DUHDDORQJ ZLWKWZRWULEXWDULHVRIWKHULYHU6ODQH\WKH7XOORZSKHOLPDQG0RXQW:ROVHOH\VWUHDPVDORQJZLWK WKH&RSSHQDJK6WUHDPDWULEXWDU\RIWKH5LYHU'HUUHHQ7KHULYHU'HUUHHQULVHVOLNHWKH5LYHU 6ODQH\LQWKH/XJQDTXLOOD0RXQWDLQLQ:LFNORZDQGMRLQVWKHULYHU6ODQH\VRXWKRI7XOORZ )LJXUH:DWHUFRXUVHVIORZLQJWKURXJK7XOORZ 2.3 Environment 7KH5LYHU6ODQH\WKURXJK7XOORZDQGRQHLWVWULEXWDULHVWKH5LYHU'HUUHHQKDYHEHHQGHVLJQDWHG DV6SHFLDO$UHDVRI&RQVHUYDWLRQ 6$& 6LWH6ODQH\5LYHU9DOOH\6$& 8QGHU $UWLFOH RI WKH (8 +DELWDWV 'LUHFWLYH DQ ³DSSURSULDWH DVVHVVPHQW´ $$ LV UHTXLUHG ZKHUHDQ\SODQRUSURMHFWHLWKHUDORQHRUµLQFRPELQDWLRQ¶ZLWKRWKHUSODQVRUSURMHFWVFRXOGKDYH DQDGYHUVHHIIHFWRQWKHLQWHJULW\RID1DWXUDVLWH V7XOORZ6)5$YGRF[ 7KHPDQDJHPHQWRIIORRGULVNZLWKLQVXFKDUHDVPXVWKDYHUHJDUGWRSRWHQWLDOQHJDWLYHLPSDFWV WRWKLVHQYLURQPHQW)XUWKHULQIRUPDWLRQLVSURYLGHGLQWKHIXOO6WUDWHJLF(QYLURQPHQWDO$VVHVVPHQW 6($ DQG$$IRUWKH&'3 2.4 Planning Policy 2.4.1 Carlow County Development Plan 7KHFXUUHQWSODQFRYHUVWKHSHULRG7KHSODQVHWVRXWFRPSOLDQFHZLWKQDWLRQDOVSDWLDO VWUDWHJ\DQGWKH:HVW5HJLRQDO3ODQQLQJ*XLGHOLQHVLQFOXGLQJ SROLFLHVIRUWKHSURWHFWLRQRIDUHDV DWULVNIURPIORRGLQJ 7KHIORRGPDQDJHPHQWSROLFLHVRI&DUORZ&RXQW\&RXQFLODVODLGRXWLQWKHGHYHORSPHQWSODQ LQFOXGH x &DUU\RXWIORRGULVNDVVHVVPHQWIRUWKHSXUSRVHRIUHJXODWLQJUHVWULFWLQJDQGFRQWUROOLQJ GHYHORSPHQWLQDUHDVDWULVNRIIORRGLQJDQGWRPLQLPLVHWKHOHYHORIIORRGULVNWRSHRSOH EXVLQHVVLQIUDVWUXFWXUHDQGWKHHQYLURQPHQWWKURXJKWKHLGHQWLILFDWLRQDQGPDQDJHPHQW RIH[LVWLQJDQGSRWHQWLDOIXWXUHIORRGULVN x /RZHUWLHUSODQVVKDOOXQGHUWDNH6WUDWHJLF)ORRG5LVN$VVHVVPHQWLQDFFRUGDQFHZLWKWKH UHTXLUHPHQWV RI WKH 3ODQQLQJ 6\VWHP DQG )ORRG 5LVN 0DQDJHPHQW*XLGHOLQHV IRU 3ODQQLQJ$XWKRULWLHV '(+/*DQG23: x $SSO\WKHVHTXHQWLDODSSURDFKZKLFKLVEDVHGRQWKHSULQFLSOHVRIDYRLGDQFHUHGXFWLRQ DQGPLWLJDWLRQRIIORRGULVNVZKHQSUHSDULQJWRZQGHYHORSPHQWSODQVDQGORFDODUHDSODQV DQGZKHQDVVHVVLQJSODQQLQJDSSOLFDWLRQVIRUGHYHORSPHQWSURSRVDOV x 5HTXLUHWKHXVHRI6XVWDLQDEOH8UEDQ'UDLQDJH6\VWHPV 6X'6 WRPLQLPLVHWKHH[WHQW RI KDUG VXUIDFLQJ DQG SDYLQJ DQG UHTXLUH WKH XVH RI VXVWDLQDEOH GUDLQDJH IRU QHZ GHYHORSPHQWRUH[WHQVLRQVWRH[LVWLQJGHYHORSPHQWV x (QVXUH WKDW DOO GHYHORSPHQW SURSRVDOV FRPSO\ ZLWK WKH UHTXLUHPHQWV RI WKH 3ODQQLQJ 6\VWHPDQG)ORRG5LVN0DQDJHPHQW*XLGHOLQHVIRU3ODQQLQJ$XWKRULWLHV¶ '(+/*DQG 23: DQG WR HQVXUH WKDW WKH -XVWLILFDWLRQ7HVW IRU 'HYHORSPHQW0DQDJHPHQWLV DSSOLHGWRUHTXLUHGGHYHORSPHQWSURSRVDOVDQGLQDFFRUGDQFHZLWKPHWKRGRORJ\VHWRXW LQWKHJXLGHOLQHV x 3UHVHUYHDSSURSULDWHO\VL]HGULSDULDQVWULSVDORQJVLGHULYHUFKDQQHOVIUHHRIGHYHORSPHQW DQGRIDGHTXDWHZLGWKWRSHUPLWDFFHVVIRUULYHUPDLQWHQDQFH x ,QWHJUDWHDVDSSURSULDWHWKHUHFRPPHQGDWLRQVRIDQ\UHOHYDQW&)5$06WXGLHV)ORRG5LVN 0DQDJHPHQW3ODQVIXWXUHIORRGKD]DUGPDSVRUIORRGULVNPDSV x (QVXUHWKDW ZKHUHIORRGSURWHFWLRQRUDOOHYLDWLRQ ZRUNVWDNHSODFHWKDW WKHQDWXUDODQG FXOWXUDOKHULWDJHDQGULYHUVVWUHDPVDQGZDWHUFRXUVHVDUHSURWHFWHGDQGHQKDQFHG6XFK ZRUNVZLOOEHVXEMHFWWR$SSURSULDWH$VVHVVPHQWDVUHTXLUHGXQGHU$UWLFOHRIWKH(8 +DELWDWV'LUHFWLYH x (QVXUHWKDWGHYHORSPHQWSURSRVDOVLQDUHDVDWPRGHUDWH )ORRG=RQH% RUKLJK )ORRG =RQH$ ULVNRIIORRGLQJZKLFKDUHFRQVLGHUHGDFFHSWDEOHLQSULQFLSOHGHPRQVWUDWHWKDW DSSURSULDWH PLWLJDWLRQ PHDVXUHV FDQ EH SXW LQ SODFH DQG WKDW UHVLGXDOULVNVFDQEH PDQDJHGWRDFFHSWDEOHOHYHOV x 6LWHVSHFLILF )ORRG 5LVN $VVHVVPHQW )5$ LV UHTXLUHG IRU DOO SODQQLQJ DSSOLFDWLRQV LQ DUHDVDWULVNRIIORRGLQJHYHQIRUGHYHORSPHQWVDSSURSULDWHWRWKHSDUWLFXODU)ORRG=RQH 7KH GHWDLO RI WKHVH VLWHVSHFLILF )5$V ZLOO GHSHQG RQ WKH OHYHORIULVNDQGVFDOHRI GHYHORSPHQW$GHWDLOHGVLWHVSHFLILF)5$VKRXOGTXDQWLI\WKHULVNVWKHHIIHFWVRIVHOHFWHG PLWLJDWLRQDQGWKHPDQDJHPHQWRIDQ\UHVLGXDOULVNV7KH&RXQFLOVKDOOKDYHUHJDUGWRWKH UHVXOWVRIDQ\&)5$06WXG\LQWKHDVVHVVPHQWRISODQQLQJDSSOLFDWLRQV x 6XSSRUWLQFRRSHUDWLRQZLWKWKH23:WKHLPSOHPHQWDWLRQRIWKH(8)ORRG5LVN'LUHFWLYH (& WKH )ORRG 5LVN 5HJXODWLRQV 6, 1R RI DQGWKH'(+/*23: SXEOLFDWLRQ7KH3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQW*XLGHOLQHV DQGDQ\ XSGDWHGVXSHUVHGLQJOHJLVODWLRQRUSROLF\JXLGDQFH &DUORZ&RXQW\&RXQFLOZLOODOVRWDNH DFFRXQWRIWKH6RXWK(DVWHUQ&DWFKPHQW)ORRG5LVN$VVHVVPHQWDQG0DQDJHPHQW6WXG\ x 3URWHFWZDWHUERGLHVDQGZDWHUFRXUVHVZLWKLQWKH&RXQW\IURPLQDSSURSULDWHGHYHORSPHQW LQFOXGLQJULYHUVVWUHDPVDVVRFLDWHGXQGHYHORSHGULSDULDQVWULSV ZHWODQGV DQG QDWXUDO IORRGSODLQV 7KLV ZLOO LQFOXGH SURWHFWLRQ EXIIHUV LQ ULYHULQH DQG ZHWODQG DUHDV DV V7XOORZ6)5$YGRF[ DSSURSULDWH)RU ODUJHU ULYHU FKDQQHOV RYHU P WKH UHFRPPHQGHG ZLGWK RI WKH FRUH ULSDULDQFRUH &=5 LVP PRQHDFKVLGHRIWKHULYHU DQGPD\EHODUJHUZKHUH IORRGSODLQVDGMRLQWKHULSDULDQ]RQH)RUVPDOOHUFKDQQHOV XQGHUP DFRUHULSDULDQ ]RQH &=5 RIPRUJUHDWHU PLQLPXPPRQHDFKVLGHRIWKHULYHU LVUHFRPPHQGHG ,QDGGLWLRQWKH6SHFLILF2EMHFWLYHIRU)ORRG5LVN0DQDJHPHQWUHTXLUHVDGHWDLOHGVLWHVSHFLILF)5$ IRULGHQWLILHGSRWHQWLDOIORRGULVNDUHDVWDNLQJLQWRFRQVLGHUDWLRQILQGLQJVRIWKH&)5$06WXG\ZKHQ FRPSOHWHG 7KHUHTXLUHPHQWIRUDGHWDLOHG)5$IRUHYHU\GHYHORSPHQWZLWKLQ)ORRG=RQHV$RU%KDVEHHQ UHYLHZHGDVSDUWRIWKLV6)5$DQGVSHFLILFVWDQGDUGVDQGJXLGDQFHDUHLQFOXGHGLQWKLVGRFXPHQW V7XOORZ6)5$YGRF[ 3 The Planning System and Flood Risk Management 3.1 Introduction 3ULRUWRGLVFXVVLQJWKHPDQDJHPHQWRIIORRGULVNLWLVKHOSIXOWRXQGHUVWDQGZKDWLVPHDQWE\WKH WHUP,WLVDOVRLPSRUWDQWWRGHILQHWKHFRPSRQHQWVRIIORRGULVNLQRUGHUWRDSSO\WKHSULQFLSOHVRI WKH3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQWLQDFRQVLVWHQWPDQQHU The Planning System and Flood Risk Management: Guidelines for Planning Authorities SXEOLVKHGLQ1RYHPEHU GHVFULEHIORRGLQJDVDQDWXUDOSURFHVVWKDWFDQRFFXUDWDQ\WLPH DQGLQDZLGHYDULHW\RIORFDWLRQV)ORRGLQJFDQRIWHQEHEHQHILFLDODQGPDQ\KDELWDWVUHO\RQ SHULRGLFLQXQGDWLRQ+RZHYHUZKHQIORRGLQJLQWHUDFWVZLWKKXPDQGHYHORSPHQWLWFDQWKUHDWHQ SHRSOHWKHLUSURSHUW\DQGWKHHQYLURQPHQW 7KLV6HFWLRQZLOOILUVWO\RXWOLQHWKHGHILQLWLRQVRIIORRGULVNDQGWKH)ORRG=RQHVXVHGDVDSODQQLQJ WRRO DGLVFXVVLRQRIWKHSULQFLSOHVRIWKHSODQQLQJJXLGHOLQHVDQGWKHPDQDJHPHQWRIIORRGULVNLQ WKHSODQQLQJV\VWHPZLOOIROORZ 3.2 Definition of Flood Risk )ORRGULVNLVJHQHUDOO\DFFHSWHGWREHDFRPELQDWLRQRIWKHOLNHOLKRRG RUSUREDELOLW\ RIIORRGLQJ DQGWKHSRWHQWLDOFRQVHTXHQFHVDULVLQJ)ORRGULVNFDQEHH[SUHVVHGLQWHUPVRIWKHIROORZLQJ UHODWLRQVKLS Flood Risk = Probability of Flooding x Consequences of Flooding 7KHDVVHVVPHQWRIIORRGULVNUHTXLUHVDQXQGHUVWDQGLQJRIWKHVRXUFHVWKHIORZSDWKRIIORRGZDWHU DQGWKHSHRSOHDQGSURSHUW\WKDWFDQEHDIIHFWHG7KHsource - pathway - receptor model, shown below in )LJXUH, LOOXVWUDWHVWKLVDQGLVDZLGHO\XVHGHQYLURQPHQWDOPRGHOWRDVVHVVDQGLQIRUP WKHPDQDJHPHQWRIULVN )LJXUH6RXUFH3DWKZD\5HFHSWRU0RGHO 6RXUFH )LJXUH$7KH3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQW*XLGHOLQHV7HFKQLFDO$SSHQGLFHV 3ULQFLSDOVRXUFHVRIIORRGLQJDUHUDLQIDOORUKLJKHUWKDQQRUPDOVHDOHYHOVZKLOHWKHPRVWFRPPRQ SDWKZD\V DUH ULYHUV GUDLQV VHZHUV RYHUODQG IORZ DQG ULYHU DQG FRDVWDO IORRGSODLQV DQG WKHLU GHIHQFHDVVHWV 5HFHSWRUV FDQ LQFOXGH SHRSOHWKHLU SURSHUW\ DQG WKH HQYLURQPHQW $OO WKUHH HOHPHQWVPXVWEHSUHVHQWIRUIORRGULVNWRDULVH0LWLJDWLRQPHDVXUHVVXFKDVGHIHQFHVRUIORRG UHVLOLHQWFRQVWUXFWLRQKDYHOLWWOHRUQRHIIHFWRQVRXUFHVRIIORRGLQJEXWWKH\FDQEORFNRULPSHGH SDWKZD\VRUUHPRYHUHFHSWRUV 7KH SODQQLQJ SURFHVV LV SULPDULO\ FRQFHUQHG ZLWK WKH ORFDWLRQ RI UHFHSWRUV WDNLQJ DSSURSULDWH DFFRXQWRISRWHQWLDOVRXUFHVDQGSDWKZD\VWKDWPLJKWSXWWKRVHUHFHSWRUVDWULVN V7XOORZ6)5$YGRF[ 3.2.1 Likelihood of Flooding /LNHOLKRRGRUSUREDELOLW\RIIORRGLQJRUDSDUWLFXODUIORRGHYHQWLVFODVVLILHGE\LWVDQQXDOH[FHHGDQFH SUREDELOLW\ $(3 RUUHWXUQSHULRG LQ\HDUV $$(3IORRGLQGLFDWHVWKHIORRGHYHQWWKDWZLOO RFFXURUEHH[FHHGHGRQDYHUDJHRQFHHYHU\\HDUVDQGKDVDLQFKDQFHRIRFFXUULQJ LQDQ\JLYHQ\HDU 5HWXUQSHULRGLVRIWHQPLVXQGHUVWRRGWREHWKHSHULRGEHWZHHQODUJHIORRGHYHQWVUDWKHUWKDQDQ DYHUDJH UHFXUUHQFH LQWHUYDO $QQXDO H[FHHGDQFH SUREDELOLW\ LV WKHLQYHUVHRI UHWXUQSHULRG DV VKRZQLQ7DEOH 7DEOH3UREDELOLW\RI)ORRGLQJ 5HWXUQ3HULRG &RQVLGHUHG RYHU WKH OLIHWLPH RI GHYHORSPHQW DQ DSSDUHQWO\ ORZIUHTXHQF\ RU UDUH IORRG KDV D VLJQLILFDQWSUREDELOLW\RIRFFXUULQJ)RUH[DPSOH x $IORRGKDVD LQ FKDQFHRIRFFXUULQJDWOHDVWRQFHLQD\HDUSHULRGWKH SHULRGRIDW\SLFDOUHVLGHQWLDOPRUWJDJH x $QGD LQ FKDQFHRIRFFXUULQJLQD\HDUSHULRGDW\SLFDOKXPDQOLIHWLPH 3.2.2 Consequences of Flooding &RQVHTXHQFHVRIIORRGLQJGHSHQGRQWKHKD]DUGVFDXVHGE\IORRGLQJ GHSWKRIZDWHUVSHHGRI IORZUDWHRIRQVHWGXUDWLRQZDYHDFWLRQHIIHFWVZDWHUTXDOLW\ DQGWKHYXOQHUDELOLW\RIUHFHSWRUV W\SH RI GHYHORSPHQW QDWXUH HJ DJHVWUXFWXUH RI WKH SRSXODWLRQ SUHVHQFH DQG UHOLDELOLW\ RI PLWLJDWLRQPHDVXUHVHWF 7KH 3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQW SURYLGHVWKUHHYXOQHUDELOLW\FDWHJRULHVEDVHG RQWKHW\SHRIGHYHORSPHQWZKLFKDUHGHWDLOHGLQ7DEOHRIWKH*XLGHOLQHVDQGDUHVXPPDULVHG DV x Highly vulnerable LQFOXGLQJ UHVLGHQWLDO SURSHUWLHV HVVHQWLDO LQIUDVWUXFWXUH DQG HPHUJHQF\VHUYLFHIDFLOLWLHV x Less vulnerableVXFKDVUHWDLODQGFRPPHUFLDODQGORFDOWUDQVSRUWLQIUDVWUXFWXUH x Water compatibleLQFOXGLQJ RSHQVSDFHRXWGRRUUHFUHDWLRQDQGDVVRFLDWHGHVVHQWLDO LQIUDVWUXFWXUHVXFKDVFKDQJLQJURRPV 3.3 Definition of Flood Zones ,Q WKH 3ODQQLQJ 6\VWHP DQG )ORRG 5LVN 0DQDJHPHQW )ORRG =RQHV DUH XVHG WR LQGLFDWH WKH OLNHOLKRRGRIDIORRGRFFXUULQJ7KHVH=RQHVLQGLFDWHDKLJKPRGHUDWHRUORZULVNRIIORRGLQJIURP IOXYLDORUWLGDOVRXUFHVDQGDUHGHILQHGEHORZLQ7DEOH ,WLVLPSRUWDQWWRQRWHWKDWWKHGHILQLWLRQRIWKH)ORRG=RQHVLVEDVHGRQDQundefended scenario DQGGRHVQRWWDNHLQWRDFFRXQWWKHSUHVHQFHRIIORRGSURWHFWLRQVWUXFWXUHVVXFKDVIORRGZDOOVRU HPEDQNPHQWV 7KLV LV WR DOORZ IRU WKHIDFW WKDWWKHUHLV DUHVLGXDO ULVN RIIORRGLQJ EHKLQG WKH GHIHQFHVGXHWRRYHUWRSSLQJRUEUHDFKDQGWKDWWKHUHPD\EHQRJXDUDQWHHWKDWWKHGHIHQFHVZLOO EHPDLQWDLQHGLQSHUSHWXLW\ ,WLVDOVRLPSRUWDQWWRQRWHWKDWWKH)ORRG=RQHVLQGLFDWHIORRGLQJIURPIOXYLDODQGWLGDOVRXUFHVDQG GRQRWWDNHRWKHUVRXUFHVVXFKDVJURXQGZDWHURUSOXYLDOLQWRDFFRXQWVRDQDVVHVVPHQWRIULVN DULVLQJIURPVXFKVRXUFHVVKRXOGDOVREHPDGH V7XOORZ6)5$YGRF[ 7DEOH'HILQLWLRQRI)ORRG=RQHV Zone Description 7KLV]RQHGHILQHVDUHDVZLWKWKHKLJKHVWULVNRIIORRGLQJIURP Zone A ULYHUV LHPRUHWKDQSUREDELOLW\RUPRUHWKDQLQ +LJKSUREDELOLW\RIIORRGLQJ DQGWKHFRDVW LHPRUHWKDQSUREDELOLW\RUPRUHWKDQ LQ 7KLV]RQHGHILQHVDUHDVZLWKDPRGHUDWHULVNRIIORRGLQJIURP Zone B ULYHUV LHWRSUREDELOLW\RUEHWZHHQLQDQG 0RGHUDWHSUREDELOLW\RI LQ DQGWKHFRDVW LHWRSUREDELOLW\RU IORRGLQJ EHWZHHQLQDQGLQ 7KLV]RQHGHILQHVDUHDVZLWKDORZULVNRIIORRGLQJIURPULYHUV Zone C DQGWKHFRDVW LHOHVVWKDQSUREDELOLW\RUOHVVWKDQLQ /RZSUREDELOLW\RIIORRGLQJ 3.4 Objectives and Principles of the Planning Guidelines 7KH 3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQW GHVFULEHVJRRGIORRGULVNSUDFWLFHLQSODQQLQJ DQGGHYHORSPHQWPDQDJHPHQW3ODQQLQJDXWKRULWLHVDUHGLUHFWHGWRKDYHUHJDUGWRWKHJXLGHOLQHV LQ WKH SUHSDUDWLRQ RI 'HYHORSPHQW 3ODQV DQG /RFDO $UHD 3ODQV DQG IRU GHYHORSPHQW FRQWURO SXUSRVHV 7KH REMHFWLYH RI WKH 3ODQQLQJ 6\VWHP DQG )ORRG 5LVN 0DQDJHPHQW LV WR LQWHJUDWH IORRG ULVN PDQDJHPHQW LQWR WKH SODQQLQJ SURFHVV WKHUHE\ DVVLVWLQJ LQ WKH GHOLYHU\ RI VXVWDLQDEOH GHYHORSPHQW)RUWKLVWREHDFKLHYHGIORRGULVNPXVWEHDVVHVVHGDVHDUO\DVSRVVLEOHLQWKH SODQQLQJSURFHVV3DUDJUDSKRIWKH*XLGHOLQHVVWDWHVWKDWWKHFRUHREMHFWLYHVDUHWR xavoid inappropriate development in areas at risk of flooding; x avoid new developments increasing flood risk elsewhere, including that which may arise from surface run-off; x ensure effective management of residual risks for development permitted in floodplains; x avoid unnecessary restriction of national, regional or local economic and social growth; x improve the understanding of flood risk among relevant stakeholders; and x ensure that the requirements of EU and national law in relation to the natural environment and nature conservation are complied with at all stages of flood risk management". 7KH JXLGHOLQHV DLP WR IDFLOLWDWH the transparent consideration of flood risk at all levels of the planning process, ensuring a consistency of approach throughout the country.¶6)5$VWKHUHIRUH EHFRPHDNH\HYLGHQFHEDVHLQPHHWLQJWKHVHREMHFWLYHV 7KH 3ODQQLQJ 6\VWHP DQG )ORRG 5LVN 0DQDJHPHQW ZRUNV RQ D QXPEHU RI NH\ SULQFLSOHV LQFOXGLQJ x $GRSWLQJDVWDJHGDQGKLHUDUFKLFDODSSURDFKWRWKHDVVHVVPHQWRIIORRGULVN x $GRSWLQJDVHTXHQWLDODSSURDFKWRWKHPDQDJHPHQWRIIORRGULVNEDVHGRQWKHIUHTXHQF\ RIIORRGLQJ LGHQWLILHGWKURXJK)ORRG=RQHV DQGWKHYXOQHUDELOLW\RIWKHSURSRVHGODQGXVH V7XOORZ6)5$YGRF[ 3.5 The Sequential Approach and Justification Test (DFKVWDJHRIWKH)5$SURFHVVDLPVWRDGRSWDVHTXHQWLDODSSURDFKWRPDQDJHPHQWRIIORRGULVN LQWKHSODQQLQJSURFHVV :KHUHSRVVLEOHGHYHORSPHQWLQDUHDVLGHQWLILHGDVEHLQJDWIORRGULVNVKRXOGEHDYRLGHG WKLVPD\ QHFHVVLWDWHGH]RQLQJODQGVZLWKLQWKHSODQERXQGDU\,IGH]RQLQJLVQRWSRVVLEOHWKHQUH]RQLQJ IURPDKLJKHUYXOQHUDELOLW\ODQGXVHVXFKDVUHVLGHQWLDOWRDOHVVYXOQHUDEOHXVHVXFKDVRSHQ VSDFHPD\EHUHTXLUHG )LJXUH6HTXHQWLDO$SSURDFK3ULQFLSOHVLQ)ORRG5LVN0DQDJHPHQW 6RXUFH 7KH3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQW )LJXUH :KHUH UH]RQLQJ LV QRW SRVVLEOH H[FHSWLRQV WR WKH GHYHORSPHQW UHVWULFWLRQV DUH SURYLGHG IRU WKURXJKWKH-XVWLILFDWLRQ7HVW0DQ\WRZQVDQGFLWLHVKDYHFHQWUDODUHDVWKDWDUHDIIHFWHGE\IORRG ULVNDQGKDYHEHHQWDUJHWHGIRUJURZWK7RDOORZWKHVXVWDLQDEOHDQGFRPSDFWGHYHORSPHQWRI WKHVH XUEDQ FHQWUHV GHYHORSPHQW LQ DUHDV RI IORRG ULVN PD\ EH FRQVLGHUHG QHFHVVDU\ )RU GHYHORSPHQWLQVXFKDUHDVWREHDOORZHGWKH-XVWLILFDWLRQ7HVWPXVWEHSDVVHG 7KH-XVWLILFDWLRQ7HVWKDVEHHQGHVLJQHGWRULJRURXVO\DVVHVWKHDSSURSULDWHQHVVRURWKHUZLVH RIVXFKGHYHORSPHQWV7KHWHVWLVFRPSULVHGRIWZRSURFHVVHV WKH3ODQPDNLQJ-XVWLILFDWLRQ7HVW DQGWKH'HYHORSPHQW0DQDJHPHQW-XVWLILFDWLRQ7HVW7KHODWWHULVXVHGDWWKHSODQQLQJDSSOLFDWLRQ VWDJHZKHUHLWLVLQWHQGHGWRGHYHORSODQGWKDWLVDWPRGHUDWHRUKLJKULVNRIIORRGLQJIRUXVHVRU GHYHORSPHQWYXOQHUDEOHWRIORRGLQJWKDWZRXOGJHQHUDOO\EHFRQVLGHUHGLQDSSURSULDWHIRUWKDWODQG 7DEOHVKRZVZKLFKW\SHVRIGHYHORSPHQWEDVHGRQYXOQHUDELOLW\WRIORRGULVNDUHDSSURSULDWH ODQGXVHVIRUHDFKRIWKH)ORRG=RQHV7KHDLPRIWKH6)5$LVWRJXLGHGHYHORSPHQW]RQLQJVWR WKRVHZKLFKDUH DSSURSULDWH DQGWKHUHE\DYRLGWKHQHHGWRDSSO\WKH-XVWLILFDWLRQ7HVW 7DEOH0DWUL[RI9XOQHUDELOLW\YHUVXV)ORRG=RQH Flood Zone A Flood Zone B Flood Zone C +LJKO\YXOQHUDEOHGHYHORSPHQW -XVWLILFDWLRQ -XVWLILFDWLRQ $SSURSULDWH ,QFOXGLQJHVVHQWLDOLQIUDVWUXFWXUH 7HVW 7HVW /HVVYXOQHUDEOHGHYHORSPHQW -XVWLILFDWLRQ $SSURSULDWH $SSURSULDWH 7HVW :DWHUFRPSDWLEOHGHYHORSPHQW $SSURSULDWH $SSURSULDWH $SSURSULDWH 6RXUFH 7DEOHRI7KH3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQW V7XOORZ6)5$YGRF[ 3.6 Scales and Stages of Flood Risk Assessment :LWKLQ WKH KLHUDUFK\ RI UHJLRQDO VWUDWHJLF DQG VLWHVSHFLILF IORRGULVN DVVHVVPHQWV D WLHUHG DSSURDFKHQVXUHVWKDWWKHOHYHORILQIRUPDWLRQLVDSSURSULDWHWRWKHVFDOHDQGQDWXUHRIWKHIORRG ULVNLVVXHVDQGWKHORFDWLRQDQGW\SHRIGHYHORSPHQWSURSRVHGDYRLGLQJH[SHQVLYHIORRGPRGHOOLQJ DQGGHYHORSPHQWRIPLWLJDWLRQPHDVXUHVZKHUHLWLVQRWQHFHVVDU\7KHVWDJHVDQGVFDOHVRIIORRG ULVNDVVHVVPHQWFRPSULVH x Regional Flood Risk Appraisal (RFRA)±DEURDGRYHUYLHZRIIORRGULVNLVVXHVDFURVVD UHJLRQWRLQIOXHQFHVSDWLDODOORFDWLRQVIRUJURZWKLQKRXVLQJDQGHPSOR\PHQWDVZHOODVWR LGHQWLI\ZKHUHIORRGULVNPDQDJHPHQWPHDVXUHVPD\EHUHTXLUHGDWDUHJLRQDOOHYHOWR VXSSRUWWKHSURSRVHGJURZWK7KLVVKRXOGEHEDVHGRQUHDGLO\GHULYDEOHLQIRUPDWLRQDQG XQGHUWDNHQWRLQIRUPWKH5HJLRQDO3ODQQLQJ*XLGHOLQHV x Strategic Flood Risk Assessment (SFRA) ±DQ DVVHVVPHQWRIDOOW\SHVRIIORRGULVN LQIRUPLQJODQGXVHSODQQLQJGHFLVLRQV7KLVZLOOHQDEOHWKH3ODQQLQJ$XWKRULW\WRDOORFDWH DSSURSULDWHVLWHVIRUGHYHORSPHQWZKLOVWLGHQWLI\LQJRSSRUWXQLWLHVIRUUHGXFLQJIORRGULVN 7KLV6)5$ZLOOUHYLVLWDQGGHYHORSWKHIORRGULVNLGHQWLILFDWLRQXQGHUWDNHQLQWKH5)5$ DQGJLYHFRQVLGHUDWLRQWRDUDQJHRISRWHQWLDOVRXUFHVRIIORRGLQJ $Q LQLWLDOIORRGULVN DVVHVVPHQWEDVHGRQWKHLGHQWLILFDWLRQRI)ORRG=RQHVZLOODOVREHFDUULHGRXWIRUWKRVH DUHDV ZKLFK ZLOO EH ]RQHG IRU GHYHORSPHQW :KHUH WKH LQLWLDO IORRG ULVN DVVHVVPHQW KLJKOLJKWV WKH SRWHQWLDO IRU D VLJQLILFDQW OHYHO RI IORRG ULVN RU WKHUH LV FRQIOLFW ZLWK WKH SURSRVHG YXOQHUDELOLW\ RI GHYHORSPHQW WKHQ D VLWH VSHFLILF )5$ ZLOO EH UHFRPPHQGHG ZKLFKZLOOQHFHVVLWDWHDGHWDLOHGIORRGULVNDVVHVVPHQW x Site Specific Flood Risk Assessment (FRA) ± VLWH RU SURMHFW VSHFLILF IORRG ULVN DVVHVVPHQW WR FRQVLGHU DOO W\SHV RI IORRG ULVN DVVRFLDWHG ZLWK WKH VLWH DQG SURSRVH DSSURSULDWHVLWHPDQDJHPHQWDQGPLWLJDWLRQPHDVXUHVWRUHGXFHIORRGULVNWRDQGIURP WKHVLWHWRDQDFFHSWDEOHOHYHO,IWKHSUHYLRXVWLHUVRIVWXG\KDYHEHHQXQGHUWDNHQWR DSSURSULDWHOHYHOVRIGHWDLOLWLVKLJKO\OLNHO\WKDWWKHVLWHVSHFLILF)5$ZLOOUHTXLUHGHWDLOHG FKDQQHODQGVLWHVXUYH\DQGK\GUDXOLFPRGHOOLQJ V7XOORZ6)5$YGRF[ 4 Data Collection 4.1 Overview 7KHUHDUHDQXPEHURIVRXUFHVRIIORRGGDWDDYDLODEOHIRUWKH7XOORZDUHD7KHIROORZLQJWDEOHOLVWV WKHFRUH GDWDVHWVXVHGWRFRPSLOHWKHIORRGPDSIRUWKH7XOORZ/RFDO $UHD 3ODQDQGJLYHVDQ DVVHVVPHQWRIWKHGDWDTXDOLW\DQGWKHFRQILGHQFHLQLWVDFFXUDF\6RXWKHDVWHUQ 7DEOH)ORRG'DWD8VHGWR&RPSLOH)ORRG=RQH0DSSLQJ Description Coverage Robustness Comment on usefulness 6RXWK(DVWHUQ &RYHUVWKH5LYHUV +LJK 'HWDLOHG''&)5$0 &)5$0'UDIW 6ODQH\ 'HUUHHQDV $)$VWDWXV +3:PRGHODQGLVXVHIXO )ORRG0DSSLQJ ZHOODV7XOORZSKHOLP 6LWHYHULILHGE\ZDONRYHUDQG 0RXQW:ROVHOH\ FRQVXOWDWLRQZLWK/RFDO &RSSHQDJKVWUHDPV $XWKRULW\ 23:3)5$IORRG &RYHUVDOO 0RGHUDWH &)5$0PDSSLQJ H[WHQWPDSVDV ZDWHUFRXUVHV VXSHUVHGHVDOO3)5$ YHULILHGE\&)5$0 PDSSLQJ+DVEHHQXVHGIRU )55 VHQVLELOLW\FKHFNLQJRQO\ +LVWRULFDO)ORRG 6SRWFRYHUDJHRI 0RGHUDWH +LJKO\XVHIXORYHUVLJKWRI 5HFRUGVDQG ZKROH/$3 $UHD KLVWRULFIORRGLQJLVVXHV &RQVXOWDWLRQZLWK (QJLQHHUVSHFLILF SURYLGHGE\/RFDO$XWKRULW\ $UHD(QJLQHHU LQSXW :DONRYHU6XUYH\ &RYHUVDOOVLJQLILFDQW 0RGHUDWH :DONRYHUXVHGWRYDOLGDWH ZDWHUFRXUVHV RXWOLQHVHVWLPDWHQHZ RXWOLQHVDQGIORZSDWKVDW NH\ORFDWLRQV(VVHQWLDO SURFHVVLQWKH)ORRG=RQH SURFHVV 7KH)ORRG=RQHPDSSLQJUHSUHVHQWVDFRPELQDWLRQRIWKHDERYHIORRGVRXUFHV7KHGUDIW6RXWK (DVWHUQ&)5$0PDSSLQJKDVIRUPHGWKHFRUHVRXUFHRIWKHILQDO)ORRG=RQHVIRUDOOZDWHUFRXUVHV DVWKH\KDYHDOOEHHQVXEMHFWWRGHWDLOHGDQDO\VLVXQGHUWKLVSURMHFW$OOIORRGPDSSLQJKDVEHHQ VLWHYHULILHGE\ZDONRYHUDQGFRQVXOWDWLRQZLWKWKH/RFDO$XWKRULW\$UHD(QJLQHHU7KHUHKDVDOVR EHHQDWKRURXJKUHYLHZRIKLVWRULFIORRGUHFRUGV7KHUHVXOWLV)ORRG=RQHPDSSLQJWKDWSUHVHQWV WKHEHVWDYDLODEOHGDWDIRUWKHVWXG\DUHD )LJXUHRYHUWKHSDJHSUHVHQWVDQRYHUYLHZRIWKH)ORRG=RQHVDQGZDWHUFRXUVHV(DFKRIWKH VRXUFHVRIIORRGLQIRUPDWLRQLVGLVFXVVHGLQPRUHGHWDLOEHORZ V7XOORZ6)5$YGRF[ )LJXUH)ORRG=RQHPDSSLQJZLWKZDWHUFRXUVHDQQRWDWLRQ 4.2 National PFRA Study Fluvial Flood Outlines 7KH 3UHOLPLQDU\ )ORRG 5LVN $VVHVVPHQW 3)5$ LV D QDWLRQDO VFUHHQLQJ H[HUFLVH WKDW ZDV XQGHUWDNHQE\WKH23:WRLGHQWLI\DUHDVDWSRWHQWLDOIORRGULVN7KH3)5$ZDVDUHTXLUHPHQWRI WKH(8)ORRGV'LUHFWLYHDQGWKHSXEOLFDWLRQRIWKLVZRUNLQIRUPHGWKHPRUHGHWDLOHGDVVHVVPHQW WKDW LV EHLQJ XQGHUWDNHQ DV SDUW RI WKH &DWFKPHQW )ORRG 5LVN $VVHVVPHQW DQG 0DQDJHPHQW &)5$0 VWXGLHV7KH3)5$VWXG\FRQVLGHUHGIORRGLQJIURPDQXPEHURIVRXUFHV IOXYLDOWLGDO SOXYLDODQGJURXQGZDWHUDQGUHVXOWHGLQSURGXFWLRQRIDVXLWHRIEURDGVFDOHIORRGPDSV )RUWKHSUHSDUDWLRQRIWKH3)5$IOXYLDOIORRGPDSVIORRGIORZHVWLPDWHVZHUHFDOFXODWHGDWQRGHV HYHU\PDORQJWKHHQWLUHULYHUQHWZRUN 7KHULYHUQHWZRUNLVWKH(3$ EOXHOLQH QHWZRUNZKLFK IRUWKHPRVWSDUWPDWFKHVWKHULYHUVPDSSHGDWWKH VFDOH'LVFRYHU\6HULHV26PDSSLQJ 7KLV IORZ HVWLPDWLRQ ZDV EDVHG RQ WKH 23: )ORRG 6WXGLHV 8SGDWH UHVHDUFKSURJUDPPH $Q DVVXPSWLRQZDVPDGHWKDWWKHLQFKDQQHOIORZHTXDWHVWRWKHPHDQDQQXDOIORRGDQGVRWKHRXW RIEDQNIORZIRUDSDUWLFXODU$(3HYHQWZDVGHWHUPLQHGE\GHGXFWLQJWKHPHDQDQQXDOIORRGIURP WKHIORRGIORZHVWLPDWHIRUWKDWSUREDELOLW\HYHQW 8VLQJDPQDWLRQDOGLJLWDOWHUUDLQPRGHO '70 DFURVVVHFWLRQZDVGHWHUPLQHGDWPVSDFLQJV 7KH0DQQLQJ VHTXDWLRQDK\GUDXOLFHTXDWLRQIRUQRUPDOIORZZDVXVHGWRFDOFXODWHDIORRGOHYHO ZKLFKZDVWKHQH[WUDSRODWHGDFURVVWKH'70WRGHWHUPLQHWKHIORRGH[WHQW7KLVH[HUFLVHZDV FRPSOHWHGE\WKH23:IRUDOOULYHUFDWFKPHQWVJUHDWHUWKDQNP 7KLV PHWKRGRORJ\ GLG QRW WDNH LQWR DFFRXQW GHIHQFHV FKDQQHO VWUXFWXUHV RU FKDQQHO ZRUNV 3RWHQWLDO VRXUFHV RI HUURU LQ WKH PDSSLQJ LQFOXGH ORFDO HUURUV LQWKH'70RUFKDQJHVWRWKH ZDWHUFRXUVHIORZURXWHGXHWRDQHUURULQPDSSLQJRUQHZGHYHORSPHQW,Q0XLQHEKHDJDQG5R\DO 2DNWKH3)5$PDSSLQJFRYHUVWKH5LYHU%DUURZ DOWKRXJKWKLVKDVEHHQVXSHUVHGHGE\&)5$0 GDWD DQGDQXPEHURIXQQDPHGWULEXWDULHVGUDLQLQJLQWRLW V7XOORZ6)5$YGRF[ 4.3 National CFRAM Programme )ROORZLQJRQIURPWKH3)5$VWXG\WKH23:FRPPHQFHGDSSRLQWPHQWRIFRQVXOWDQWVWRFDUU\RXW DPRUHGHWDLOHGIORRGULVNDVVHVVPHQWIRUNH\IORRGULVNDUHDV7KLVZRUNLVEHLQJXQGHUWDNHQ XQGHUWKHQDWLRQDO&)5$0SURJUDPPHDFURVVVHYHQULYHUEDVLQGLVWULFWVLQ,UHODQG7KH&)5$0 SURJUDPPHFRPPHQFHGZLWKWKUHHSLORWVWXGLHVFRYHULQJWKH5LYHU/HH)LQJDO(DVW0HDWKDUHD DQGWKH5LYHU'RGGHU$IXUWKHUVWXGLHVDUHFXUUHQWO\XQGHUZD\LQWKH(DVW6RXWK(DVW6RXWK :HVW:HVW1RUWK:HVWDQG1HDJK%DQQUHJLRQV 7XOORZIDOOVZLWKLQWKH6RXWK(DVWHUQ&)5$06WXG\DUHD7KHLQLWLDO)ORRG5LVN5HYLHZ )55 VWDJHRIWKH6RXWK(DVWHUQ&)5$0KDVEHHQFRPSOHWHGDQGWKLVLQFOXGHGDVLWHEDVHGUHYLHZRI WKH 3)5$ IORRG RXWOLQHV IRU WKH DUHD ZKLFK SURYLGHG IHHGEDFN RQ IORRG ULVN DQG SRWHQWLDO IRU LQFOXVLRQDVDGHWDLOHG$UHDRI)XUWKHU$VVHVVPHQW 7KHDUHDZDVGHVLJQDWHGDVDSUREDEOH$)$ $UHDIRU)XUWKHU$VVHVVPHQW 7KHDUHDZDVVXEMHFW WRWKHIXOODQDO\VLVXQGHUWKH6RXWK(DVWHUQ&)5$07KLVLQFOXGHGDGHWDLOHG''K\GUDXOLF PRGHOWKHPRGHOUHSUHVHQWVWKH7XOORZ$)$DQGHQFRPSDVVHVWKH5LYHU6ODQH\XSVWUHDPDQG GRZQVWUHDPRILWVH[WHQWSOXVDVVRFLDWHGWULEXWDULHV7KUHHWULEXWDULHVDUHLQFOXGHGLQWKHPRGHO WKHVH DUH WKH 'HUUHHQ 5LYHU DQG RQH RI LWV WULEXWDULHV WKH &RSSHQDJK VWUHDP WKH XUEDQ 7XOORZSKHOLPDQG0RXQW:ROVHOH\VWUHDPVWKDWIORZWKURXJKWKHVWXG\DUHD7KH&)5$0PDSSLQJ UHSUHVHQWVDVLJQLILFDQWLPSURYHPHQWFRPSDUHGWRWKHDFFXUDF\SURYLGHGE\WKH3)5$PDSSLQJ DQGWKH&)5$0PDSSLQJKDVEHHQYHULILHGE\DVLWHZDONRYHUDQGFRQVXOWDWLRQZLWKWKH/RFDO $XWKRULW\ $3XEOLF&RQVXOWDWLRQRQWKHSUHOLPLQDU\RSWLRQVIRUIORRGULVNPDQDJHPHQWZLWKLQWKH7XOORZ$)$ ZDVKHOGLQ7XOORZRQ WK0DUFK7KHFRQVXOWDWLRQFRQILUPHGWKDWWKHUHDUH SURSHUWLHV FXUUHQWO\GHIHQGHGE\WKH7XOORZSKHOLP)ORRG5HOLHI6FKHPH )56 7KHGUDIWUHFRPPHQGDWLRQ IRUWKH7XOORZ$)$LVWKDWIORRGULVNFRQWLQXHVWREHPDQDJHGE\WKH)56DQGWKDWDIXUWKHUVLQJOH KRXVHFDQSRWHQWLDOO\EHGHIHQGHGXQGHUDPLQRUZRUNVSURSRVDO)XUWKHUGHWDLOVRQWKH)56LV SURYLGHGLQWKHQH[WVHFWLRQ 4.4 Tullowphelim Flood Relief Scheme (FRS) 7KH7XOORZ)56ZDVFRPSOHWHGLQDQGKDVDVWDQGDUGRISURWHFWLRQXSWRD$(3IORRG HYHQW,WLQFOXGHVDVHULHVRIZDOOVHPEDQNPHQWVDQGVL[GHPRXQWDEOHIORRGEDUULHUV,QDGGLWLRQ WKHFKDQQHORIWKH5LYHU6ODQH\KDVEHHQZLGHQHGGRZQVWUHDPRIWKHEULGJHDVFKHPDWLFRIWKH )56LVLQFOXGHGLQ)LJXUHEHORZ $VLQGLFDWHGDERYHWKHVFKHPHUHOLHVRQGHPRXQWDEOHEDUULHUVZKLFKDUHSXWLQSODFHE\&DUORZ &RXQW\&RXQFLODOOVL[EDUULHUVDUHORFDWHGRQWKHZHVWHUQEDQNRIWKH6ODQH\ZLWKWKUHHXSVWUHDP DQGWKUHHGRZQVWUHDPRIWKHWRZQEULGJH3XPSVDUHWKHQLQVWDOOHGWRPDQDJHVXUIDFHZDWHU OHYHOVEHKLQGWKHGHIHQFHV $WHOHPHWU\V\VWHPPRQLWRUVULYHU OHYHOLQIRUPDWLRQIURP5DWKYLOO\ NPXSVWUHDPRQWKH6ODQH\ DQGDOVRZLWKLQ7XOORZLWVHOI$VHULHVRIRSHUDWLRQDOUXOHVGLFWDWH ZKHQWKHGHIHQFHVDUHPDQXDOO\LQVWDOOHGDQGWKHPRQLWRULQJHTXLSPHQWVHQGVRXWDXWRPDWHGWH[W PHVVDJHVWRNH\RSHUDWLRQDOVWDII0HW(LUHDQQUDLQIDOOZDUQLQJVDUHDOVRPRQLWRUHGDQGXVHGWR LQIRUPSUHFDXWLRQDU\LQVWDOODWLRQRIWKHEDUULHUV7KHXSVWUHDPFDWFKPHQWUHVXOWVLQDUHODWLYHO\ UDSLGULVHLQIORRGOHYHOVDQGOHDGLQWLPHVIRUWKHLQVWDOODWLRQRIWKHEDUULHUVDUHWKHUHIRUHVKRUW FLUFDKRXUV 6RXWK(DVWHUQ&)5$06WXG\+$+\GUDXOLFV5HSRUW7XOORZ 7XOORZSKHOLP 0RGHO$XJXVW V7XOORZ6)5$YGRF[ )LJXUH7XOORZ)56/D\RXW (PEDQNPHQWV JUHHQ DQG:DOOV SLQN 6RXUFH 23:(&)5$07XOORZB7XOORZSKHOLP+\GUDXOLFV5HSRUW 7KHUHLVDUHVLGXDOULVNDVVRFLDWHGZLWKIDLOXUHRIWKHVHGHIHQFHVGXHWRRYHUWRSSLQJRUEUHDFKRU IDLOXUHWRHUHFWVHFWLRQVRIWKHGHIHQFHV7KHIDLOXUHWRHUHFWWKHUHPRYDEOHEDUULHUVLVSHUKDSVWKH PRVWVLJQLILFDQWULVNIDFLQJWKHWRZQFHQWUHDUHDJLYHQWKHVKRUWOHDGLQWLPH DQGUHOLDQFHRQD WHOHPHWHUHGULYHUOHYHOPRQLWRULQJV\VWHP 7KH6RXWK(DVWHUQ&)5$0SURYLGHVDXVHIXOUHYLHZRIWKHRSHUDWLRQRIWKH)56DQGZLWKLQWKH GUDIWK\GUDXOLFVUHSRUWLWFRQILUPVWKDWWKHV\VWHPLVHIIHFWLYHWRWKH$(3ZLWKWKHH[FHSWLRQRI DQRYHUVSLOOSRLQWORFDWHGRQWKHZHVWHUQVLGHRIWKHWRZQEULGJHZKLFKVSLOOVZDWHUDWORZHUUHWXUQ SHULRGVVHH)LJXUHEHORZ-%$KDVYHULILHGWKLVSRWHQWLDOVSLOOORFDWLRQZLWK&DUORZ&RXQW\ &RXQFLOZKRFRQILUPHGWKDWWKHUHLVDIORRGEDUULHULQSODFHDWWKHVWDWHGORFDWLRQ EHWZHHQWKH EULGJHSDUDSHWDQGJDEOHHQGZDOORIWKHSXEOLFKRXVH $VVXFKWKHVSLOOSRLQWFRXOGEHVWDWHGLQ HUURURUSRVVLEO\RYHUHVWLPDWHG )LJXUH%\SDVVLQJSRLQWLQGLFDWHGE\6(&)5$0+\GUDXOLFV5HSRUW 6RXUFH 23:(&)5$07XOORZB7XOORZSKHOLP+\GUDXOLFV5HSRUW V7XOORZ6)5$YGRF[ 4.5 Historic Flood Review and Consultation with Area Engineer 5HFRUGVRISDVWIORRGLQJDUHXVHIXOIRUORRNLQJDWWKHVRXUFHVVHDVRQDOLW\IUHTXHQF\DQGLQWHQVLW\ RIIORRGLQJ+LVWRULFDOUHFRUGVDUHPRVWO\DQHFGRWDODQGLQFRPSOHWHEXWDUHXVHIXOIRUSURYLGLQJ EDFNJURXQGLQIRUPDWLRQ 4.5.1 OPW Floodmaps.ie 7KH23:KRVWVD1DWLRQDO)ORRG+D]DUG0DSSLQJZHEVLWHWKDWPDNHVDYDLODEOHLQIRUPDWLRQRQ DUHDVSRWHQWLDOO\DWULVNIURPIORRGLQJ7KLVZHEVLWHSURYLGHVLQIRUPDWLRQRQKLVWRULFDOIORRGHYHQWV DFURVVWKHFRXQWU\DQGIRUPHGWKHEDVLVRIWKH5HJLRQDO)ORRG5LVN$SSUDLVDO ,QIRUPDWLRQLVSURYLGHGLQWKHIRUPRIUHSRUWVDQGQHZVSDSHUDUWLFOHVZKLFKJHQHUDOO\UHODWHWRUDUH DQGH[WUHPHHYHQWV6LQFHWKHHVWDEOLVKPHQWRIWKHKD]DUGPDSSLQJZHEVLWHPRUHUHFRUGVDUH DYDLODEOHZKLFKLGHQWLI\PRUHIUHTXHQWDQGRIWHQUHFXUULQJHYHQWV7KHVHWHQGWRLQFOXGHPHPRV DQGPHHWLQJUHFRUGVIURPORFDODXWKRULW\DUHDHQJLQHHUVRIWHQUHODWLQJWRURDGIORRGLQJ 4.5.2 Consultation $ PHHWLQJ ZLWK WKH $UHD (QJLQHHU IRU 7XOORZ KHOSHG WR FODULI\ DQGLPSURYHRQWKHJHQHUDO DSSUHFLDWLRQRIIORRGULVNDFURVVWKHVHWWOHPHQW7KLVLQFOXGHVIRUDSSURSULDWHVFUHHQLQJRIWKH KLVWRULF DQG SRWHQWLDO IORRG ULVN IURP WKH VPDOOHU ZDWHUFRXUVHV ZLWKLQ WKH VHWWOHPHQW ERXQGDU\ ,QFLGHQFHVRIIORRGLQJIURPWKHFRQVXOWDWLRQDUHQRWHGLQWKHIROORZLQJVHFWLRQ 4.5.3 Summary of Historic Flood Risk 7KH SHUWLQHQW IORRG ULVN KLVWRU\ IURP ERWKWKH FRQVXOWDWLRQDQG 23:IORRGPDSVLH VRXUFHV DUH VXPPDULVHGLQ)LJXUHDQG7DEOHEHORZ )LJXUH+LVWRULF)ORRG0DSSLQJ 6SDWLDO5HSUHVHQWDWLRQ ZZZIORRGPDSVLH V7XOORZ6)5$YGRF[ 7DEOH+LVWRULF)ORRGLQJ,QIRUPDWLRQTXRWHGIURP6RXWK(DVWHUQ&)5$0,QFHSWLRQ5HSRUWDQGWKHFRQVXOWDWLRQZLWK &DUORZ(QJLQHHULQJVWDII Date of Flood Description 1RYHPEHUWK /DUJHVWUHFRUGHGIORRGLQJHYHQWWRKDYHRFFXUUHGLQ7XOORZSURSHUWLHV IORRGHGE\GHSWKVRIXSWRP5HSRUWVVXJJHVWWKDWWKHIORRGLQJZDVD UHVXOWRIDEORFNHGEULGJHXSVWUHDPZKLFKKDGHIIHFWLYHO\EHFRPHDGDP IDLOLQJVHQGLQJDIORRGZDYHGRZQVWUHDP 1RYHPEHUWK 7KH HYHQWLVUHSRUWHGWRKDYHFDXVHGLQIUDVWUXFWXUDOIORRGLQJDQG VRPHIORRGLQJRISURSHUWLHV$YDLODELOLW\RIH[WHQWVIORRGOHYHOVDQGGHSWKV DUHOLPLWHGIRUWKLVHYHQW 1RYHPEHUWK 7KHVHFRQGJUHDWHVWUHFRUGHGIORRGHYHQWRFFXUUHGLQ7XOORZLQ1RYHPEHU 7KHHYHQWZDVFDXVHGE\KHDY\UDLQIDOODQGUHVXOWHGLQIORRGLQJRI SURSHUWLHV 1RYHPEHUWK 6RPHURDGVVXFKDV7KRPDV7UD\QRU6WUHHWDQG2XUDJK5RDGZHUH IORRGHGLQ1RYHPEHURI1RIORRGLQJRISURSHUWLHVZDVUHFRUGHGDQG WKHIORRGHYHQWZDVDWWULEXWHGWREDFNLQJXSRIWKHVXUIDFHZDWHUGUDLQDJH V\VWHPDVRSSRVHGWRIOXYLDOIORRGLQJ 5HFXUULQJ 7ZRVHFWLRQVRIURDGDW0RXQWZROVHOH\7XOORZUHJXODUO\EHFRPH LPSDVVDEOHGXHWRIORRGLQJ 5HFXUULQJ 5HFXUULQJIORRGLQJWREXLOGLQJVDQGURDGVLQWKH7XOORZWRZQFHQWUHWR EXLOGLQJVDQGURDGVZDVSUHYLRXVO\DQLVVXH 4.6 Sources of Flooding $UHYLHZRIWKHKLVWRULFDOHYHQWGDWDDQGSUHGLFWLYHIORRGLQIRUPDWLRQKDVKLJKOLJKWHGDQXPEHURI VRXUFHVRISRWHQWLDOIORRGULVNWRWKHWRZQ7KHVHDUHGLVFXVVHGLQWKHIROORZLQJVHFWLRQV 4.6.1 Fluvial Flooding 7KHPDLQVRXUFHRIKLVWRULFDQGSRWHQWLDOIORRGULVNWRGHYHORSPHQWLQ7XOORZLVWKH5LYHU6ODQH\ ZLWKWKHULYHU'HUUHHQSUHVHQWLQJDORZULVN7KH5LYHU6ODQH\KDVEHHQVXEMHFWWRD)ORRG5HOLHI 6FKHPH )56 ,QDGGLWLRQWRWKH5LYHU6ODQH\DQG'HUUHHQWKHUHDUHWKUHHVPDOOHUWULEXWDULHV WKDW GUDLQ LQWR WKH DIRUHPHQWLRQHG ULYHUV 7KH WULEXWDULHV GR QRW FDXVH VLJQLILFDQW LPSDFWV DQG SUHVHQWDORZULVN $OWKRXJKWKHUHDUHVHYHUDOKLVWRULFHYHQWVRIIORRGLQJIRU7XOORZOLVWHGLQ7DEOHPRVWRIWKHVH HYHQWVDUHSULRUWRWKHFRQVWUXFWLRQIORRGGHIHQFHVLQWKHWRZQDORQJWKH6ODQH\5LYHUKRZHYHUWKH ULYHUGRHVVWLOOSUHVHQWDUHVLGXDOIORRGULVNWRWKHVHGHIHQGHGDUHDV 4.6.2 Residual Risk 7KHIORRGGHIHQFHZRUNVDORQJWKH5LYHU6ODQH\DUHGHVLJQHGWRD$(3 \HDU VWDQGDUG RISURWHFWLRQDOWKRXJKLWLVQRWHGWKDWWKHUHLVDSRWHQWLDOVSLOOORFDWHGDWWKHZHVWHUQVLGHRIWKH WRZQEULGJHDWDORZHU$(3HYHQW$VZLWKDQ\EXLOWGHIHQFHVWKHUHLVDUHVLGXDOULVNDVVRFLDWHG ZLWKIDLOXUH RI WKHVHGHIHQFHV GXHWR RYHUWRSSLQJ RU EUHDFKRU IDLOXUH WRHUHFW VHFWLRQV RI WKH GHIHQFHV 7KHDUHDVEHQHILWLQJIURPGHIHQFHVDUHSUHVHQWHGEHORZLQ)LJXUHDQGLQGLFDWHWKHDUHDVRI UHVLGXDOULVN :LWKFOLPDWHFKDQJHWKHIUHTXHQF\SDWWHUQDQGVHYHULW\RIIORRGLQJDUHH[SHFWHGWRFKDQJHDQG EHFRPHPRUHGDPDJLQJ&OLPDWHFKDQJHDQGLQFUHDVHGULYHUIORZVZLOOLPSDFWRQWKHOHYHORI SURWHFWLRQ RI WKH VFKHPH LQ IXWXUH \HDUV )XUWKHU GLVFXVVLRQ RQ WKH W\SHV RI UHVLGXDO ULVN LV SURYLGHGEHORZ 6RXWK(DVWHUQ&)5$06WXG\+$,QFHSWLRQ5HSRUW53623:-XQH 7XOORZ3UH)HDVLELOLW\)ORRG5HOLHI6WXG\23:6HSWHPEHU 7XOORZ3UH)HDVLELOLW\)ORRG5HOLHI6WXG\23:6HSWHPEHU 7XOORZ3UH)HDVLELOLW\)ORRG5HOLHI6WXG\23:6HSWHPEHU 7XOORZ3UH)HDVLELOLW\)ORRG5HOLHI6WXG\23:6HSWHPEHU KWWS ZZZIORRGPDSVLH KWWS ZZZIORRGPDSVLH V7XOORZ6)5$YGRF[ )LJXUH7XOORZ)ORRG=RQHVDQG'HIHQGHG$UHDV &)5$0'DWD 4.6.2.1 Residual Risk due to Overtopping 2YHUWRSSLQJRIIORRGGHIHQFHVZLOORFFXUGXULQJIORRGHYHQWVJUHDWHUWKDQWKHGHVLJQOHYHORIWKH GHIHQFHV7KHGHIHQFHVLQ7XOORZKDYHEHHQGHVLJQHGWRD$(3OHYHORISURWHFWLRQWKLVZLOO LQFOXGHDOHYHORIIUHHERDUG'XULQJDQ\HYHQWJUHDWHUWKDQD$(3 RUDQHYHQWOHVVWKDQ $(3DWWKHWRZQEULGJH RYHUWRSSLQJZLOORFFXU7KLVLVFDQFDXVHPRUHOLPLWHGLQXQGDWLRQRIWKH IORRGSODLQWKDQLIGHIHQFHVKDGQRWEHHQEXLOWEXWWKHLPSDFWZLOOGHSHQGRQWKHGXUDWLRQVHYHULW\ DQGYROXPHRIIORRGZDWHU,QDQDUURZIORRGSODLQOLNHWKDWRIWKH6ODQH\WKHULYHUOHYHOVPD\EHD VLPLODUOHYHOWRWKHIORRGSODLQ+RZHYHUDQGPRUHFULWLFDOO\RYHUWRSSLQJFDQGHVWDELOLVHDIORRG GHIHQFHFDXVHHURVLRQDQGPDNHLWPRUHVXVFHSWLEOHWREUHDFKRUIDLO 2YHUWRSSLQJPD\EHFRPHPRUHOLNHO\LQIXWXUH\HDUVGXHWRWKHLPSDFWVRIFOLPDWHFKDQJH,Q 7XOORZWKHGHIHQFHVKDYHEHHQGHVLJQHGWRD$(3VWDQGDUGRISURWHFWLRQZLWKRXWWKHLQFOXVLRQ RISRVVLEOHFOLPDWHFKDQJHLPSDFWVVXFKDVPRUHIUHTXHQWDQGKLJKHUULYHUIORZV 4.6.2.2 Residual Risk due to Breach or Structural Failure %UHDFKRUVWUXFWXUDOIDLOXUHRIIORRGGHIHQFHVLVKDUGWRSUHGLFWDQGLVODUJHO\UHODWHGWRWKHVWUXFWXUDO FRQGLWLRQDQGW\SHRIIORRGGHIHQFH +DUG IORRGGHIHQFHVVXFKDVVROLGFRQFUHWHZDOOVDUHOHVV OLNHO\WREUHDFKWKDQ VRIW GHIHQFHVXFKDVHDUWKHPEDQNPHQWV %UHDFKZLOOXVXDOO\UHVXOWLQVXGGHQIORRGLQJZLWKOLWWOHRUQRZDUQLQJDQGSUHVHQWVDVLJQLILFDQW KD]DUGDQGGDQJHUWROLIH7KHUHLVOLNHO\WREHGHHSHUIORRGLQJLQWKHHYHQWRIDEUHDFKWKDQGXH WRRYHUWRSSLQJ7KHYROXPHDQGLPSDFWRIIORRGLQJZLOOGHSHQGRQDQXPEHURIIDFWRUVLQFOXGLQJ x 6L]HDQGQXPEHURIEUHDFKHV x 7KHWLPHWKDWWKHEUHDFKGHYHORSV DEUHDFKWKDWGHYHORSVHDUO\ZLOODOORZPRUHIORRGZDWHU WKURXJK KRZHYHU D EUHDFK WKDW GHYHORSV QHDU WKH SHDN RI WKH HYHQW ZLOO EH PRUH KD]DUGRXV V7XOORZ6)5$YGRF[ x +RZORQJWKHEUHDFKUHPDLQVRSHQOHDYLQJWKRVHLQWKHIORRGSODLQYXOQHUDEOHWRVHFRQGDU\ IORRGSHDNVRQDZDWHUFRXUVH 4.6.2.3 Residual Risk due to Operational Failure ,IDGHIHQFHV\VWHPLQFOXGHVWHPSRUDU\RUGHPRXQWDEOHVHFWLRQVVXFKDVLQ7XOORZLWPD\IDLOGXH WRIRUHFDVWLQJHUURUVDFFHVVRUWHFKQLFDOGLIILFXOWLHVZLWKWKHGHPRXQWDEOHV\VWHPLWVHOI7KHOHDG LQ WLPH LV VKRUW DQG WKLV UHVLGXDO ULVN VKRXOG QRW EH XQGHUHVWLPDWHG 2SHUDWLRQDO IDLOXUH SUHGRPLQDQWO\LPSDFWVWKHZHVWHUQEDQNRIWKH6ODQH\ZKLFKLVZKHUHWKHVL[IORRGEDUULHUVDUH ORFDWHG 7KHUH LV DOVR D ULVN WKDW VXUIDFH ZDWHU SXPSLQJ IURP EHKLQG WKH GHIHQFHV VXIIHUV IDLOXUH WKLV SXPSLQJRFFXUVRQERWKWKHZHVWHUQDQGHDVWHUQVLGHVRIWKHULYHU 4.6.2.4 Scales of Residual Risk ,QWKHHYHQWRIGHIHQFHRYHUWRSSLQJRUEUHDFKRQUHODWLYHO\QDUURZIORRGSODLQVVXFKDVWKDWRIWKH 6ODQH\WKURXJK7XOORZLQXQGDWLRQOHYHOVDFURVVWKHIORRGSODLQDUHOLNHO\WREHWKHVDPHRUYHU\ QHDUO\WKHVDPHDVOHYHOVLQWKHULYHUFKDQQHO,QWKH DUHDLPPHGLDWHO\EHKLQGWKHGHIHQFHV NQRZQDVWKH UDSLGLQXQGDWLRQ]RQH IORRGGHSWKVDQGYHORFLWLHVZLOOEHKLJKHVWSDUWLFXODUO\LQWKH WLPHLPPHGLDWHO\IROORZLQJWKHRQVHWRIRYHUWRSSLQJRUEUHDFK7KHUHPD\EHOLWWOHWLPHIRUZDUQLQJ RUUHDFWLQJWRWKHIDLOXUHRIWKHGHIHQFH,QWKHDUHDRIIORRGSODLQIXUWKHVWIURPWKHULYHUZDWHU OHYHOVZLOOULVHPRUHJUDGXDOO\DQGUHDFKORZHUGHSWKVDQGYHORFLWLHV%HLQJQHDUHVWWRKLJKHUDQG GU\ODQGHYDFXDWLRQRSSRUWXQLWLHVIURPWKLVDUHDDUHDOVRJUHDWHVW :KHUHDQDUHDLVSURWHFWHGE\DGHPRXQWDEOHGHIHQFHHLWKHUIXOO\RULQSDUWWKHUHVLGXDOULVNVDUH JUHDWHUWKDQZKHUHODQGLVEHKLQGDIL[HGGHIHQFH,WLVWKHUHIRUHLPSRUWDQWWKDWULVNVDQGWKH LPSDFWRIGHIHQFHIDLOXUHLVFRQVLGHUHGLQUHODWLRQWRWKHZKROHIORRGFHOOUDWKHUWKDQWKHODQG LPPHGLDWHO\EHKLQGRQHVHFWLRQRIGHIHQFH7KLVLVSDUWLFXODUO\UHOHYDQWLQ7XOORZZKHUH)56UHOLHV RQDFRPELQDWLRQRIIL[HGDQGGHPRXQWDEOHGHIHQFHV 7KH UHOLHI VFKHPH LQ 7XOORZ ZDV FRQVWUXFWHG UHFHQWO\ DQG LV WKHUHIRUH LQ JRRG FRQGLWLRQ DQG XQOLNHO\ WR IDLO GXH WR VWUXFWXUDO GHILFLHQFLHV 7KH VWDQGDUG RI SURWHFWLRQ DQG FRQGLWLRQ RI WKH GHIHQFHVZLOOEHGHSHQGHQWRQUHJXODULQVSHFWLRQDQGPDLQWHQDQFHRYHULWVHQWLUHOLIHWLPH7KH FXUUHQWOHYHORIUHVLGXDOULVNEHKLQGWKHGHIHQFHVLVORZGXHWRWKHIDFWWKDWWKHGHIHQFHVKDYHEHHQ UHFHQWO\GHVLJQHGDQGFRQVWUXFWHG 7KHVFDOHRIUHVLGXDOULVNLVGLIILFXOWWRSUHGLFWDQGUHTXLUHVGHWDLOHGPRGHOOLQJWRHVWLPDWHWKHIORRG H[WHQWVIURPDUDQJHRIGLIIHUHQWVFHQDULRVGHIHQGHGDQGXQGHIHQGHG$VSDUWRI6(&)5$0 GHIHQGHGDQGXQGHIHQGHGGUDIWIORRGH[WHQWVDUHDYDLODEOHDQGWKH XQGHIHQGHG IORRG H[WHQWV KDYHEHHQXVHGWRFUHDWH)ORRG=RQH$ 8QGHUVWDQGLQJ WKH UHVLGXDO ULVNV LV FULWLFDO WR DSSOLFDWLRQ RI WKH )ORRGLQJ *XLGHOLQHV LQ WKHVH GHIHQGHG DUHDV (YHQ WKRXJK WKH DUHD LV GHIHQGHG LW LV LPSRUWDQWWREHDEOHWRJXLGHPRUH YXOQHUDEOHGHYHORSPHQWWRWKHORZHUUHVLGXDOULVNDUHDVDQGWRDVVHVVKRZWKHXUEDQIRUPRIWKH GHYHORSPHQWPD\EHLPSDFWHGE\WKHVHULVNV:LWKRXWGHWDLOHGEUHDFKPRGHOOLQJWKHIROORZLQJ DVVXPSWLRQVKDYHEHHQPDGHLQRUGHUWRDVVHVVWKHUHVLGXDOULVN x :RUVWFDVHVFHQDULRZRXOGEHIORRGH[WHQWHTXDOWRWKDWRIDQXQGHIHQGHGVFHQDULRIRUD SDUWLFXODUUHWXUQSHULRG x )ORRG GHSWKV LQ WKLV QDUURZ IORRGSODLQ FDQ EH DFFXUDWHO\ DVVXPHG WREH VLPLODU WRWKH SUHGLFWHGIORRGOHYHOVIURPWKH6(&)5$0PRGHOOLQJ x )ORZ YHORFLWLHV DQG KHQFH KD]DUG ZLOO EH JUHDWHVW LPPHGLDWHO\ DGMDFHQW WR WKH IORRG GHIHQFHV 'HYHORSPHQWLQDUHDVEHQHILWLQJIURPGHIHQFHVPXVWFRQVLGHUORQJWHUPIORRGULVNPDQDJHPHQW SROLFLHVDQGSODQV2QDVLWHVSHFLILFOHYHOHPHUJHQF\UHVSRQVHSODQVKRXOGEHSUHSDUHGWDNLQJ LQWRDFFRXQWWKHRYHUDOOSODQIRUWKHDUHDDQGWKHLPSOLFDWLRQVIRUDGGLQJIXUWKHUGHPDQGVRQWKH EOXHOLJKWVHUYLFHV 7KH PDQDJHPHQW RI IOXYLDO IORRG ULVN WKURXJK WKH GHYHORSPHQW RI DSSURSULDWH SROLFLHV DQG REMHFWLYHVLVGLVFXVVHG6HFWLRQ$IXOOUHYLHZRIORFDWLRQVZKHUHGHYHORSPHQWLVLPSDFWHGE\ IORRGULVNLVLQFOXGHGLQ6HFWLRQ V7XOORZ6)5$YGRF[ 4.6.3 Surface Water / Pluvial Flooding )ORRGLQJRIODQGIURPVXUIDFHZDWHUUXQRIILVXVXDOO\FDXVHGE\LQWHQVHUDLQIDOOWKDWPD\RQO\ODVW DIHZKRXUV$UHDVDWULVNIURPIOXYLDOIORRGLQJZLOODOPRVWFHUWDLQO\EHDWULVNIURPVXUIDFHZDWHU IORRGLQJ7KHLQGLFDWLYHSOXYLDOPDSIURPP\SODQLHVKRZVWKH23:3)5$VWXG\LQ)LJXUH,W KDVEHHQXVHGWRLGHQWLI\GHYHORSPHQWDUHDVDWSDUWLFXODUULVNRIVXUIDFHZDWHUDQGSOXYLDOIORRGLQJ 7KH 23: KLVWRULF UHFRUGV LQGLFDWH WKDW EDFNLQJ XS RI WKH VXUIDFHZDWHUV\VWHPKDVFDXVHG SUREOHPVZLWKLQWKHWRZQFHQWUH+RZHYHUPRVWSUHYLRXVIORRGHYHQWVDWWULEXWHGWRIOXYLDOIORRGLQJ IURPWKH5LYHU6ODQH\SULRUWRWKHLQVWDOODWLRQRIWKH)56$OWKRXJKVXUIDFHZDWHUFRXOGKDYHEHHQ D FRQWULEXWLQJ IDFWRU ZLWKLQ VRPH RI WKHVH IORRG HYHQWV SRRUO\ SODQQHG GHYHORSPHQWV RU LQDGHTXDWHO\ GHVLJQHG VXUIDFH ZDWHU GUDLQDJH V\VWHPV FDQ LQFUHDVHWKH ULVN RI VXUIDFHZDWHU IORRGLQJ DQG H[DFHUEDWH WKH H[WHQW RI IOXYLDO IORRGLQJ 1HZ GHYHORSPHQW RU UHGHYHORSPHQW RI H[LVWLQJVLWHVDGKHULQJWRWKHSROLFLHVRQWKHPDQDJHPHQWRIVXUIDFHZDWHUZLOOHQVXUHWKHULVNZLOO EHDGHTXDWHO\PDQDJHG7KLVLVH[SODLQHGIXUWKHULQ6HFWLRQ )LJXUH3)5$,QGLFDWLYH3OXYLDO)ORRG0DS 4.6.4 Groundwater Flooding *URXQGZDWHUIORRGLQJLVFDXVHGE\WKHHPHUJHQFHRIZDWHURULJLQDWLQJIURPWKHVXEVXUIDFHDQG LVSDUWLFXODUO\FRPPRQLQNDUVWODQGVFDSHV7KLVVRXUFHRIIORRGLQJFDQSHUVLVWRYHUDQXPEHURI ZHHNVDQGSRVHVDVLJQLILFDQWEXWORFDOLVHGLVVXHWKDWKDVDWWUDFWHGDQLQFUHDVLQJDPRXQWRISXEOLF FRQFHUQLQUHFHQW\HDUV,QPRVWFDVHVJURXQGZDWHUIORRGLQJFDQQRWEHHDVLO\PDQDJHGRUODVWLQJ VROXWLRQVHQJLQHHUHG 7KH GUDIW 3)5$ JURXQGZDWHU IORRG PDSV ZKLFK HQWDLOHG DQ HYLGHQFHEDVHG DSSURDFK DQG FRQVLGHUHGWKHK\GURJHRORJLFDOHQYLURQPHQWVXFKDVWKHSUHVHQFHRIWXUORXJKVGLGQRWVKRZ DQ\VLJQLILFDQWULVNLQWKH/$3DUHD%DVHGRQWKH3)5$VWXG\WKHULVNRIJURXQGZDWHUIORRGLQJLV QRWFRQVLGHUHGVLJQLILFDQWHQRXJKWRZDUUDQWIXUWKHULQYHVWLJDWLRQLQWKLV6)5$ 6RXUFH KWWS ZZZP\SODQLHHQLQGH[KWPO 5HIHUHQFH KWWS ZZZP\SODQLHHQLQGH[KWPO V7XOORZ6)5$YGRF[ 4.7 Climate Change 7KH3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQWJXLGHOLQHVUHFRPPHQGVWKDWDSUHFDXWLRQDU\ DSSURDFKWRFOLPDWHFKDQJHLVDGRSWHGGXHWRWKHOHYHO RIXQFHUWDLQW\LQYROYHGLQWKHSRWHQWLDO HIIHFWV 6SHFLILFDGYLFHRQWKHH[SHFWHGLPSDFWVRIFOLPDWHFKDQJHDQGWKHDOORZDQFHVWREHSURYLGHGIRU IXWXUHIORRGULVNPDQDJHPHQWLQ,UHODQGLVJLYHQLQWKH23:GUDIWJXLGDQFH7ZRFOLPDWHFKDQJH VFHQDULRVDUHFRQVLGHUHG7KHVHDUHWKH0LG5DQJH)XWXUH6FHQDULR 05)6 DQGWKH+LJK(QG )XWXUH6FHQDULR +()6 7KH05)6LVLQWHQGHGWRUHSUHVHQWDOLNHO\IXWXUHVFHQDULREDVHGRQ WKH ZLGHUDQJH RIIXWXUHSUHGLFWLRQVDYDLODEOH7KH +()6UHSUHVHQWVDPRUHH[WUHPHIXWXUH VFHQDULRDWWKHXSSHUERXQGDULHVRIIXWXUHSURMHFWLRQV%DVHGRQWKHVHWZRVFHQDULRVWKH23: UHFRPPHQGHGDOORZDQFHVIRUFOLPDWHFKDQJHDUHJLYHQLQ7DEOHEHORZ 7DEOH$OORZDQFHVIRU)XWXUH6FHQDULRV 4.7.1 Climate Change and Flood Risk Assessment 7KH)ORRG=RQHVDUHGHWHUPLQHGEDVHGRQUHDGLO\DYDLODEOHLQIRUPDWLRQDQGWKHLUSXUSRVHLVWREH XVHGDVDWRROWRDYRLGLQDSSURSULDWHGHYHORSPHQWLQDUHDVRIIORRGULVN:KHUHGHYHORSPHQWLV SURSRVHGZLWKLQDQDUHDRISRWHQWLDOIORRGULVN )ORRG=RQH$RU% DIORRGULVNDVVHVVPHQWRI DSSURSULDWHVFDOHZLOOEHUHTXLUHGDQGWKLVDVVHVVPHQWPXVWWDNHLQWRDFFRXQWFOLPDWHFKDQJHDQG DVVRFLDWHG LPSDFWV 8QGHU WKH 1DWLRQDO &)5$0 SURJUDPPH WKH GHWDLOHG PRGHOOLQJ DQG DVVHVVPHQW VWDJH RI HDFK VWXG\ ZLOO LQFOXGH IRU FOLPDWH FKDQJH HIIHFWV EXW KDV QRW \HW EHHQ GHOLYHUHGXQGHUWKHGUDIWVWDJH &OLPDWHFKDQJHPD\UHVXOWLQLQFUHDVHGIORRGH[WHQWVDQGWKHUHIRUHFDXWLRQVKRXOGEHWDNHQZKHQ ]RQLQJODQGVLQWUDQVLWLRQDODUHDVAs recommended in the Planning System and Flood Risk Management Guidelines; Flood Zone B, which represents the 0.1% AEP extent, can be taken as an indication of the extent of the 1% AEP flood event with climate change.,QVWHHSYDOOH\V DQLQFUHDVHLQZDWHUOHYHOZLOOUHODWHWRDYHU\VPDOOLQFUHDVHLQH[WHQWKRZHYHULQIODWWHUORZO\LQJ EDVLQVDVPDOOLQFUHDVHLQZDWHUOHYHOFDQUHVXOWLQDVLJQLILFDQWLQFUHDVHLQIORRGH[WHQW ,Q WKH GHVLJQ RI IORRG DOOHYLDWLRQ PHDVXUHV FOLPDWH FKDQJH VKRXOG EH WDNHQ LQWR DFFRXQW DQG GHVLJQOHYHOVRIVWUXFWXUHVVXFKDVIORRGZDOOVRUHPEDQNPHQWVPXVWEHVXIILFLHQWWRFRSHZLWK WKHHIIHFWVRIFOLPDWHFKDQJHRYHUWKHOLIHWLPHRIWKHVWUXFWXUHRUZKHUHFLUFXPVWDQFHVSHUPLWEH FDSDEOHRIDGDSWDWLRQ)XUWKHUFRQVLGHUDWLRQWRWKHSRWHQWLDOIXWXUHLPSDFWVRIFOLPDWHFKDQJHZLOO EHJLYHQIRUVSHFLILFDUHDVRIWKH/$3ZLWKLQ6HFWLRQ V7XOORZ6)5$YGRF[ 5 Approach to Flood Risk Management 7KH 3ODQQLQJ *XLGHOLQHV UHFRPPHQG D VHTXHQWLDO DSSURDFK WR VSDWLDO SODQQLQJ SURPRWLQJ DYRLGDQFHUDWKHUWKDQMXVWLILFDWLRQDQGVXEVHTXHQWPLWLJDWLRQRIULVN7KHLPSOHPHQWDWLRQRIWKH 3ODQQLQJ*XLGHOLQHVRQDVHWWOHPHQWEDVLVLVDFKLHYHGWKURXJKWKHDSSOLFDWLRQRIWKHSROLFLHVDQG REMHFWLYHVFRQWDLQHGZLWKLQ6HFWLRQ )ORRGLQJ RIWKH&&'37KHVHKDYHEHHQ RXWOLQHGLQ6HFWLRQ 7KHXVHDQGDSSOLFDWLRQRIWKHSROLFLHVDQGJXLGHOLQHVDWWKH/$3OHYHOFRQVWLWXWHVWKHIRUPDOSODQ IRUIORRGULVNPDQDJHPHQWIRU7XOORZ 5.1 The Strategic Approach $VWUDWHJLFDSSURDFKWRWKHPDQDJHPHQWRIIORRGULVNLVLPSRUWDQWLQ7XOORZDVWKHUHLVDVLJQLILFDQW DUHDRIWKHFRUHWRZQFHQWUHDUHDORFDWHGZLWKLQ)ORRG=RQH$%:KLOVWWKHUHLVDQ)56LQSODFH WKHSURWHFWLRQDIIRUGHGE\WKHVFKHPHUHOLHVRQWKHSODFHPHQWRIGHPRXQWDEOHGHIHQFHVDQGWKH GHIHQFHV FDQ IDLO RU RYHUWRS 7KH UHVLGXDO ULVN WKHUHIRUH UHPDLQV VLJQLILFDQW DQG )5$V IRU GHYHORSPHQW ZLWKLQWKHWRZQFHQWUHPXVWWDNHWKLVLQWR DFFRXQWZKHQSURYLGLQJPLWLJDWLRQDQG GHVLJQDGYLFH $VXPPDU\RIIORRGULVNVDVVRFLDWHGZLWKHDFKRIWKH]RQLQJREMHFWLYHVKDVEHHQSURYLGHGLQ7DEOH EHORZ,WVKRXOGEHQRWHGWKDWWKLVWDEOHLVLQWHQGHGDVDJXLGHRQO\DQGVKRXOGEHUHDGLQ FRQMXQFWLRQ ZLWK WKH GHWDLOHG DVVHVVPHQW RI ULVNV SURYLGHG LQ 6HFWLRQ +RZHYHU ZKHQ DSSOLFDWLRQVDUHEHLQJFRQVLGHUHGLWLVLPSRUWDQWWRUHPHPEHUWKDWQRWDOOXVHVZLOOEHDSSURSULDWH RQ IORRG ULVN JURXQGV KHQFH WKH QHHG WR ZRUN WKURXJK WKH -XVWLILFDWLRQ 7HVW IRU 'HYHORSPHQW 0DQDJHPHQWRQDVLWHE\VLWHEDVLVDQGZLWKUHIHUHQFHWR6HFWLRQ)RUH[DPSOHWKHFRPPXQLW\ ]RQLQJREMHFWLYHFRXOGLQFOXGHDKLJKO\YXOQHUDEOHFUqFKHOHVV YXOQHUDEOH VKRSV DQG ZDWHU FRPSDWLEOHFDUSDUNLQJVSRUWVIDFLOLWLHVEXWWKH\ZRXOGQRWEHHTXDOO\SHUPLVVLEOHRQWKHJURXQG IORRUZLWKLQ)ORRG=RQH$RU% 7DEOH =RQLQJREMHFWLYHYXOQHUDELOLW\ Indicative Primary Zoning Objective Flood Risk Commentary Vulnerability -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR ([LVWLQJ3HUPLWWHG DOORZ]RQLQJLQ)ORRG=RQH$DQG%)RU +LJKYXOQHUDELOLW\ 5HVLGHQWLDO DOWHUDWLRQVWRH[LVWLQJGHYHORSPHQWVHH 6HFWLRQ 1HZ5HVLGHQWLDO -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR +LJKYXOQHUDELOLW\ 3KDVHDQG DOORZ]RQLQJLQ)ORRG=RQH$DQG% -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR DOORZ]RQLQJLQ)ORRG=RQH$DQG%)RU 8WLOLWLHV +LJKYXOQHUDELOLW\ DOWHUDWLRQVWRH[LVWLQJGHYHORSPHQWVHH 6HFWLRQ -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR DOORZKLJKO\YXOQHUDEOHGHYHORSPHQW +LJKRUOHVVYXOQHUDEOHRU )DUPKRXVHV LQ)ORRG=RQH$DQG%DQG $JULFXOWXUH ZDWHUFRPSDWLEOH IRUOHVVYXOQHUDEOHGHYHORSPHQWLQ)ORRG =RQH%:DWHUFRPSDWLEOHXVHVDUH DSSURSULDWH -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR DOORZKLJKO\YXOQHUDEOHGHYHORSPHQW ,QWHJUDWHG7RXULVPDQG )ORRG=RQH$DQG%DQGIRUOHVV +LJKRUOHVVYXOQHUDEOH /HLVXUH YXOQHUDEOHGHYHORSPHQWLQ)ORRG=RQH% )RUDOWHUDWLRQVWRH[LVWLQJGHYHORSPHQW VHH6HFWLRQ -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR &RPPXQLW\6HUYLFHV +LJKRUOHVVYXOQHUDEOHRU DOORZKLJKO\YXOQHUDEOHGHYHORSPHQW DQG(GXFDWLRQDO ZDWHUFRPSDWLEOH )ORRG=RQH$DQG%DQGIRUOHVV YXOQHUDEOHGHYHORSPHQWLQ)ORRG=RQH% -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR 1HLJKERXUKRRG DOORZKLJKO\YXOQHUDEOHGHYHORSPHQW +LJKDQGOHVVYXOQHUDEOH )DFLOLWLHV )ORRG=RQH$DQG%DQGIRUOHVV YXOQHUDEOHGHYHORSPHQWLQ)ORRG=RQH% /HVVYXOQHUDEOHZLWK -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR 7RZQ&HQWUH VRPHKLJKO\YXOQHUDEOH DOORZKLJKO\YXOQHUDEOHGHYHORSPHQW V7XOORZ6)5$YGRF[ Indicative Primary Zoning Objective Flood Risk Commentary Vulnerability )ORRG=RQH$DQG%DQGIRUOHVV YXOQHUDEOHGHYHORSPHQWLQ)ORRG=RQH% ,QGXVWU\DQG -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR :DUHKRXVLQJDQG /HVVYXOQHUDEOH DOORZ]RQLQJLQ)ORRG=RQH% DVVRFLDWHG2IILFH8VH (QWHUSULVHDQG -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR /HVVYXOQHUDEOH (PSOR\PHQW DOORZ]RQLQJLQ)ORRG=RQH% 0DQXIDFWXULQJ7RXULVP DQG(QWHUSULVH -XVWLILFDWLRQ7HVWQHHGVWREHSDVVHGWR /HVVYXOQHUDEOH (PSOR\PHQW DOORZ]RQLQJLQ)ORRG=RQH% 'HYHORSPHQW :DWHUFRPSDWLEOHXVHVDUHDSSURSULDWH 2SHQ6SDFHDQG :DWHUFRPSDWLEOHRUOHVV -XVWLILFDWLRQQHHGVWREHSDVVHGWRDOORZ $PHQLW\ YXOQHUDEOH OHVVYXOQHUDEOHGHYHORSPHQWLQ)ORRG =RQH% 5.2 Application of the Plan Making Justification Test +DYLQJ UHYLHZHG WKH SURSRVHG ]RQLQJ REMHFWLYHV ZLWKLQ WKH VHWWOHPHQW LW LV FOHDU WKDW WKHUH LV UHODWLYHO\OLWWOHRYHUODSEHWZHHQ]RQHGundevelopedODQGVDQGSRWHQWLDOFRQIOLFWZLWKIORRGULVN :KHUHWKHUHDUHRYHUODSVWKHQVSHFLILFPHDVXUHVFDQEHSXWLQSODFHWRGHILQHDQGDYRLGULVNDQG WKH-XVWLILFDWLRQ7HVWKDVQRWEHHQDSSOLHGWKLVLVGLVFXVVHGLQ6HFWLRQ $SSURSULDWH PHDVXUHV IRU DVVHVVLQJ DQG PDQDJLQJ ULVNV WR H[LVWLQJ KLJK DQG ORZ YXOQHUDELOLW\ GHYHORSPHQWLQ)ORRG=RQHV$%DQG&DW'HYHORSPHQW0DQDJHPHQW 3ODQQLQJ$SSOLFDWLRQ VWDJHLVGLVFXVVHGLQ6HFWLRQRQZDUGV 5.2.1 Development on Greenfield Land 7KHPDMRULW\RIXQGHYHORSHGODQGWKDWLVZLWKLQ)ORRG=RQH$RU%LV]RQHGIRUZDWHUFRPSDWLEOH XVHVVXFKDV$PHQLW\DQG2SHQ6SDFH7KLVLVDQDSSURSULDWH]RQLQJDQGVKRXOGFRQWLQXH 5LVNVSHFLILFXVHVDQGGHWDLOHG)5$DUHGLVFXVVHGLQ6HFWLRQIRUHDFKVSHFLILFDUHD0HDVXUHV IRFXV RQ WKH PRUH GHWDLOHG DVVHVVPHQW RI ULVN IURP WKH FRQWULEXWLQJ ZDWHUFRXUVHV DQG WKH DYRLGDQFHRIKLJKO\YXOQHUDEOHGHYHORSPHQWZLWKLQWKHUHGHILQHG)ORRG=RQH$ 2WKHUSURSRVDOVIRUQHZGHYHORSPHQWRQJUHHQILHOGODQGZLWKLQ)ORRG=RQH$RU%ZRXOGQRWSDVV WKH-XVWLILFDWLRQ7HVWDQGODQGLV]RQHGDFFRUGLQJO\ZLWKDZDWHUFRPSDWLEOHRUOHVVYXOQHUDEOHXVH 5.2.2 Existing, Developed, Zoned Areas at Risk of Flooding 7KHUHDUHVLJQLILFDQWDUHDVRIexistingWRZQFHQWUHGHYHORSPHQWORFDWHGEHKLQGIORRGGHIHQFHV WKDWLVDWSRWHQWLDOUHVLGXDOULVNRIIORRGLQJ ZLWKLQ)ORRG=RQH$% DQGLQWKLVFDVH]RQLQJFDQQRW EHVLJQLILFDQWO\DPHQGHGEXWPHDVXUHVFDQEHSXWLQSODFHWRPDQDJHULVNSDUWLFXODUO\WKDWWRDQ\ VLJQLILFDQWQHZGHYHORSPHQWZLWKLQWKLVVHQVLWLYHDUHD 6HFWLRQRQZDUGVSURYLGHVJHQHUDOJXLGDQFHRQKRZWRPDQDJHGHYHORSPHQWDQG6HFWLRQ SURYLGHVDGHWDLOHGUHYLHZRIULVNWRVSHFLILFDUHDVRIWKHVHWWOHPHQW 5.3 Flood Management Action Plans 7KHUHDUHYDULRXVOHYHOVRIIORRGPDQDJHPHQWSODQVSURGXFHGE\DQXPEHURISXEOLFERGLHVDQG WKHVHLQFOXGHWKHRYHUDOOVWUDWHJ\IRUWKHULYHUFDWFKPHQWWKHHPHUJHQF\UHVSRQVHSODQRIWKHORFDO DXWKRULW\DQGWKHIORRGULVNPDQDJHPHQWSODQDWDVLWHVSHFLILFOHYHO Strategic Flood Risk Management PlanWKLVZLOOEHLQIRUPHGE\WKHGHWDLOHGDVVHVVPHQWRIWKH 7XOORZDUHDZKLFKZLOOIROORZFRPSOHWLRQRIWKH6(&)5$0ODWHULQ,WLVLQIRUPHGE\WKH GHWDLOVRQWKHRSHUDWLRQRIWKH7XOORZ)567KHIRUPXODWLRQRIDPDQDJHPHQWSODQLVSDUWLFXODUO\ LPSRUWDQWLQ7XOORZEHFDXVHRIWKHSUHVHQFHRIWKHIORRGGHIHQFHV7KHPDQDJHPHQWSODQPXVW FRQVLGHU UHVLGXDO ULVN DQG DQ HIIHFWLYH HPHUJHQF\ UHVSRQVH VKRXOGWKHGHIHQFHVIDLOGXHWR RYHUWRSSLQJRUEUHDFK Emergency Response PlanLWLVUHFRPPHQGHGWKDWWKH/RFDO$XWKRULW\GUDIWDQ(PHUJHQF\3ODQ WKDWGHDOVZLWKVHYHUHZHDWKHUVFHQDULRVLQFOXGLQJIORRGLQJDQGWKHGRFXPHQWVKRXOGLQFRUSRUDWH Dµ)ORRG3ODQ¶,WLVHVVHQWLDOWKDWWKHIORRGSODQLVUHYLHZHGWRHQVXUHWKHRSHUDWLRQDQGHYDFXDWLRQ SURFHGXUHVDVVRFLDWHGZLWKWKHGHPRXQWDEOHGHIHQFHVDUHLQFOXGHGDORQJZLWKWKHVSHFLILFUROHV V7XOORZ6)5$YGRF[ DQGUHVSRQVLELOLWLHV RI WKRVHLVVXLQJ DOHUWV HUHFWLQJ WKH GHIHQFHV DQG FDUU\LQJ RXW DQ\ UHODWHG GXWLHV Site Specific FRMPWKLVZLOOEHVSHFLILFWRWKHGHYHORSPHQWDQGDVVRFLDWHGDFWLYLWLHVPRVWOLNHO\ LWZLOOEHUHTXLUHGIRUPRUHVLJQLILFDQWWRZQFHQWUHVLWHVWKDWDUHORFDWHGEHKLQGWKHGHIHQFHVDQG DUHDWUHVLGXDOULVNRIIORRGLQJ$VLWHVSHFLILF)503ZKLFKPD\LQFOXGHDQHPHUJHQF\SODQZLOO EHUHTXLUHGIRUDQ\GHYHORSPHQWSURSRVDOWKDWLVJUDQWHGDSSURYDOLQDQDUHDRIIORRGULVN 5.4 Development Management and Flood Risk ,QRUGHUWRJXLGHERWKDSSOLFDQWVDQGUHOHYDQWFRXQFLOVWDIIWKURXJKWKHSURFHVVRISODQQLQJIRUDQG PLWLJDWLQJIORRGULVNWKHNH\IHDWXUHVRIDUDQJHRIGHYHORSPHQWVFHQDULRVKDYHEHHQLGHQWLILHG UHODWLQJWKHIORRG]RQHGHYHORSPHQWYXOQHUDELOLW\DQGSUHVHQFHRUDEVHQFHRIGHIHQFHV )RU HDFK VFHQDULR D QXPEHU RI FRQVLGHUDWLRQV UHODWLQJ WR WKH VXLWDELOLW\ RI WKH GHYHORSPHQW DUH VXPPDULVHGEHORZ ,W VKRXOG EH QRWHG WKDW WKLV VHFWLRQ RI WKH 6)5$ EHJLQV IURP WKH SRLQW WKDW DOO ODQG ]RQHG IRU GHYHORSPHQWKDVSDVVHGWKH-XVWLILFDWLRQ7HVWIRU'HYHORSPHQW3ODQVDQGWKHUHIRUHSDVVHV3DUW RI WKH -XVWLILFDWLRQ 7HVW IRU 'HYHORSPHQW 0DQDJHPHQW ,Q DGGLWLRQ WR WKH JHQHUDO UHFRPPHQGDWLRQV LQ WKH IROORZLQJ VHFWLRQV 6HFWLRQ VKRXOG EH UHYLHZHG IRU VSHFLILF UHFRPPHQGDWLRQVIRULQGLYLGXDODUHDVRIWKH/$3 $VVWDWHGLQ6HFWLRQLQRUGHUWRGHWHUPLQHWKHDSSURSULDWHGHVLJQVWDQGDUGVIRUDGHYHORSPHQW LWPD\EHQHFHVVDU\WRXQGHUWDNHDVLWHVSHFLILFIORRGULVNDVVHVVPHQW7KLVPD\EHDTXDOLWDWLYH DSSUDLVDORIULVNVLQFOXGLQJGUDLQDJHGHVLJQ)XUWKHUGHWDLOVRIHDFKRIWKHVHVFHQDULRVLQFOXGLQJ FRQVLGHUDWLRQVIRUWKHIORRGULVNDVVHVVPHQWDUHSURYLGHGLQWKHIROORZLQJVHFWLRQV 5.5 Requirements for a Flood Risk Assessment ,W LV UHFRPPHQGHG WKDW DQ DVVHVVPHQW RI IORRG ULVN LV UHTXLUHG LQ VXSSRUW RI DQ\ SODQQLQJ DSSOLFDWLRQZKHUHIORRGULVNPD\EHDQLVVXHDQGWKLVPD\LQFOXGHVLWHVLQ)ORRG=RQH&ZKHUHD VPDOOZDWHUFRXUVHRUILHOGGUDLQH[LVWVQHDUE\7KHOHYHORIGHWDLOZLOOYDU\GHSHQGLQJRQWKHULVNV LGHQWLILHGDQGWKHSURSRVHGODQGXVH$VDPLQLPXPDOOSURSRVHGGHYHORSPHQWLQFOXGLQJWKDWLQ )ORRG =RQH & PXVW FRQVLGHU WKH LPSDFW RI VXUIDFH ZDWHU IORRG ULVNV RQ GUDLQDJH GHVLJQ ,Q DGGLWLRQIORRGULVNIURPVRXUFHVRWKHUWKDQIOXYLDODQGWLGDOVKRXOGEHUHYLHZHG )RUVLWHVZLWKLQ)ORRG=RQH$RU%DVLWHVSHFLILF6WDJH,QLWLDO)5$ZLOOEHUHTXLUHGDQGPD\ QHHGWREHGHYHORSHGLQWRD6WDJH'HWDLOHG)5$7KHH[WHQWVRI)ORRG=RQH$DQG%DUH GHOLQHDWHGWKURXJKWKLV6)5$+RZHYHUIXWXUHVWXGLHVPD\UHILQHWKHH[WHQWV HLWKHUWRUHGXFHRU HQODUJHWKHP VRDFRPSUHKHQVLYHUHYLHZRIDYDLODEOHGDWDVKRXOGEHXQGHUWDNHQRQFHD)5$KDV EHHQWULJJHUHG :LWKLQ WKH )5$ WKH LPSDFWV RI FOLPDWH FKDQJH DQG UHVLGXDO ULVN LQFOXGLQJ FXOYHUWVWUXFWXUH EORFNDJH VKRXOGEHFRQVLGHUHGDQGUHPRGHOOHGZKHUHQHFHVVDU\XVLQJDQDSSURSULDWHOHYHORI GHWDLOLQWKHGHVLJQRIILQLVKHGIORRUOHYHOV)XUWKHULQIRUPDWLRQRQWKHUHTXLUHGFRQWHQWRIWKH)5$ LVSURYLGHGLQWKH3ODQQLQJ6\VWHPDQG)ORRG5LVN0DQDJHPHQW*XLGHOLQHV $Q\SURSRVDOWKDWLVFRQVLGHUHGDFFHSWDEOHLQSULQFLSOHVKDOOGHPRQVWUDWHWKHXVHRIWKHVHTXHQWLDO DSSURDFKLQWHUPVRIWKHVLWHOD\RXWDQGGHVLJQDQGLQVDWLVI\LQJWKH-XVWLILFDWLRQ7HVW ZKHUH UHTXLUHG WKHSURSRVDOZLOOGHPRQVWUDWHWKDWDSSURSULDWHPLWLJDWLRQDQGPDQDJHPHQWPHDVXUHV DUHSXWLQSODFH 5.5.1 Development Proposals in Flood Zone A or B &RPPHQWDU\RQWKHSURFHGXUHIRUGHYHORSLQJODQGVZLWKLQ)ORRG=RQH$RU%ZLWKLQ7XOORZDUH FORVHO\OLQNHGWKHORFDWLRQRIWKHSRWHQWLDOGHYHORSPHQWZLWKLQDGHIHQGHGRUXQGHIHQGHGDUHDRI WKHWRZQ$GGLWLRQDOFRQVLGHUDWLRQLVWKHQJLYHQWRWKHVFDOHRIWKHGHYHORSPHQWEHLWUHQRYDWLRQ PLQRULQILOORUPRUHVLJQLILFDQWQHZGHYHORSPHQW *HQHUDOO\WKHDSSURDFKWRGHDOZLWKIORRGSURWHFWLRQZRXOGLQYROYHUDLVLQJWKHJURXQGIORRUOHYHOV DERYHWKHOHYHORIH[WUHPHULYHUOHYHOV,IWKLVOHDGVWRIORRUOHYHOVEHLQJPXFKKLJKHUWKDQDGMDFHQW VWUHHWVLWFRXOGFUHDWHDKRVWLOHVWUHHWVFDSHIRUSHGHVWULDQV7KLVZRXOGFDXVHSUREOHPVIRULQILOO GHYHORSPHQWVLWHVLIIORRUOHYHOVZHUHUHTXLUHGWREHVLJQLILFDQWO\KLJKHUWKDQWKRVHRIQHLJKERXULQJ SURSHUWLHV,QWKLVUHJDUGLWKDVEHHQUHFRJQLVHGWKDWVRPHIOH[LELOLW\FRXOGEHDOORZHGZKHQZLWKLQ GHIHQGHG DUHDV RU ZKHUH WKH GHYHORSPHQW LV FRQVLGHUHG PLQRU ,Q WKHVH FDVHV WKH GHWDLOHG GHVLJQRIWKHGHYHORSPHQWVKRXOGUHIOHFWWKHYXOQHUDELOLW\RIWKHVLWHLQWHUPVRILQWHUQDOOD\RXW PDWHULDOVIL[WXUHVDQGILWWLQJVDQGLQWHUQDOOD\RXW)RUKLJKULVNDUHDVOHVVYXOQHUDEOHXVHVDUH V7XOORZ6)5$YGRF[ HQFRXUDJHGDWJURXQGIORRUOHYHOV7KHVLWHVSHFLILF)5$ZLOOLQIRUPDSSURSULDWHXVHVDQGGHWDLOHG GHVLJQDQGOD\RXW ,WVKRXOGEHQRWHGWKDWIRUUHVLGHQWLDOEXLOGLQJVZLWKLQ)ORRG=RQH$RU%EHGURRPDFFRPPRGDWLRQ LVPRUHDSSURSULDWHDWXSSHUIORRUOHYHOV )RUFRPPHUFLDORSHUDWLRQVEXVLQHVVFRQWLQXLW\PXVWEHFRQVLGHUHGDQGVWHSVWDNHQWRHQVXUH RSHUDELOLW\ GXULQJ DQG UHFRYHU\ DIWHU D IORRG HYHQW IRU ERWK UHVLGHQWLDO DQG FRPPHUFLDO GHYHORSPHQWV(PHUJHQF\DFFHVVPXVWEHFRQVLGHUHGDVLQPDQ\FDVHVIORRGUHVLOLHQFHZLOOQRW EHHDVLO\DFKLHYHGLQWKHH[LVWLQJEXLOWHQYLURQPHQW 5.5.1.1 Undefended Areas ,WLVQRWDSSURSULDWHIRUQHZKLJKO\YXOQHUDEOHGHYHORSPHQWWREHORFDWHGLQ)ORRG=RQHV$RU% SDUWLFXODUO\ZKHUHWKHUHDUHQRIORRGGHIHQFHVDQGVXFKSURSRVDOVZLOOQRWSDVVWKH-XVWLILFDWLRQ 7HVW,QVWHDGDOHVVYXOQHUDEOHXVHVKRXOGEHFRQVLGHUHG ,QJHQHUDOWKHDSSOLFDWLRQRIWKHVHTXHQWLDODSSURDFKXQGHUWKLV6)5$KDVHQVXUHGWKDWWKHUHLV RQO\DVPDOODPRXQWRIODQG]RQHGIRUYXOQHUDEOHXVHDQGWKHGHYHORSPHQWLVFDYHDWHGE\IXUWKHU DQDO\VLV DQG DYRLGDQFH VHH 6HFWLRQ WKHUHIRUH HQVXULQJ WKH FRQWLQXHG DSSOLFDWLRQ RI WKH VHTXHQWLDODSSURDFKDQGDSSURSULDWHVLWHVSHFLILF)5$ 5.5.1.2 Defended Areas ,Q DUHDV RI UHQRYDWLRQ DQGRU UHJHQHUDWLRQ ZLWKLQ WKH GHIHQGHG WRZQ FHQWUH RI 7XOORZ LW LV QRW QHFHVVDULO\GHVLUDEOHWRH[FOXGHKLJKO\DQGOHVVYXOQHUDEOHGHYHORSPHQWDOWRJHWKHU%\GHILQLWLRQ LWFDQSDVVWKH-XVWLILFDWLRQ7HVWKRZHYHUH[WUHPHO\FDUHIXOFRQVLGHUDWLRQPXVWEHJLYHQWRWKH SRVLWLRQDQGGHVLJQRIDQ\GHYHORSPHQW0LQRUVPDOOVFDOHLQILOOKRXVLQJH[WHQVLRQVRUFKDQJHV RI XVH LV GLVFXVVHG LQ 6HFWLRQ DQG VXEMHFW WR VLWH VSHFLILF IORRG ULVN DVVHVVPHQW FDQ JHQHUDOO\EHFRQVLGHUHGDSSURSULDWHDQGUHVLOLHQFHUHVLVWDQFHZLOOEHHPSOR\HG ,QFDVHVZKHUHODUJHUVFDOHQHZGHYHORSPHQWLVSURSRVHGZLWKLQWKHWRZQFHQWUHDUHDD6WDJH 'HWDLOHG)5$DQGPDQDJHPHQWSODQLVUHTXLUHGWRDFFRPSDQ\WKH3ODQQLQJ$SSOLFDWLRQ)RU WKLVW\SHRIGHYHORSPHQW7KH)5$VKRXOGLPSURYHRQWKHGHWDLOSURYLGHGE\WKH6(&)5$0DQG LQYHVWLJDWHWKHLPSDFWVRIGHIHQFHIDLOXUHEUHDFK,WVKRXOGWKHUHIRUHLQFOXGHDQH[DPLQDWLRQRI KD]DUGYHORFLW\DQGWLPHRILQXQGDWLRQDQGVKRXOGSURSRVHVXLWDEOHPDQDJHPHQWDQGPLWLJDWLRQ PHDVXUHV2ISULPHLPSRUWDQFHLVWKHUHTXLUHPHQWWRPDQDJHULVNWRWKHGHYHORSPHQWVLWHDQG QRWWRLQFUHDVHIORRGULVNHOVHZKHUH,WPD\EHQHFHVVDU\WRUDLVHWKH))/VDERYHVLJQLILFDQWIORRG OHYHOVDQGWKHGHVLJQVKRXOGJLYH GXHFRQVLGHUDWLRQWRVDIHHYDFXDWLRQURXWHVDQG DFFHVVIRU HPHUJHQF\ VHUYLFHV GXULQJ D IORRG HYHQW IXUWKHU DGYLFH RQ GHVLJQ OHYHOV DQG DVVHVVPHQW LV SURYLGHGLQ6HFWLRQEHORZ :LWKLQ WKH )5$ WKH LPSDFWV RI FOLPDWH FKDQJH DQG UHVLGXDO ULVN LQFOXGLQJ FXOYHUWVWUXFWXUH EORFNDJH VKRXOGEHPRGHOOHGDQGXVHGWRLQIRUPWKHGHVLJQDQG))/V 5.5.1.3 Note on Minor Developments 6HFWLRQ RIWKH3ODQQLQJ*XLGHOLQHV RQ)ORRG5LVN0DQDJHPHQWLGHQWLILHV FHUWDLQ W\SHVRI GHYHORSPHQW DV EHLQJ PLQRU ZRUNV DQG WKHUHIRUH H[HPSW IURP WKH -XVWLILFDWLRQ 7HVW 6XFK GHYHORSPHQW UHODWHV WR ZRUNV DVVRFLDWHG ZLWK H[LVWLQJ GHYHORSPHQWV VXFK DV H[WHQVLRQV UHQRYDWLRQVDQGUHEXLOGLQJRIWKHH[LVWLQJGHYHORSPHQWVPDOOVFDOHLQILOODQGFKDQJHVRIXVH 'HVSLWHWKHµ6HTXHQWLDO$SSURDFK¶DQGµ-XVWLILFDWLRQ7HVW¶QRWDSSO\LQJDVWKH\UHODWHWRH[LVWLQJ EXLOGLQJVDQDVVHVVPHQWRIWKHULVNVRIIORRGLQJVKRXOGDFFRPSDQ\VXFKDSSOLFDWLRQV7KLVPXVW GHPRQVWUDWH WKDW WKH GHYHORSPHQW ZRXOG QRW LQFUHDVH IORRG ULVNV E\ LQWURGXFLQJ VLJQLILFDQW QXPEHUVRIDGGLWLRQDOSHRSOHLQWRWKHIORRGSODLQDQGRUSXWWLQJDGGLWLRQDOSUHVVXUHRQHPHUJHQF\ VHUYLFHVRUH[LVWLQJIORRGPDQDJHPHQWLQIUDVWUXFWXUH7KHGHYHORSPHQWPXVWQRWKDYHDGYHUVH LPSDFWV RU LPSHGH DFFHVV WR D ZDWHUFRXUVH IORRGSODLQ RU IORRG SURWHFWLRQ DQG PDQDJHPHQW IDFLOLWLHV:KHUHSRVVLEOHWKHGHVLJQRIEXLOWHOHPHQWVLQWKHVHDSSOLFDWLRQVVKRXOGGHPRQVWUDWH SULQFLSOHV RI IORRG UHVLOLHQW GHVLJQ 6HH µ7KH 3ODQQLQJ 6\VWHP DQG )ORRG 5LVN 0DQDJHPHQW *XLGHOLQHV IRU 3ODQQLQJ $XWKRULWLHV 7HFKQLFDO $SSHQGLFHV 6HFWLRQ 'HVLJQLQJ IRU 5HVLGXDO)ORRG5LVN 7KHUHTXLUHPHQWIRUSURYLGLQJFRPSHQVDWRU\VWRUDJHIRUPLQRUGHYHORSPHQWVKDVEHHQUHYLHZHG DQGFDQJHQHUDOO\EHUHOD[HGHYHQZKHUHILQLVKHGIORRUOHYHOVKDYHEHHQUDLVHG7KLVLVEHFDXVH WKHGHYHORSPHQWFRQFHUQVODQGZKLFKKDVSUHYLRXVO\EHHQGHYHORSHGDQGZRXOGDOUHDG\KDYH V7XOORZ6)5$YGRF[ OLPLWHGFDSDFLW\WRPLWLJDWHIORRGLQJ+RZHYHUDFRPPHQWDU\WRWKLVHIIHFWPXVWEHVXEVWDQWLDWHG LQWKHVLWHVSHFLILF)5$ 5.5.2 Development proposals in Flood Zone C :KHUHDVLWHLVZLWKLQ)ORRG=RQH&EXWDGMRLQLQJRULQFORVHSUR[LPLW\WR)ORRG=RQH$RU%WKHUH FRXOGEHDULVNRIIORRGLQJDVVRFLDWHGZLWKIDFWRUVVXFKDVIXWXUHVFHQDULRV FOLPDWHFKDQJH RULQ WKHHYHQWRIIDLOXUHRIDGHIHQFHEORFNLQJRIDEULGJHRUFXOYHUW5LVNIURPVRXUFHVRWKHUWKDQ IOXYLDODQGFRDVWDOPXVWDOVREHDGGUHVVHGIRUDOOGHYHORSPHQWLQ)ORRG=RQH&$VDPLQLPXPLQ VXFKDVFHQDULRDIORRGULVNDVVHVVPHQWVKRXOGEHXQGHUWDNHQZKLFKZLOOVFUHHQRXWSRVVLEOH LQGLUHFWVRXUFHVRIIORRGULVNDQGZKHUHWKH\FDQQRWEHVFUHHQHGRXWLWVKRXOGSUHVHQWPLWLJDWLRQ PHDVXUHV7KHPRVWOLNHO\PLWLJDWLRQPHDVXUHZLOOLQYROYHVHWWLQJILQLVKHGIORRUOHYHOVWRDKHLJKW WKDW LV DERYH WKH LQ \HDU IOXYLDO IORRG OHYHO ZLWK DQ DOORZDQFH IRU FOLPDWH FKDQJH DQG IUHHERDUG RU WR HQVXUH D VWHS XS IURP URDG OHYHO WR SUHYHQW VXUIDFH ZDWHU LQJUHVV 'HVLJQ HOHPHQWVVXFKDVFKDQQHOPDLQWHQDQFHRUWUDVKVFUHHQVPD\DOVREHUHTXLUHG(YDFXDWLRQURXWHV LQWKHHYHQWRILQXQGDWLRQRIVXUURXQGLQJODQGVKRXOGDOVREHGHWDLOHG 7KHLPSDFWVRIFOLPDWHFKDQJHVKRXOGEHFRQVLGHUHGIRUDOOSURSRVHGGHYHORSPHQWV'HWDLOVRI WKH DSSURDFK WR LQFRUSRUDWLQJ FOLPDWH FKDQJH LPSDFWV LQWR WKH DVVHVVPHQW DQG GHVLJQ DUH SURYLGHGLQ6HFWLRQVDQG 5.6 Flood Mitigation Measures at Site Design )RUDQ\GHYHORSPHQWSURSRVDOZLWKLQ)ORRG=RQH$RU%WKDWLVFRQVLGHUHGDFFHSWDEOHLQSULQFLSOH LWPXVWEHGHPRQVWUDWHGWKDWDSSURSULDWHPLWLJDWLRQPHDVXUHVFDQEHSXWLQSODFHDQGWKDWUHVLGXDO ULVNV IDLOXUHRURYHUWRSSLQJRIWKHIORRGGHIHQFHVLQ7XOORZ FDQEHPDQDJHGWRDFFHSWDEOHOHYHOV 7KHDSSURDFKZLOOYDU\GHSHQGLQJRQZKHWKHUWKHGHYHORSPHQWLVORFDWHGZLWKLQDGHIHQGHGRUXQ GHIHQGHGDUHDRI7XOORZ 9DULRXVPLWLJDWLRQPHDVXUHVDUHRXWOLQHGEHORZDQGIXUWKHUGHWDLORQIORRGUHVLOLHQFHDQGIORRG UHVLVWDQFHDUH LQFOXGHGLQ WKH7HFKQLFDO$SSHQGLFHV RIWKH3ODQQLQJ*XLGHOLQHV7KH3ODQQLQJ 6\VWHPDQG)ORRG5LVN0DQDJHPHQW 5.6.1 Raised Defences ,QVWDOODWLRQRIUDLVHGGHIHQFHVKDVEHHQWKHWUDGLWLRQDOUHVSRQVHWRIORRGULVNDQG7XOORZLVDOUHDG\ VXEMHFWWRDQ)56WKDWSURWHFWVWKHFRUHWRZQFHQWUHWRD$(3VWDQGDUGRISURWHFWLRQ$UHYLHZ RIIORRGULVNDQGPDQDJHPHQWPHDVXUHVKDVUHFHQWO\EHHQFRPSOHWHGXQGHUWKH23:6(&)5$0 DQG ZLWK WKH H[FHSWLRQ RI D PLQRU ZRUNV DSSOLFDWLRQ WR SURWHFW D VLQJOH GZHOOLQJ QR IXUWKHU UHFRPPHQGDWLRQVKDYHEHHQPDGHWRH[WHQGRUFRQVWUXFWIXUWKHUGHIHQFHVLQWKHWRZQ 5.6.2 Site Layout and Design 7RDGGUHVVIORRGULVNLQWKHGHVLJQRIQHZGHYHORSPHQWDULVNEDVHGDSSURDFKVKRXOGEHDGRSWHG WRORFDWHPRUHYXOQHUDEOHODQGXVHWRKLJKHUJURXQGZKLOHZDWHUFRPSDWLEOHGHYHORSPHQWLHFDU SDUNLQJUHFUHDWLRQDOVSDFHFDQEHORFDWHGLQKLJKHUIORRGULVNDUHDV7KLVVKRXOGEHWKHSUHIHUUHG DSSURDFKIRUVLWHVORFDWHGZLWKLQWKHWRZQFHQWUHDQGVXEMHFWWRUHGHYHORSPHQW 7KH VLWH OD\RXW VKRXOG LGHQWLI\ DQG SURWHFW ODQG UHTXLUHG IRU FXUUHQW DQG IXWXUH IORRG ULVN PDQDJHPHQW :DWHUVLGH DUHDV RU DUHDV DORQJ NQRZQ IORZ URXWHV FDQ EH XVHG IRU UHFUHDWLRQ DPHQLW\DQGHQYLURQPHQWDOSXUSRVHVWRDOORZSUHVHUYDWLRQRIIORZURXWHVDQGIORRGVWRUDJHZKLOH DWWKHVDPHWLPHSURYLGLQJYDOXDEOHVRFLDODQGHQYLURQPHQWDOEHQHILWV 5.6.3 Ground levels, floor levels and building use 0RGLI\LQJ JURXQG OHYHOV WR UDLVH ODQG DERYH WKH GHVLJQ IORRG OHYHO LV D YHU\ HIIHFWLYH ZD\ RI UHGXFLQJIORRGULVNWRWKHSDUWLFXODUVLWHLQTXHVWLRQ+RZHYHULQPRVWDUHDVRIIOXYLDOIORRGULVN FRQYH\DQFHRUIORRGVWRUDJHZRXOGEHUHGXFHGKDYLQJDQDGYHUVHHIIHFWRQIORRGULVNHOVHZKHUH 7KHUHIRUHWKHUHLVDJHQHUDOUHTXLUHPHQWWKDWFRPSHQVDWRU\VWRUDJHLVSURYLGHGRQDOHYHOIRU OHYHOEDVLVZKHUHUDLVLQJJURXQGOHYHOVLVSURSRVHGLQXQGHIHQGHGDUHDV 7KH 3ODQQLQJ 6\VWHP DQG )ORRG 5LVN 0DQDJHPHQW *XLGHOLQHV IRU 3ODQQLQJ $XWKRULWLHV 7HFKQLFDO $SSHQGLFHV 1RYHPEHU V7XOORZ6)5$YGRF[ 7KLVUHTXLUHPHQWFDQEHUHOD[HGLQDUHDVEHKLQGGHIHQFHVZKHUHWKHIORRGVWRUDJHKDVDOUHDG\ EHHQORVWDQGDVVHVVHGWKURXJKWKHGHVLJQRIWKHIORRGUHOLHIVFKHPH For undefended areas: x 7KHSDUWLFXODU]RQLQJPXVWKDYHEHHQMXVWLILHGWKURXJKWKLV6)5$EDVHGRQWKHH[LVWLQJ XQPRGLILHG JURXQGOHYHOV x 7KH)5$VKRXOGHVWDEOLVKWKHIXQFWLRQSURYLGHGE\WKHIORRGSODLQ:KHUHFRQYH\DQFHLV DSULPHIXQFWLRQWKHQDK\GUDXOLFPRGHOZLOOEHUHTXLUHGWRVKRZWKHLPSDFWRILWVDOWHUDWLRQ x &RPSHQVDWRU\VWRUDJHVKRXOGEHSURYLGHGRQDOHYHOIRUOHYHOEDVLVWREDODQFHWKHWRWDO DUHDWKDWZLOOEHORVWWKURXJKLQILOOLQJZKHUHWKHIORRGSODLQSURYLGHVVWDWLFVWRUDJH x 7KHSURYLVLRQRIWKHFRPSHQVDWRU\VWRUDJHVKRXOGEHLQFORVHSUR[LPLW\WRWKHDUHDWKDW VWRUDJHLVEHLQJORVWIURP LHZLWKLQWKHVDPHIORRGFHOO x 7KH ODQG SURSRVHG WR SURYLGH WKH FRPSHQVDWRU\ VWRUDJH DUHD PXVW EH ZLWKLQ WKH RZQHUVKLSFRQWURORIWKHGHYHORSHU x 7KHODQGEHLQJJLYHQRYHUWRVWRUDJHPXVWEHODQGZKLFKGRHVQRWIORRGLQWKH$(3 HYHQW LH)ORRG=RQH%RU& x 7KHFRPSHQVDWRU\VWRUDJHDUHDVKRXOGEHFRQVWUXFWHGEHIRUHODQGLVUDLVHGWRIDFLOLWDWH GHYHORSPHQW ,QVRPHVLWHVLWLVSRVVLEOHWKDWJURXQGOHYHOVFDQEHUHODQGVFDSHGWRSURYLGHDVXIILFLHQWO\ODUJH GHYHORSPHQWIRRWSULQW+RZHYHULWLVOLNHO\WKDWLQRWKHUSRWHQWLDOGHYHORSPHQWORFDWLRQVWKHUHLV LQVXIILFLHQWODQGDYDLODEOHWRIXOO\FRPSHQVDWHIRUWKHORVVRIIORRGSODLQ,QVXFKFDVHVLWZLOOEH QHFHVVDU\WRUHFRQVLGHUWKHOD\RXWRUUHGXFHWKHVFDOHRIGHYHORSPHQWRUSURSRVHDQDOWHUQDWLYH DQGOHVVYXOQHUDEOHW\SHRIGHYHORSPHQW,QRWKHUFDVHVLWLVSRVVLEOHWKDWWKHODFNRIDYDLODELOLW\ RIVXLWDEOHDUHDVRIFRPSHQVDWRU\VWRUDJHPHDQWKHWDUJHWVLWHFDQQRWEHGHYHORSHGDQGVKRXOG UHPDLQRSHQVSDFH For defended areas: x 5DLVLQJILQLVKHGIORRUOHYHOVZLWKLQDGHYHORSPHQWLVDQHIIHFWLYHZD\RIDYRLGLQJGDPDJH WRWKHLQWHULRURIEXLOGLQJV LHIXUQLWXUHDQGILWWLQJV LQWLPHVRIIORRG5DLVLQJRI))/VLV UHFRPPHQGHGIRUFRQVLGHUDWLRQRQQHZGHYHORSPHQWRIKLJKO\YXOQHUDEOHXVHVJLYHQWKH UHVLGXDOULVNRIGHIHQFHIDLOXUHLQ7XOORZ$SSURSULDWH))/VKRXOGEHW\SLFDOO\GLUHFWHGE\ DWOHDVWPPIUHHERDUGDERYHWKHEUHDFKOHYHODWWKH$(3SOXVFOLPDWHFKDQJHDQG WKLVOHYHOVKRXOGEHDVFHUWDLQHGE\GHWDLOHGK\GUDXOLFPRGHOOLQJXQGHUDVLWHVSHFLILF)5$ x 7KHRYHUDOOLPSDFWRQWKHULVNWRVXUURXQGLQJSURSHUW\ LIVLJQLILFDQW JURXQG UDLVLQJ LV HPSOR\HG VKRXOGVWLOOEHGHILQHGE\DGHWDLOHG)5$WKDWUHSUHVHQWVDEUHDFKVFHQDULRIRU WKHGHVLJQHYHQWXQGHUSUHDQGSRVWGHYHORSPHQWVFHQDULRV$Q\VLJQLILFDQWLQFUHDVHLQ UHVLGXDOULVNWRVXUURXQGLQJSURSHUWLHVZLOOQRWEHDSSURSULDWHDQGDOWHUQDWLYHPLWLJDWLRQ VROXWLRQVVKRXOGEHLQYHVWLJDWHG x $OWHUQDWLYHO\ LW PD\ QRW EH VXLWDEOH WR UDLVH ))/V VLJQLILFDQWO\ DQG DVVLJQLQJ D ZDWHU FRPSDWLEOHXVH LHJDUDJHFDUSDUNLQJODQGVFDSLQJ RUOHVVYXOQHUDEOHXVHWRWKHJURXQG IORRUOHYHODORQJZLWKVXLWDEOHIORRGUHVLOLHQWFRQVWUXFWLRQLVDQHIIHFWLYHZD\RIUDLVLQJ YXOQHUDEOHOLYLQJVSDFHDERYHGHVLJQIORRGOHYHOV,WFDQKRZHYHUKDYHDQLPSDFWRQWKH VWUHHWVFDSH6DIHDFFHVVDQGHJUHVVLVDFULWLFDOFRQVLGHUDWLRQLQDOORFDWLQJJURXQGIORRU XVHV x 'HSHQGLQJRQWKHVFDOHRIUHVLGXDOULVNUHVLOLHQFHDQGUHVLVWDQFHPHDVXUHVPD\EHDQ DSSURSULDWHUHVSRQVHEXWWKLVZLOOPRVWO\DSSO\WROHVVYXOQHUDEOHGHYHORSPHQW 5.7 Drainage impact assessment ,WLVUHFRPPHQGHGWKDWDOOSURSRVHGGHYHORSPHQWZKHWKHULQ)ORRG=RQH$%RU&PXVWFRQVLGHU WKHLPSDFWRIVXUIDFHZDWHUIORRGULVNVRQGUDLQDJHGHVLJQ$VXLWDEOHVWDQGDUGIRUWKLVLVVSHFLILHG E\ WKH VXUIDFH ZDWHU PDQDJHPHQW SROLFLHV LQ WKH *UHDWHU 'XEOLQ 6WUDWHJLF 'UDLQDJH 6WXG\ *'6'6 &RQVLGHUDWLRQRIWKHVXUIDFHZDWHUULVNVKRXOGEHLQWKHIRUPRIDVHFWLRQZLWKLQWKH IORRGULVNDVVHVVPHQW IRUVLWHVLQ)ORRG=RQH$RU% RUSDUWRIDVXUIDFHZDWHUPDQDJHPHQWSODQ $UHDVYXOQHUDEOHWRSRQGLQJDUHLQGLFDWHGRQWKH23: V3)5$PDSSLQJUHSURGXFHGLQ)LJXUH 3DUWLFXODUDWWHQWLRQVKRXOGEHJLYHQWRGHYHORSPHQWLQORZO\LQJDUHDVZKLFKPD\DFWDVQDWXUDO SRQGVIRUFROOHFWLRQRIUXQRII V7XOORZ6)5$YGRF[ 7KH GUDLQDJH GHVLJQ VKRXOG HQVXUH QR LQFUHDVH LQ IORRG ULVN WR WKH VLWH RU WKH GRZQVWUHDP FDWFKPHQW:KHUHSRVVLEOHDQGSDUWLFXODUO\LQDUHDVRIQHZGHYHORSPHQWIORRUOHYHOVVKRXOGDW DPLQLPXPEHPPDERYHDGMDFHQWURDGVDQGKDUGVWDQGLQJDUHDVWRUHGXFHWKHFRQVHTXHQFHV RI DQ\ ORFDOLVHG IORRGLQJ :KHUH WKLV LV QRW SRVVLEOH DQ DOWHUQDWLYH GHVLJQ DSSURSULDWH WR WKH ORFDWLRQPD\EHSUHSDUHG ,QDGGLWLRQIRUODUJHUVLWHV LHPXOWLSOHGZHOOLQJVRUFRPPHUFLDOXQLWV PDVWHUSODQQLQJVKRXOG HQVXUHWKDWH[LVWLQJIORZURXWHVDUHPDLQWDLQHGWKURXJKWKHXVHRIJUHHQLQIUDVWUXFWXUH 5.8 Incorporating Climate Change into Development Design 7KH)ORRG=RQHVDUHGHWHUPLQHGEDVHGRQUHDGLO\DYDLODEOHLQIRUPDWLRQDQGWKHLUSXUSRVHLVWREH XVHGDVDWRROWRDYRLGLQDSSURSULDWHGHYHORSPHQWLQDUHDVRIIORRGULVN:KHUHGHYHORSPHQWLV SURSRVHGZLWKLQDQDUHDRISRWHQWLDOIORRGULVN )ORRG=RQH$RU% DIORRGULVNDVVHVVPHQWRI DSSURSULDWHVFDOHZLOOEHUHTXLUHGDQGWKLVDVVHVVPHQWPXVWWDNHLQWRDFFRXQWFOLPDWHFKDQJHDQG DVVRFLDWHGLPSDFWV &RQVLGHUDWLRQ RI FOLPDWH FKDQJH LV SDUWLFXODUO\ LPSRUWDQW ZKHUH IORRG DOOHYLDWLRQ PHDVXUHV DUH SURSRVHGDVWKHGHVLJQVWDQGDUGRIWKHSURSRVDOPD\UHGXFHVLJQLILFDQWO\LQIXWXUH\HDUVGXHWR LQFUHDVHGUDLQIDOODQGULYHUIORZV$VUHFRPPHQGHGE\WKHSODQQLQJJXLGHOLQHVDSUHFDXWLRQDU\ DSSURDFKVKRXOGEHDGRSWHG &OLPDWHFKDQJHPD\UHVXOWLQLQFUHDVHGIORRGH[WHQWVDQGWKHUHIRUHFDXWLRQVKRXOGEHWDNHQZKHQ ]RQLQJ ODQGVLQWUDQVLWLRQDODUHDV,Q JHQHUDO)ORRG =RQH % ZKLFKUHSUHVHQWV WKH $(3 H[WHQWFDQEHWDNHQDVDQLQGLFDWLRQRIWKHH[WHQWRIWKH$(3IORRGHYHQWZLWKFOLPDWHFKDQJH ,QVWHHSYDOOH\V VXFKDVWKHVPDOOHUWULEXWDU\VWUHDPV DQLQFUHDVHLQZDWHUOHYHOZLOOUHODWHWRD YHU\VPDOOLQFUHDVHLQH[WHQWKRZHYHULQIODWWHUORZO\LQJEDVLQVDVPDOOLQFUHDVHLQZDWHUOHYHO FDQ UHVXOW LQ D VLJQLILFDQW LQFUHDVH LQ IORRG H[WHQW KRZHYHU LW LV QRWHG WKDW WKH 5LYHU 6ODQH\ IORRGSODLQGRHVQRWLQFOXGHDODUJH YDULDWLRQ EHWZHHQ)ORRG=RQH $DQG %KRZHYHUWKH5LYHU 'HUUHHQGRHV )RUPRVWGHYHORSPHQWLQFOXGLQJUHVLGHQWLDOQXUVLQJKRPHVVKRSVDQGRIILFHVWKHPHGLXPUDQJH IXWXUHVFHQDULR LQFUHDVHLQIORZV LVDQDSSURSULDWHFRQVLGHUDWLRQ7KLVVKRXOGEHDSSOLHGLQ DOODUHDVWKDWDUHDWULVNRIIORRGLQJ LHZLWKLQ)ORRG=RQH$DQG% DQGVKRXOGEHFRQVLGHUHGIRU VLWHVZKLFKDUHLQ)ORRG=RQH&EXWDUHDGMDFHQWWR)ORRG=RQH$RU%7KLVLVEHFDXVHODQGZKLFK LV FXUUHQWO\ QRW DW ULVN PD\ EHFRPH YXOQHUDEOH WR IORRGLQJ ZKHQFOLPDWHFKDQJHLVWDNHQLQWR DFFRXQW :KHUH WKH ULVN DVVRFLDWHG ZLWK LQXQGDWLRQ RI D GHYHORSPHQW LV ORZ DQG WKH GHVLJQ OLIH RI WKH GHYHORSPHQWLVVKRUW W\SLFDOO\OHVVWKDQ\HDUV WKHDOORZDQFHSURYLGHGIRUFOLPDWHFKDQJHPD\ EH OHVV WKDQ WKH +RZHYHU WKH UHDVRQLQJ DQG LPSDFWV RI VXFKDQDSSURDFKVKRXOGEH SURYLGHGLQWKHVLWHVSHFLILF)5$$QH[DPSOHRIWKLVPLJKWEHFRPPHUFLDOXVHLQ7RZQ&HQWUH ODQGVRUPDQXIDFWXULQJXVHVSRWHQWLDOO\DWULVNRIIORRGLQJIURPWKH5LYHU%DUURZ &RQYHUVHO\ WKHUH PD\ EH GHYHORSPHQW ZKLFK UHTXLUHV D KLJKHU OHYHO UHVSRQVH WR FOLPDWH FKDQJH 7KLV FRXOG LQFOXGH PDMRU IDFLOLWLHV ZKLFK DUH H[WUHPHO\ GLIILFXOW WR UHORFDWH VXFK DV KRVSLWDOV 6HYHVR VLWHV RU ZDVWH ZDWHU WUHDWPHQW SODQWV DQG WKRVH ZKLFK UHSUHVHQW D KLJK HFRQRPLFDQGORQJWHUPLQYHVWPHQWZLWKLQWKHVFDOHRIGHYHORSPHQWRIWKHVSHFLILFVHWWOHPHQW,Q VXFKVLWXDWLRQVLWZRXOGEHUHDVRQDEOHWRH[SHFWWKHKLJKHQGIXWXUHVFHQDULR LQFUHDVHLQ IORZ WREHXVHGDVWKHGHVLJQVWDQGDUG )XUWKHU FRQVLGHUDWLRQ WR WKH SRWHQWLDO IXWXUH LPSDFWV RI FOLPDWH FKDQJH ZLOO EH JLYHQ IRU HDFK VHWWOHPHQWZLWKLQ6HFWLRQ V7XOORZ6)5$YGRF[ 6 Settlement Review ,Q WKH IROORZLQJ VHFWLRQV D UHYLHZ RI IORRG ULVN WR NH\ VLWHV KDV EHHQ SURYLGHG DORQJ ZLWK UHFRPPHQGDWLRQVIRUWKHGHYHORSPHQWRIWKHVHVLWHV5HIHUHQFHLVPDGHWRJHQHUDOPDQDJHPHQW PHDVXUHVWKDWDUHGLVFXVVHGLQPRUHGHWDLOXQGHU6HFWLRQRIWKLVUHSRUW )RUHDFKVLWHFRQVLGHUDWLRQRIIORRGULVNZLOOEHUHTXLUHGDWWKHGHYHORSPHQWPDQDJHPHQWVWDJHRI WKHSODQQLQJSURFHVV7KLVUDQJHVIURPDQDVVHVVPHQWRIVXUIDFHZDWHUGUDLQDJHIRUVLWHVZLWKLQ )ORRG=RQH&WRPRUHFRQVLGHUHG)5$VIRUVLWHVLQ)ORRG=RQH$DQG%7KHFRQVWUXFWLRQRIDQ\ VLJQLILFDQWQHZUHGHYHORSPHQWEHKLQGWKHIORRGGHIHQFHVLQ7XOORZZLOOQHFHVVLWDWHWKDWDGHWDLOHG IORRGULVNDVVHVVPHQWZLOOEHUHTXLUHGWRGHILQHUHVLGXDOIORRGULVNDQGOHDGPLWLJDWLRQGHVLJQEXW LQRWKHUDUHDVLWLVJHQHUDOO\SRVVLEOHWRXQGHUVWDQGULVNVWKURXJKDQLQLWLDO)5$ZLWKRXWLQFXUULQJ WKHFRVWDQGWLPHLQSXWUHTXLUHGIRUDGHWDLOHG)5$ ,QDOOFDVHVWKHDGYLFHRQIORRGPLWLJDWLRQIRUVLWHGHVLJQFRQWDLQHGLQ6HFWLRQVKRXOGEHIROORZHG DORQJZLWKDQ\VLWHVSHFLILFUHFRPPHQGDWLRQVGHWDLOHGLQWKHIROORZLQJVHFWLRQV 6.1 Residential Lands Adjacent to Slaney Residential Lands Adjacent to Slaney Flood Zone Data 23:&)5$0PDSSLQJ-%$VLWHYHULILHG 3RWHQWLDOIORRGULVNIURP5LYHU6ODQH\WRH[LVWLQJ Flood Risk Overview UHVLGHQWLDOODQGV Sensitivity to Climate Change /RZ0RGHUDWH %DOO\PXUSK\7XOORZURDGUHFXUULQJSOXVOLNHO\UHFXUULQJ Historical Flooding IORRGLQJRIWKHIORRGSODLQ Comment: 6RPHH[LVWLQJUHVLGHQWLDOODQGVDUHDWULVNRIIORRGLQJIURPWKH5LYHU6ODQH\7KH23:6( &)5$0KDVUHFRPPHQGHGDPLQRUZRUNVVFKHPHWRHQDEOHSURWHFWLRQLQWKLVDUHD$Q\ 8QGHYHORSHGODQGVZLWKLQ)ORRG=RQH$%DUHDSSURSULDWHO\]RQHGDVDPHQLW\DQGRSHQ VSDFH )XWXUHDSSOLFDWLRQVIRUUHGHYHORSPHQWRQDQ\UHVLGHQWLDOVLWHVRQRUDGMDFHQWWR)ORRG=RQH $%ZLOOUHTXLUHDQ)5$DWGHYHORSPHQWPDQDJHPHQWVWDJHLQDFFRUGDQFHZLWKWKH UHTXLUHPHQWVVWDWHGXQGHU6HFWLRQRIWKLV6)5$ V7XOORZ6)5$YGRF[ 6.2 Town Centre Town Centre 26 26 23: &)5$0 PDSSLQJ -%$ VLWH YHULILHG 'HIHQFHV LQ SODFH ZKLFK SURYLGH D $(3 Flood Zone Data VWDQGDUG RI SURWHFWLRQ 7KH ZHVW EDQN RI WKH 6ODQH\LQFOXGHVGHPRXQWDEOHGHIHQFHV 3RWHQWLDOIORRGULVNIURP5LYHU6ODQH\IURP)ORRG =RQH$ %WRWKHFRUHRIWKHWRZQ7KHIORRGSODLQ UHPDLQVUHODWLYHO\QDUURZDQGIORRGGHSWKVLQWKH Flood Risk Overview IORRGSODLQ DUH OLNHO\ WR PLUURU WKDW RI WKH PDLQ FKDQQHO7RZQLVSURWHFWHGWR$(3VWDQGDUG EXWUHVLGXDOULVNRIIORRGLQJUHPDLQVDQGLVDNH\ FRQVLGHUDWLRQ Sensitivity to Climate Change 0RGHUDWH 6LJQLILFDQW KLVWRULFDO IORRGLQJ SULRU WR WKH Historical Flooding LQVWDOODWLRQRIWKH7XOORZ)56 Comment: 7KHWRZQFHQWUHODQGVFRQWDLQVLJQLILFDQWDUHDVWKDWDUHZLWKLQWKHGHIHQGHG)ORRG=RQH$DQG )ORRG =RQH % 0LQRU DSSOLFDWLRQV IRU UHGHYHORSPHQW DQG RUUHQRYDWLRQ VKRXOG DSSO\ WKH SULQFLSOHVRXWOLQHGZLWKLQ6HFWLRQDQG7KHIRFXVLVRQPDQDJLQJWKHSRWHQWLDOUHVLGXDO IORRGULVNVWRWKHGHYHORSPHQWDQGPDLQWDLQLQJVDIHDFFHVVDQGHJUHVV 7KHSRWHQWLDOIRUODUJHVFDOHUHGHYHORSPHQWLVOLPLWHGWRWZRRSSRUWXQLW\VLWHV2SSRUWXQLW\6LWH 26 LVWKH0LOO6WUHHW&DU3DUNRSSRVLWHWKH&RXQFLOEXLOGLQJV2SSRUWXQLW\6LWH 26 LV ORFDWHGRQERWKVLGHVRI7KRPDV7UD\QRU5RDGQHDULWVMXQFWLRQZLWKWKH1%RWKVLWHVDUH SDUWLDOO\ZLWKLQ)ORRG=RQH$%DQGWKHLUUHGHYHORSPHQWUHTXLUHVDJUHDWHUOHYHORIDVVHVVPHQW DQGFRQVLGHUDWLRQ $VZKHQVLJQLILFDQWQHZGHYHORSPHQWLVSURSRVHGZLWKLQ26RU26LWVKRXOGEHDFFRPSDQLHG E\DVLWHVFDOHGHWDLOHGPDQDJHPHQWSODQDQG)5$ZKLFKZRXOGEXLOGXSRQWKHRXWSXWVRIWKH V7XOORZ6)5$YGRF[ Town Centre 6(&)5$0EXWVKRXOGDOVRLQFOXGHDQH[DPLQDWLRQRIKD]DUGYHORFLW\DQGWLPHRILQXQGDWLRQ DQGVKRXOGSURSRVHVXLWDEOHPDQDJHPHQWDQGPLWLJDWLRQPHDVXUHVDORQJZLWKDQHPHUJHQF\ SODQLQWKHHYHQWRIGHIHQFHIDLOXUH,WLVSDUWLFXODUO\LPSRUWDQWWKDWWKHFDSDELOLW\RIEOXHOLJKW VHUYLFHVWRPDQDJHWKHDGGLWLRQDOULVNVEHDGGUHVVHG 26LVVXEMHFWWRDJUDGXDOLQFUHDVHLQJUDGLHQWLQDQRUWKHDVWHUO\GLUHFWLRQWRZDUGV0LOO6WUHHW SRWHQWLDOLQXQGDWLRQGHSWKVJUDGXDWHIURPPRUOHVVWR]HURDVWKHVLWHPRYHVXSDQGRXWRI WKHIORRGSODLQ,WLVUHFRPPHQGHGWKDW))/VRIDQ\ KLJKO\ YXOQHUDEOHXVHLVNHSWDERYHWKH GHVLJQIORRGOHYHOSOXVIUHHERDUGRIDWOHDVWPPDQGWKDWHPHUJHQF\DFFHVVLVUHWDLQHGWR )ORRG=RQH&DWWKH0LOO6WUHHWVLGHRIWKHGHYHORSPHQW 26LVVSOLWHLWKHUVLGHRI7KRPDV7UD\QRU5RDG/DQGVRQWKHULYHUVLGH QRUWK RIWKHURDGDUH ORZO\LQJDQGJLYHQWKHSRWHQWLDOIORRGGHSWKV !P RQWKHVLWHLQDEUHDFKFRQGLWLRQLWLVXQOLNHO\ WKDW ))/V LQ H[FHVV RI EUHDFK OHYHOV ZLOO EH IHDVLEOH $V VXFK WKHVH ODQGV VKRXOG RQO\ EH FRQVLGHUHGIRUOHVVYXOQHUDEOHODQGXVHV/DQGVWRWKHVRXWKRI7KRPDV7UD\QRU5RDGDUHDWD KLJKHUHOHYDWLRQDQGLQFOXGHDUHDVRI)ORRG=RQH&3RWHQWLDOIORRGGHSWKVJUDGHIURPPWR ]HURDVWKHVLWHPRYHVXSDQGRXWRIWKHGHIHQGHGIORRGSODLQ7KHODQGVDUHVXLWDEOHIRUKLJKO\ RUOHVVYXOQHUDEOHXVHDQGFRQVLGHUDWLRQFDQDOVREHJLYHQWRHQVXULQJ))/VDUHDERYHSRWHQWLDO EUHDFKOHYHOV$Q\)5$IRUWKLVVLWHPXVWLQYHVWLJDWHWKHLVVXHRIWKHVWDQGDUGRISURWHFWLRQDW WKHGRZQVWUHDPZHVWHUQEULGJHSDUDSHWDVGLVFXVVHGLQ6HFWLRQ,WZLOOEHQHFHVVDU\WR OLDLVHZLWK&DUORZ&RXQW\&RXQFLOWRHQVXUHWKDWWKHSURWHFWLRQLVIXQFWLRQLQJDVGHVLJQHG 5HIHUWR6HFWLRQDQGIRUIXUWKHUJXLGDQFHIRUWKHRSSRUWXQLW\VLWHVDQGWKHUHTXLUHPHQWV IRUIXUWKHUDVVHVVPHQWDQG))/V *LYHQ WKH UHVWULFWHG IXQFWLRQ RI WKH VXUIDFH ZDWHU GUDLQDJH GXULQJ KLJK ULYHU OHYHOV WKH FRQVLGHUDWLRQRIVXUIDFHZDWHUGUDLQDJHVKRXOGEHJLYHQDSSURSULDWHFRQVLGHUDWLRQDWGHVLJQ VWDJH7KLVLVPRVWUHOHYDQWWRWKHRSSRUWXQLW\VLWHVDQGJXLGDQFHLVSURYLGHGZLWKLQ6HFWLRQ )RUDQ\UHGHYHORSPHQWRIH[LVWLQJUHVLGHQWLDOODQGVORFDWHGWRWKHQRUWKZHVWRIWKHWRZQFHQWUH DQDSSURSULDWHO\GHWDLOHG)5$ZLOOEHUHTXLUHGLQOLQHZLWKWKHFRQVLGHUDWLRQVVWLSXODWHGZLWKLQ 6HFWLRQ V7XOORZ6)5$YGRF[ 6.3 Lands to the south of the Town Centre Land to the south of the Town Centre Flood Zone Data 23:&)5$0PDSSLQJ-%$VLWHYHULILHG 3RWHQWLDOIORRGULVNIURP5LYHU6ODQH\IURP)ORRG=RQH Flood Risk Overview $ %8QGHYHORSHGUHVLGHQWLDODQGLQGXVWULDOODQGDW SRWHQWLDOULVN Sensitivity to Climate Change 0RGHUDWH 1RQHUHFRUGHGIRU5LYHU6ODQH\KRZHYHUOLNHO\ Historical Flooding UHFXUULQJLQXQGDWLRQRIWKHIORRGSODLQ Comment: 7KHIORRGSODLQGRZQVWUHDPRIWKHWRZQFHQWUHODUJHO\FRPSULVHVRIDPHQLW\DQGRSHQVSDFH ODQGVDQGLVDSSURSULDWHO\]RQHG6RPHH[LVWLQJUHVLGHQWLDOODQGLVORFDWHGDGMDFHQWWRWKH 6ODQH\DQGLVDWSRWHQWLDOULVN$Q\IXWXUHUHGHYHORSPHQWSURSRVDOVVKRXOGEHVXEMHFWWRDQ DSSURSULDWHO\GHWDLOHG)5$LQDFFRUGDQFHZLWK6HFWLRQRIWKH6)5$ V7XOORZ6)5$YGRF[ 6.4 Lands adjacent to Mount Wolseley and Tullowphelim Streams Lands adjacent to Mount Wolseley and Tullowphelim Streams 7XOORZSKHOLP6WUHDP 0RXQW:ROVHOH\6WUHDP Flood Zone Data 23:&)5$0PDSSLQJ-%$VLWHYHULILHG 3RWHQWLDOIORRGULVNIURPWKHWZRVPDOOWULEXWDULHVLV PLQLPDO KRZHYHU WKH UHVLGXDO ULVN RI FXOYHUW Flood Risk Overview EORFNDJH PXVW EH FRQVLGHUHG DW GHYHORSPHQW PDQDJHPHQWVWDJH Sensitivity to Climate Change 0RGHUDWH Historical Flooding 1RQHIRXQG Comment: 7KHWZRPLQRUZDWHUFRXUVHVIORZLQJLQWRWKH6ODQH\DUHWKH0RXQW:ROVHOH\DQG7XOORZSKHOLP 6WUHDPV7KHZDWHUFRXUVHVKDYHEHHQPRGHOOHGXQGHUWKH&)5$0DQGGRQRWLQGLFDWHDQ\ VLJQLILFDQWULVNWRDGMDFHQWODQGV([LVWLQJ]RQLQJLVVWLOOUHFRPPHQGHGWRKDYHDJUHHQFRUULGRU DGMDFHQWWRWKHFKDQQHOWRIDFLOLWDWHPDLQWHQDQFHZD\OHDYHDQGPDLQWDLQRSHQVSDFH7KH ZLGWKRIWKLVPDUJLQFDQEHGLVFXVVHGDQGDJUHHGZLWK&DUORZ&RXQW\&RXQFLO $VXLWDEO\GHWDLOHG)5$VKRXOGEHSURYLGHGIRUDQ\GHYHORSPHQWDGMDFHQWWRWKHVWUHDPVRU QHDUWRDFXOYHUWFURVVLQJ7KH)5$FDQPDQDJHVLWHGHVLJQDWGHYHORSPHQWPDQDJHPHQW VWDJHEXWWKHUHVLGXDOULVNRIFXOYHUWEORFNDJHZLOOQHHGWREHVSHFLILFDOO\LQYHVWLJDWHGLQDOO FDVHVDQGLWPXVWEHGHWHUPLQHGWKHVLWHGHVLJQFDQPDQDJHWKHSRWHQWLDOUHVLGXDOULVN5HIHU WR6HFWLRQRIWKH6)5$ V7XOORZ6)5$YGRF[ 6.5 Lands to east of Tullow Lands to east of Tullow Flood Zone Data 23:&)5$0PDSSLQJ-%$VLWHYHULILHG 3RWHQWLDO IORRG ULVN IURP 'HUUHHQ 5LYHU WR H[LVWLQJ UHVLGHQWLDOVLWHDQGWRODQG]RQHGIRUDJULFXOWXUDOXVHV Flood Risk Overview &RSSHQDJK 6WUHDP DSSURDFKHV IURP QRUWK ZHVW DQG IORRGVDJULFXOWXUDOODQGDVDUHVXOWRIWKHOLPLWHGFDSDFLW\ RIDIDUPFXOYHUW Sensitivity to Climate Change 0RGHUDWH Historical Flooding 6RPHUHFXUULQJURDGIORRGLQJPHQWLRQHG Comment: 6RPH H[LVWLQJ GHYHORSHG UHVLGHQWLDO ODQGV H[WHQG LQWR )ORRG =RQH $% $Q\ IXWXUH UH GHYHORSPHQWSURSRVDOVVKRXOGEHVXEMHFWWRDQDSSURSULDWHO\GHWDLOHG)5$LQDFFRUGDQFHZLWK 6HFWLRQRIWKH6)5$ $Q\UHGHYHORSPHQWZLWKLQWKHLQVWLWXWLRQDOODQGV QXUVLQJKRPH DQGWKHXSVWUHDPUHVLGHQWLDO ODQGZLOOUHTXLUHGHWDLOHG)5$WRHQVXUHDSSURSULDWH))/VGHVLJQDQGDQ\SRWHQWLDOLQWHUDFWLRQ ZLWKWKHXQGHUFDSDFLW\DJULFXOWXUDOFXOYHUWDJDLQWKLVPXVWEHLQDFFRUGDQFHZLWK6HFWLRQRI WKH6)5$ V7XOORZ6)5$YGRF[ 7 SFRA Review and Monitoring $QXSGDWHWRWKH6)5$ZLOOEHWULJJHUHGE\WKHVL[\HDUUHYLHZF\FOHWKDWDSSOLHVWR/RFDO$XWKRULW\ GHYHORSPHQWSODQV,QDGGLWLRQWKHUHDUHDQXPEHURIRWKHUSRWHQWLDOWULJJHUVIRUDQ6)5$UHYLHZ DQGWKHVHDUHOLVWHGLQWKHWDEOHEHORZ 7KHUHDUHDQXPEHURINH\RXWSXWVIURPSRVVLEOHIXWXUHVWXGLHVDQGGDWDVHWVZKLFKVKRXOGEH LQFRUSRUDWHG LQWR DQ\ XSGDWH RI WKH 6)5$ DV DYDLODELOLW\ DOORZV1RWDOOIXWXUHVRXUFHVRI LQIRUPDWLRQVKRXOGWULJJHUDQLPPHGLDWHIXOOXSGDWHRIWKH6)5$ KRZHYHUQHZLQIRUPDWLRQVKRXOG EHFROOHFWHGDQGNHSWDORQJVLGHWKH6)5$XQWLOLWLVXSGDWHG 7XOORZZLOOEHVXEMHFWWRDGHWDLOHGIORRGULVNPDSSLQJDQGPDQDJHPHQWVWXG\XQGHUWKH&)5$0 ODWHULQ,WZLOOEHQHFHVVDU\WRUHYLHZWKHUHVXOWVDQGUHFRPPHQGDWLRQVRIWKH&)5$0ZLWK UHVSHFWWRWKH/$3ZKHQUHVXOWVDUHILQDOLVHG)LQDOLVHG&)5$0IORRGPDSSLQJZLOODOVREHPDGH DYDLODEOHDQGWKLVVKRXOGEHUHYLHZHG 'HWDLOHG VLWH VSHFLILF )5$V PD\ EH VXEPLWWHG WR VXSSRUW SODQQLQJ DSSOLFDWLRQV :KLOVW WKHVH UHSRUWVZLOOQRWWULJJHUDUHYLHZRIWKH)ORRG=RQHPDSVRU6)5$WKH\VKRXOGEHUHWDLQHGDQG UHYLHZHGDVSDUWRIWKHQH[WF\FOHRIWKH'HYHORSPHQW3ODQ 7DEOH6)5$5HYLHZ7ULJJHUV Possible Trigger Source Timescale 23:XQGHU &DWFKPHQW)ORRG5LVN$VVHVVPHQWDQG0DQDJHPHQW WKH)ORRGV &)5$0 )ORRG+D]DUG0DSSLQJ)LQDO 'LUHFWLYH DQG 6RXWK(DVWHUQ5LYHU%DVLQ)ORRG5LVN0DQDJHPHQW3ODQ 23: \HDUO\ UHYLHZV )ORRGPDSVRIRWKHUVRXUFHVVXFKDVGUDLQDJHQHWZRUNV 9DULRXV 8QNQRZQ 6LJQLILFDQWIORRGHYHQWV 9DULRXV 8QNQRZQ 'R(+/* &KDQJHVWR3ODQQLQJDQGRU)ORRG0DQDJHPHQW3ROLF\ 8QNQRZQ 23: V7XOORZ6)5$YGRF[ 5HJLVWHUHG2IILFH 24 Grove Island Corbally Limerick Ireland W H LQIR#MEDFRQVXOWLQJLH JBA Consulting Engineers and Scientists Limited Registration number 444752 Visit our website www.jbaconsulting.ie CIVIC and COMMUNITY FACILITIES IN TULLOW Pre-Schools – Tots to Teens (Full Day Child Care), Chatterbox Playschool and Absolute Beginners Playschool Primary Schools – Scoil Naomha Padraig, Scoil Mhuire Lourdes and St. Columba’s National School Secondary School - Tullow Community School incorporating St. Anne’s Post Leaving Certificate Courses Doctors Surgeries – Dr. John Murray and Dr. Eithne Bolger Dentist – Tullow Dental Centre H.S.E. – Tullow Health Centre Care Organisations – Tullow Day Care Centre for the Elderly, Tullow Cairdeas Centre and St. Patrick’s Cheshire Home Civic – Tullow Civic Centre incorporating Tullow Branch Library, Tullow CRISP (computer training centre) and the Housing Department of Carlow County Council. Family Development – Forward Steps Family Resource Centre Sports Clubs with Grounds – Tullow Rugby Club (Senior and Juvenile), St. Patrick’s G.F.C. (Senior and Juvenile), Parkville United Soccer Club (Senior and Juvenile) and Tullow and South Leinster Tennis Club Churches – The Church of the Most Holy Rosary (Roman Catholic) and St. Columba’s Church (Church of Ireland) Supermarkets – Tesco, Aldi, Lidl and Supervalu Department of Social Protection – Branch Office on Abbey Street Broadband – Tullow Telephone Exchange is Broadband enabled Town Park – Town Park and Children’s Playground and Skateboard Park Museum – Tullowphelim Historical Society Limited Nursing Home – Glendale Nursing Home Garda – Tullow Garda Station Fire Service – Tullow Fire and Rescue Station Resort – Mount Wolseley – golf, spa, gym and pool CLUB and SOCIETIES in TULLOW SPORTS Tullow Rugby Club St. Patrick’s G.F.C. (incorporating a 900 metre walking track) St. Anne’s G.F.C. (Ladies) Tullow / Grange Community Games St. Patrick’s Athletic Club Tullow Tae Kwon Do Club Tullow Golfing Society Tullow Angling Club Tullow Amateur Boxing Club Tullow Snooker Club Tullow and South Leinster Tennis Club Tullow Kayak Club Slaney Valley Cycling Club Emerald Darts Academy Naomh Padraig Bowls Club ARTISTIC and CULTURAL Tullow Stage School Dowsa Flanagan Kirwan School of Irish Dancing FARMING Tullow I.F.A. Tullow Macra na Fierce Tullow Sheep Breeders Association Tullow Agricultural YOUTH Tullow Youth Project (Bishop’s House) Tullow Baton Twirlers Club Tullow Scouts Tullow Girls Friendly Society Tullow Boys’ Brigade COMMUNITY Develop Tullow Association Limited DTA Tullow Tidy Towns DTA Tullow Traders DTA St. Patrick’s Day Parade OTHER Tullow Group Mothers’ Union Tullow Men’s Shed Tullow Active Retirement Association Tullow Bingo Tullow Bridge Club Tullow Vintage Club