DOCSLIB.ORG

Page 1 01 23 23 45676896 6 5 5 7 6 6 6 896 5 559 6 !" $ % & & % ' )*++

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Page 1 01 23 23 45676896 6 5 5 7 6 6 6 896 5 559 6 ! @ 7 9 ' 2)#&& 2"#&& %$#&'ÿ)01 %$#&'ÿ)01 ÿ 34ÿ6 0 8 $ ÿ &8 &0 &7 !)#$ !"#$ %$#&'ÿ)01 %$#&'ÿ)01 h fg cCe HW cdF HW ipqrs"ÿ8t8#8u ¡{ÿ¥{{yzÿ­}|¯ yy{ÿ¡¬¨y±¨ VWIWTW`Y`SabFHaU`W vwwrss"!w"2ÿvi HY sus"ÿx"q"yuypv!ÿv2"sx" y{{ÿyÿ­ ¯ yy{ÿu{yÿ°y{ x"q"yuypv!ÿ2r"1"!yuÿs"vsy yy{ÿ{{ÿ{ÿyyÿ~y} yy{ÿyÿ«{ ivsÿy"ÿsvv2"ÿ!vxuÿqu2ÿysu!21p22pv!ÿyt {zÿ{ÿ{yz $ &'ÿ!qyÿ22y"1ÿ"u!2pv! RSTUVWXFXFXF p"q"ÿuy"suÿvvÿ!vt$ÿ"pwu!ÿu"ÿ2"wypv! QF tuvÿxyz{ÿ|}~ IP { ÿ}|ÿuÿ}|ÿ~ÿ{z{ÿÿ{ÿ{yÿyÿ{y © | {{{ÿ}| }ª HF ÿyy{ÿ{z{ÿ¡y¢zÿ£ÿ¤yyz ÿ~uÿ}| ¡{ÿ¥{{yz ÿ¦}vÿ¦ÿz{ÿzÿÿ}|ÿ¦yy ÿ~¡zÿ}§¨}||ÿ ÿ©ÿ}ª || ÿdÿefÿgÿdhfgÿÿiejÿhÿdÿhdÿhgkÿdddfÿhfflehmÿneÿÿmhhÿfmÿÿgdhÿefÿodmlÿ v{ÿ ÿ«¡ ¬{{ÿ ÿ dÿegÿÿodmlÿefpqÿfdfÿpÿfÿmhhÿhdÿhmjefmÿhÿdddfÿegÿÿmhhÿrhkÿiÿodfgs ­©ÿyyzÿ©y®{¯ ABCCDEFG NOVA Gas Transmission Ltd. Supplemental Vegetation Technical Report 2017 NGTL System Expansion September 2015/650026/650027/650028/650029/652265/652345/664501 3.4 Non-Native and Invasive Species 3.4.1 Results of the Desktop/Literature Review Results of the non-native and invasive species desktop/literature review is provided in the Vegetation Technical Report (Appendix 8A of the ESA) (NEB Filing IDs: A4K2V6 and A4K2V7), and is not repeated here. 3.4.2 Results of the Field Data Collection No Prohibited Noxious weeds were observed along the proposed pipeline routes or compressor stations. Two Noxious weeds (Canada thistle [creeping thistle] and perennial sow-thistle) were observed along the all Project components, except for the Alces River Unit Addition. A list of all weed species observed during the vegetation survey for each proposed pipeline route and compressor station is provided in Appendices B to G. Where Alberta Weed Control Act: Weed Control Regulation (Province of Alberta 2010) nomenclature differs from the ACIMS List of Elements (AEP 2015a), the ACIMS name for the species has been provided in brackets following the Weed Control Act name. Weed location and abundance data are presented in Appendix H. The density classes presented in Appendix I follow the density distribution guide provided in the ASRD Rangeland Health Assessment Guide (Adams et al. 2009). Boundary Section Canada thistle (Appendix A, Plate 28) density was low during the vegetation survey. Patches of Canada thistle were observed in riparian areas located at NE 6-87-12 W6M and SE 36-85-13 W6M. A single Canada thistle plant was observed growing in a riparian area located at NE 1-86-13 W6M (Figure 3.4-1). Bear Canyon Section Canada thistle density was low during the vegetation survey. A few individuals were observed at SE 5-79-9 W6M to NE 5-79-9 W6M and SE 8-80-10 W6M in a deciduous forest and a riparian area, respectively. A single patch was observed in a wetland at NE 13-79-10 W6M (Figure 3.4-2). Pelican Lake Section Perennial sow-thistle (Appendix A, Plate 29) density was low during the vegetation survey. A single patch of perennial sow-thistle was observed growing in dugout located at NW 18-86-18 W4M (Figure 3.4-3). Christina River Section Perennial sow-thistle density was low during the vegetation survey. A few individuals were observed in a cutblock located at SE 23-80-6 W4M (Figure 3.4-4). Alces River Unit Addition No Prohibited Noxious or Noxious weed species were observed on the proposed Alces River Unit Addition. Otter Lake Unit Addition Canada thistle density was low during the vegetation survey. A few plants were observed in a cleared area spanning SE 10-91-16 W5M to SW 11-91-16 W5M (Figure 3.4-5). Page 52 A !"#"$" %&'(%)0 123004'#5 %&'(%)06 78'@ uvwxy £|~ ~z|z±£² ||~z¤°¬|³¬ !!xyy! u ||~z| ° ~zy}}~z|| vx !v y ||~zx~| z©| ~ |¥} z~z~|} wv x yy uy y w yvv |¨|¥z©~~ ||~z|z¯~ w v 1y vv x y !v6 wxyz{|}~z ­ ~ zzxzzz~}~zz ~z~|z| z ¡ ~¡|¢ ~~~ z £ ||~z~}~z¤|¥}¦§|| }zxz¢ |¨|¥z©~~zªyzªz}~ z}z¡z¢zª ||z¤}z«¬¢z z­z®¡ defgfehiejegfkijeelfhfmfekefgfekgfekjnefgggiekiiohkfpeqhefepkkeifpeedfjfgkfehiergpoe y~zz¯¤ °~~zz gehjefergpoehifsteifgiesefifepkkekgfekpmhifpekefgggiehjefepkkeuknelfergfifjv ±­z||}z­ |¨~² BCDDEBFGHFIPQFRSTUVWXYF`FaFbcdScUXeWWfGgWhSWXipXWVqWfFHcUrWHWqaFHWqDstdf B ! 89(A "#$#%# &'()&01 234115($6 &'()&017 vwxy £|~ ~z|z±£² ||~z¤°¬|³¬ ""y" v ||~z| ° ~zy}}~z|| wy "w ||~zx~| z©| ~ |¥} z~z~|} xw y v x ww |¨|¥z©~~ ||~z|z¯~ ! x w 2 ww y "w7 wxyz{|}~z ­ ~ zzxzzz~}~zz ~z~|z| z ¡ ~¡|¢ ~~~ z £ ||~z~}~z¤|¥}¦§|| }zxz¢ |¨|¥z©~~zªyzªz}~ z}z¡z¢zª ||z¤}z«¬¢z z­z®¡ defgfehiejegfkijeelfhfmfekefgfekgfekjnefgggiekiiohkfpeqhefepkkeifpeedfjfgkfehiergpoe y~zz¯¤ °~~zz gehjefergpoehifsteifgiesefifepkkekgfekpmhifpekefgggiehjefepkkeuknelfergfifjv ±­z||}z­ |¨~² CDEEFCGHIGPQRGSTUVWXY`GaGbGcdeTdVYfXXgHhXiTXYpqYXWrXgGIdVsXIXrbGIXrEtueg I & % " $ # DE.GH ()0)1)2345267 89@77A40B2345267C ! !" ' "'&( ª¢ ¥ ¥¸ª¹ ¦ «·¥³º³§ (("("! ¦ ¥·§ ¥¢ ¦ !""!"("!!"" ¦ ¦°£¦ ¡¬£ ¥ " "!" "" "!" !! !! ¯¬° ¦ ¶ £ $ !!" "! 8"! "d"!"(C ~ ´ ¡¢£¡ ¤ ¥¦§§§¨ ¢£ ¨© ¦¥ ª¦ ¦ ¢ «¬¥­®¥¦¥¤© ¯¬° ±± ¥¨©±¢«²³©¤´¢¥µ¨ efghijkhlghmnmloplqilnmrpiqlgilsmfomtmlghrglghmnmlrnmlrqulmnninplrppivorgmwlxoghlghmlwrgrljpmwlgilkmqmnrgmlghoplyniwjvgl ¦¦ ¡¶« · £ ¡ inloqlghmlyniwjvglogpmfz{ljpmnplizlghmpmlwrgrlrnmlrwtopmwlghrglmnninploqlghmlwrgrl|rulsmlynmpmqg} ¸´¢¢¥´¦¦¯¥ ¹ PQRRSPTUVTWXYT`abcdefgThTiTpqraqcfseetUuevaefwxfedyetTVqceVeyiTVeyRrt @ 56%9 ! " #$%&#'( )01((2%!3#$%&#'(4 56%8 uvwxy ¡z||xzx¯¡° zz|xzx­| xyyu zz|x~z®|xw{{|xzzx~z ±²%±³& ((" vx vy |x{z{x|z{ ¦|{ wvx y y zz|x¢®ªz´ª uy y wyvv w v zz|xv|zx§z| «| )y vv yv4 uvwxyz{|x}}~ « } | x}xvx}x~x|{|xx|x|zxzx|z |||x} © ¡xzz|x|{|x¢z£{¤¥zz{ x~vx} x ~z¦z£x§|| x¨wx¨x{|x{xx} x¨zz x~¢{x©ª}} x x«x¬ } } cdedcfgchcedighccjdfdkdcicdedciedcihlcdeeegciggmfidncofcdcniicgdnccdhdeidcfgcpenmc w|x x­v ®||x x ecfhcdcpenmcfgdqrcgdegcqcdgdcniiciedcinkfgdncicdeeegcfhcdcniicsilcjdcpedgdht ¯«xzz{x«z¦|° ABCCDEFGHFIPQFRSTUVWXFYFDF`abSaUcdWWeGfWgSWchicWVpWeFHaUqWHWprFHWpCstbe 9 ! " #$%&#'( )01((2%!3 #$%&#'(4 56%8 tuvwx y y{{wyw® ¯ yy{wyw¬{ wxx t yy{w}y­{wvzz{wyyw}y °±%°²& ((" uw u x {wzyzw{yz ¥{z vu w xx yy{w¡­©y³© tx x v xuu y v u yy{wu{yw¦y{ ª{ )x uu y x u4 tuvwxyz{w||} ª| ~{w |wuw |w}w{z{ww{w{ywyw{y {{{w | ¨ wyy{w{z{w¡y¢z£¤yyzw}uw |w }y¥y¢w¦{{w§ vw§~wz{wzww |w§yyw}¡zw ¨© ||wwª~w « | | bdbefbgbdhfgbbiejbhbdbhdbhgkbdddfbhfflehmbnebbmhhbfmbbgdhbefbodmlb v{ww¬u ­{{ww dbegbbodmlbefpqbfdfbpbfbmhhbhdbhmjefmbhbdddfbegbbmhhbrhkbibodfgs ®ªwyyzwªy¥{¯ @ABBCDEFGEHIPEQRSTUVWEXECEY`aR`TbcVVdFeVfRVbghbVUiVdEG`TpVGViqEGViBrsad P $ !" ( # $ # !" !" EF/HI )010203456378 9@A88B51C3456378D & ' ! !" % %'&) «£¦¦¹«º § ·¤ )))# § ¦¸¨¦ £ §© »¼5»½6 882 # #)## ¢ ¦ °¦ ¦ #" § ¬¸¦´¾´¨ d###"## &(#e#"# § §±¤§ µ 9d #"&)e#)D µ ¡¢£¤¢ ¥¦§¨¨¨©¡£¤¡ ©ª §¦¡ ³ «§ §£ ¬­¦ ®¯¦§ ¦¥ª °­± ²² ¦ ©ª² £¬ ³´ª¥ µ£¦¶© fghijklimhinonmpqmrjmonsqjrmhjmtngpnunmhishmhinonmsonmsrvmnoojoqmsqqjwpshnxmyphimhinmxshsmkqnxmhjmlnrnoshnmhipqmzojxkwhm §§ ¢· ¸¤ ¢ jomprmhinmzojxkwhmphqng{|mkqnoqmj{mhinqnmxshsmsonmsxupqnxmhishmnoojoqmprmhinmxshsm}svmtnmzonqnrh~ ¹µ££¦ µ§§°¦º QRSSTUVWXVY`aVbcdefghViVTVpqrcqestgguWvgwcgsxysgfguVXqegXgVXgSru 6 12!4454 ! ""#$% &'()0#&)% 12!44 qrstuv }~}¬c¯ wm}}c«~¢sj±}²±§e wxxtuuxwq wyrwtxrwu ª~|}kjmcw}jczªw wm}}chk}mmec¯}mut s rwt uwu wm}}cv~¢cvjm|cv}}c }¨cn qwuuwww s u rrwv w|~tcvucitj~} wm}}cv}¢cgtu sy rw rs u wwwvrx xrw hc}cpn ¡k¢mefcnop£ciw¤hxc¥nopqcr icv~tclecd|tudm~¢c¦}kj~tcr}mc§§§¨l|tulm~¢¨t}k© ir{vfpfqooo ijklmcnopq xqoony ªwcwm}}cw~|~c«}¬j~¢­®}}jm~jfc ¦hvcnopq© k }~}¬c¯fcr°nc°¡vvcm¢ecrcvj¨cnopq©c¦m~fc{|jv¡icnooy¨ o qo poo pqo cdefcgh rstucdefcvw z{||cv}tj~}c{m}~kj 7899@ABCDBEFGBHIPQRSTUBVBUBWXYIXQT`SSaCbScISTdeTSRfSaBDXQgSDSfhBDSf9ipYa 4 01 3 !!"#$ %&'()"%($ ipqrs t xzzvxv¬­ xxzv ª¯x°¯ uvvrssv ui uwpur x yvp usx xxzvzzv ®zvzvxx xxzvtzxv¥xz ªyv ®zvzxy qpu ryy syus ius ysuyux u q sppu xt }x¤x¡v¥zz xxzvxv©z q wypu sps s uuy v spp sps vpu stuvwxyzv{|} §{ ~zv| {vtv| {v}vzyzvvzvzxvxvzx zzzv| { |« vxxzvzyzv x¡y¢£xxyv}tv| { }x¤x¡v¥zzv¦|uv¦~vyzvyvv| {vv§~v| ¨ { { aadeafagefaahdiagaagagfjaeageekdglamdaalggaelaafgadeanlka uzvv©t ªzzvv adfaanlkadeopaeeaoaealggagaglidelagaeadfaalggaqgjahanefr ¬§vxxyv§x¤z­ 567789@AB@CDE@FGHIPQRS@T@T@UVWGVIRXQQYA`QaGQRbcRQPdQY@BVIeQBQdf@BQd7ghWY 2 ' ! '$ " #$%& " #$%& " ( 1 % # ! $ " $%& # " #$%& 0 ) defgh)i0% uqqoss pghh'pd 'pqepg$rsepthur s££px¤ ufvwvep'gssx&'vwxhsphv lroqroqrzqroxw dphvyshpspr'puwfwvhw'&eep'xvri (! 'fvxv&qsw'ep' pvvhxwg'evwrrevep'p'vhgvep'w&s lmnopqrsottu |t| ~~~ vwxysz{|o}~tomo}~t ouosrso{oxzysosqwxoqzoxzysqw sswszo}~t }} zqqsolroqroqrzqroxw|oumo}~t o w uqqoss|o}novorszy{oxrxxoo}~t oz|oxvo}~~ ~ ~ t~~ t ~ Z ZZZZ ZZ Z ZZZZd eZf Z Ze ZeZ Z Z Zged Z nxso{|o sso{|o ZZ Zged Z hiZZhZ Ze ZZeeZ ZZZ Ze ZjZZg k ¡oqxqrozqwxs¢ 34553467869@A6BCDEFGH6I646PQRCQESTGGU7VGWCGSXYSGF`GU68G`abcRU NOVA Gas Transmission Ltd. Supplemental Vegetation Technical Report 2017 NGTL System Expansion September 2015/650026/650027/650028/650029/652265/652345/664501 3.5 Forest Health 3.5.1 Results of the Desktop/Literature Review Results of the forest health desktop/literature review are provided in the Vegetation Technical Report (Appendix 8A of the ESA [NEB Filing IDs: A4K2V6 and A4K2V7]), and are not repeated here. 3.5.2 Results of the Field Data Collection No additional signs of MPB were recorded during surveys in 2015. 3.6 Late-Successional Forests 3.6.1 Results of the Desktop/Literature Review Results of the late-successional forest desktop/literature review are provided in the Vegetation Technical Report (Appendix 8A of the ESA [NEB Filing IDs: A4K2V6 and A4K2V7]), and are not repeated here. 3.6.2 Results of the Field
Load more

Recommended publications
  • Apn80: Northern Spruce
    ACID PEATLAND SYSTEM APn80 Northern Floristic Region Northern Spruce Bog Black spruce–dominated peatlands on deep peat. Canopy is often sparse, with stunted trees. Understory is dominated by ericaceous shrubs and fine- leaved graminoids on high Sphagnum hummocks. Vegetation Structure & Composition Description is based on summary of vascular plant data from 84 plots (relevés) and bryophyte data from 17 plots. l Moss layer consists of a carpet of Sphag- num with moderately high hummocks, usually surrounding tree bases, and weakly developed hollows. S. magellanicum dominates hum- mocks, with S. angustifolium present in hollows. High hummocks of S. fuscum may be present, although they are less frequent than in open bogs and poor fens. Pleurozium schre- beri is often very abundant and forms large mats covering drier mounds in shaded sites. Dicranum species are commonly interspersed within the Pleurozium mats. l Forb cover is minimal, and may include three-leaved false Solomon’s seal (Smilacina trifolia) and round-leaved sundew (Drosera rotundifolia). l Graminoid cover is 5-25%. Fine-leaved graminoids are most important and include three-fruited bog sedge (Carex trisperma) and tussock cottongrass (Eriophorum vagi- natum). l Low-shrub layer is prominent and dominated by ericaceous shrubs, particularly Lab- rador tea (Ledum groenlandicum), which often has >25% cover. Other ericads include bog laurel (Kalmia polifolia), small cranberry (Vaccinium oxycoccos), and leatherleaf (Chamaedaphne calyculata). Understory trees are limited to scattered black spruce. l Canopy is dominated by black spruce. Trees are usually stunted (<30ft [10m] tall) with 25-75% cover . Some sites have scattered tamaracks in addition to black spruce.
    [Show full text]
  • Molecular Phylogeny of Chinese Thuidiaceae with Emphasis on Thuidium and Pelekium
    Molecular Phylogeny of Chinese Thuidiaceae with emphasis on Thuidium and Pelekium QI-YING, CAI1, 2, BI-CAI, GUAN2, GANG, GE2, YAN-MING, FANG 1 1 College of Biology and the Environment, Nanjing Forestry University, Nanjing 210037, China. 2 College of Life Science, Nanchang University, 330031 Nanchang, China. E-mail: [email protected] Abstract We present molecular phylogenetic investigation of Thuidiaceae, especially on Thudium and Pelekium. Three chloroplast sequences (trnL-F, rps4, and atpB-rbcL) and one nuclear sequence (ITS) were analyzed. Data partitions were analyzed separately and in combination by employing MP (maximum parsimony) and Bayesian methods. The influence of data conflict in combined analyses was further explored by two methods: the incongruence length difference (ILD) test and the partition addition bootstrap alteration approach (PABA). Based on the results, ITS 1& 2 had crucial effect in phylogenetic reconstruction in this study, and more chloroplast sequences should be combinated into the analyses since their stability for reconstructing within genus of pleurocarpous mosses. We supported that Helodiaceae including Actinothuidium, Bryochenea, and Helodium still attributed to Thuidiaceae, and the monophyletic Thuidiaceae s. lat. should also include several genera (or species) from Leskeaceae such as Haplocladium and Leskea. In the Thuidiaceae, Thuidium and Pelekium were resolved as two monophyletic groups separately. The results from molecular phylogeny were supported by the crucial morphological characters in Thuidiaceae s. lat., Thuidium and Pelekium. Key words: Thuidiaceae, Thuidium, Pelekium, molecular phylogeny, cpDNA, ITS, PABA approach Introduction Pleurocarpous mosses consist of around 5000 species that are defined by the presence of lateral perichaetia along the gametophyte stems. Monophyletic pleurocarpous mosses were resolved as three orders: Ptychomniales, Hypnales, and Hookeriales (Shaw et al.
    [Show full text]
  • Aquatic Insects: Bryophyte Roles As Habitats
    Glime, J. M. 2017. Aquatic insects: Bryophyte roles as habitats. Chapt. 11-2. In: Glime, J. M. Bryophyte Ecology. Volume 2. 11-2-1 Bryological Interaction. Ebook sponsored by Michigan Technological University and the International Association of Bryologists. Last updated 19 July 2020 and available at <http://digitalcommons.mtu.edu/bryophyte-ecology2/>. CHAPTER 11-2 AQUATIC INSECTS: BRYOPHYTE ROLES AS HABITATS TABLE OF CONTENTS Potential Roles .................................................................................................................................................. 11-2-2 Refuge ............................................................................................................................................................... 11-2-4 Habitat Diversity and Substrate Variability ...................................................................................................... 11-2-4 Nutrients ..................................................................................................................................................... 11-2-5 Substrate Size ............................................................................................................................................. 11-2-5 Stability ...................................................................................................................................................... 11-2-6 pH Relationships .......................................................................................................................................
    [Show full text]
  • VH Flora Complete Rev 18-19
    Flora of Vinalhaven Island, Maine Macrolichens, Liverworts, Mosses and Vascular Plants Javier Peñalosa Version 1.4 Spring 2019 1. General introduction ------------------------------------------------------------------------1.1 2. The Setting: Landscape, Geology, Soils and Climate ----------------------------------2.1 3. Vegetation of Vinalhaven Vegetation: classification or description? --------------------------------------------------3.1 The trees and shrubs --------------------------------------------------------------------------3.1 The Forest --------------------------------------------------------------------------------------3.3 Upland spruce-fir forest -----------------------------------------------------------------3.3 Deciduous woodlands -------------------------------------------------------------------3.6 Pitch pine woodland ---------------------------------------------------------------------3.6 The shore ---------------------------------------------------------------------------------------3.7 Rocky headlands and beaches ----------------------------------------------------------3.7 Salt marshes -------------------------------------------------------------------------------3.8 Shrub-dominated shoreline communities --------------------------------------------3.10 Freshwater wetlands -------------------------------------------------------------------------3.11 Streams -----------------------------------------------------------------------------------3.11 Ponds -------------------------------------------------------------------------------------3.11
    [Show full text]
  • <I>Sphagnum</I> Peat Mosses
    ORIGINAL ARTICLE doi:10.1111/evo.12547 Evolution of niche preference in Sphagnum peat mosses Matthew G. Johnson,1,2,3 Gustaf Granath,4,5,6 Teemu Tahvanainen, 7 Remy Pouliot,8 Hans K. Stenøien,9 Line Rochefort,8 Hakan˚ Rydin,4 and A. Jonathan Shaw1 1Department of Biology, Duke University, Durham, North Carolina 27708 2Current Address: Chicago Botanic Garden, 1000 Lake Cook Road Glencoe, Illinois 60022 3E-mail: [email protected] 4Department of Plant Ecology and Evolution, Evolutionary Biology Centre, Uppsala University, Norbyvagen¨ 18D, SE-752 36, Uppsala, Sweden 5School of Geography and Earth Sciences, McMaster University, Hamilton, Ontario, Canada 6Department of Aquatic Sciences and Assessment, Swedish University of Agricultural Sciences, SE-750 07, Uppsala, Sweden 7Department of Biology, University of Eastern Finland, P.O. Box 111, 80101, Joensuu, Finland 8Department of Plant Sciences and Northern Research Center (CEN), Laval University Quebec, Canada 9Department of Natural History, Norwegian University of Science and Technology University Museum, Trondheim, Norway Received March 26, 2014 Accepted September 23, 2014 Peat mosses (Sphagnum)areecosystemengineers—speciesinborealpeatlandssimultaneouslycreateandinhabitnarrowhabitat preferences along two microhabitat gradients: an ionic gradient and a hydrological hummock–hollow gradient. In this article, we demonstrate the connections between microhabitat preference and phylogeny in Sphagnum.Usingadatasetof39speciesof Sphagnum,withan18-locusDNAalignmentandanecologicaldatasetencompassingthreelargepublishedstudies,wetested
    [Show full text]
  • Bryophyte Diversity of Calcareous Fens in the Bashkir Cis-Urals (Republic of Bashkortostan, the Southern Urals) E
    Ecology and Geography of Plants and Plant Communities The fourth International Scientific Conference on Ecology and Geography of Plants and Plant Communities Volume 2018 Conference Paper Bryophyte Diversity of Calcareous Fens in the Bashkir Cis-Urals (Republic of Bashkortostan, the Southern Urals) E. Z. Baisheva1, I. G. Bikbaev1, V.B. Martynenko1, P. S. Shirokikh1, and L. G. Naumova2 1Ufa Institute of Biology, Subdivision of the Ufa Federal Research Centre of the Russian Academy of Sciences, 450054 Ufa, Russia 2M. Akmulla Bashkir State Pedagogical University, 450008 Ufa, Russia Abstract The bryophyte diversity of base-rich fens was studied in 16 calcareous mires of the Bashkir Cis-Urals (the Southern Ural region). Thirty-seven moss species and nine liverworts were recorded in treeless communities dominated by Schoenus ferrugineus, Molinia caerulea, small sedges and mosses. The annotated species list with precise Corresponding Author: locations is provided. Most of the surveyed mires are located in the northeastern part E. Z. Baisheva [email protected] of the Bashkir Cis-Urals, that is, in the Mesyagutovo forest-steppe bordering with the western foothills of the Southern Ural Mountains. In the plain areas of the western Received: 12 September 2018 Accepted: 15 October 2018 part of the Bashkir Cis-Urals, calcareous mires are very rare and characterized by the Published: 29 October 2018 low number of habitat specialists. Arctic-boreo-alpine species (Cinclidium stygium, Publishing services provided by Paludella squarrosa, Palustriella decipiens, Pseudocalliergon trifarium, etc.) make up Knowledge E approximately 30% of the total bryophyte diversity of the surveyed fens. In the study E. Z. Baisheva et al.
    [Show full text]
  • Field Guide to the Moss Genera in New Jersey by Keith Bowman
    Field Guide to the Moss Genera in New Jersey With Coefficient of Conservation and Indicator Status Keith Bowman, PhD 10/20/2017 Acknowledgements There are many individuals that have been essential to this project. Dr. Eric Karlin compiled the initial annotated list of New Jersey moss taxa. Second, I would like to recognize the contributions of the many northeastern bryologists that aided in the development of the initial coefficient of conservation values included in this guide including Dr. Richard Andrus, Dr. Barbara Andreas, Dr. Terry O’Brien, Dr. Scott Schuette, and Dr. Sean Robinson. I would also like to acknowledge the valuable photographic contributions from Kathleen S. Walz, Dr. Robert Klips, and Dr. Michael Lüth. Funding for this project was provided by the United States Environmental Protection Agency, Region 2, State Wetlands Protection Development Grant, Section 104(B)(3); CFDA No. 66.461, CD97225809. Recommended Citation: Bowman, Keith. 2017. Field Guide to the Moss Genera in New Jersey With Coefficient of Conservation and Indicator Status. New Jersey Department of Environmental Protection, New Jersey Forest Service, Office of Natural Lands Management, Trenton, NJ, 08625. Submitted to United States Environmental Protection Agency, Region 2, State Wetlands Protection Development Grant, Section 104(B)(3); CFDA No. 66.461, CD97225809. i Table of Contents Introduction .................................................................................................................................................. 1 Descriptions
    [Show full text]
  • Field Guide to the Plant Community Types of Voyageurs National Park
    36 A7 Northern Sedge Poor Fen Carex lasiocarpa - C. oligosperma / Sphagnum spp. - Polytrichum spp. Herbaceous vegetation WETLAND TYPES 11 System 23 22 BG PS PF RF RS WM 21 10 9 7 8 14 xis 2 A 5 19 13 18 12 17 16 15 4 6 3 2 1 Axis 1 Description This community is dominated by 80–100% cover of Carex lasiocarpa (wire-sedge). Short, stunted tamarack trees, usually under 2 m tall, are present above the herb layer at <10% cover. Dwarf-shrubs, most commonly Chamaedaphne calyculata (leatherleaf) and Andromeda glaucophylla (bog-rosemary), may be present at <40% cover and, in wetter stands, occupy only the drier hummocks. The shrubs Kalmia polifolia (bog laurel), Betula glandulifera (bog- birch), and Vaccinium oxyccocus (small cranberry) may also be present at low density. In addition to Carex lasiocarpa (wire-sedge), other common herbs include Menyanthes trifolia (buckbean), Equisetum fluviatile(water horsetail), Drosera rotundifolia (round-leaved sundew), and Sarricenia purpurea (pitcher-plant). Stands of this type occurring in water tracks tend to be more mineral rich and may also contain Pogonia ophioglosoides, Carex limosa, and Utricularia intermedia. Sphagnum typically forms a continuous carpet, though in wetter stands may be intermixed with brown mosses. The most abundant species are Sphagnum megellanicum, S. angustifolium, S. subsecundum sensu lato, and Warnstorfii exanulata. The Northern Sedge Poor Fen occurs in and around water tracks of large peatlands. In the wetter, more minerotrophic phase, microtopography consists of wet hollows with scattered hummocks. In the drier phase, hummock and hollow microtopography is more well developed. The substrate is deep, fibric Sphagnum peat.
    [Show full text]
  • A Baseline Study of Alpine Snowbed and Rill Communities on Mount Washington, Nh Author(S): Robert S
    A Baseline Study of Alpine Snowbed and Rill Communities On Mount Washington, Nh Author(s): Robert S. Capers Nancy G. Slack Source: Rhodora, 118(976):345-381. Published By: The New England Botanical Club, Inc. DOI: http://dx.doi.org/10.3119/16-07 URL: http://www.bioone.org/doi/full/10.3119/16-07 BioOne (www.bioone.org) is a nonprofit, online aggregation of core research in the biological, ecological, and environmental sciences. BioOne provides a sustainable online platform for over 170 journals and books published by nonprofit societies, associations, museums, institutions, and presses. Your use of this PDF, the BioOne Web site, and all posted and associated content indicates your acceptance of BioOne’s Terms of Use, available at www.bioone.org/page/terms_of_use. Usage of BioOne content is strictly limited to personal, educational, and non-commercial use. Commercial inquiries or rights and permissions requests should be directed to the individual publisher as copyright holder. BioOne sees sustainable scholarly publishing as an inherently collaborative enterprise connecting authors, nonprofit publishers, academic institutions, research libraries, and research funders in the common goal of maximizing access to critical research. RHODORA, Vol. 118, No. 976, pp. 345–381, 2016 Ó Copyright 2016 by the New England Botanical Club doi: 10.3119/16-07; first published on-line February 6, 2017. A BASELINE STUDY OF ALPINE SNOWBED AND RILL COMMUNITIES ON MOUNT WASHINGTON, NH ROBERT S. CAPERS Department of Ecology and Evolutionary Biology, University of Connecticut, Storrs, CT 06269 e-mail: [email protected] NANCY G. SLACK Biology Department, The Sage Colleges, 65 1st St., Troy, NY 12180 ABSTRACT.
    [Show full text]
  • Distribution and Habitat Requirements of the Moss Hamatocaulis Vernicosus (Mitt.) Hedenäs in the Bohemian Forest
    Silva Gabreta vol. 16 (1) p. 1–11 Vimperk, 2010 Distribution and habitat requirements of the moss Hamatocaulis vernicosus (Mitt.) Hedenäs in the Bohemian Forest Táňa Štechová1*, Eva Holá1, 3, Alžběta Manukjanová1 & Eva Mikulášková2 1 Department of Botany, Faculty of Science, University of South Bohemia, Branišovská 31, CZ–37005 České Budějovice, Czech Republic 2Department of Botany and Zoology, Faculty of Sciences, Masaryk University, Kotlářská 2, CZ–61137 Brno, Czech Republic 3 Agency of nature conservation and landscape protection of the Czech Republic, Nuselská 39, CZ–14000 Praha, Czech Republic *e-mail: [email protected] Abstract The species Hamatocaulis vernicosus is a fen moss, which is endangered and protected in Europe. Recent- ly we have known 9 localities of this species in the Bohemian Forest. Vegetation relevés and detailed water chemistry were investigated at all localities and subsequently compared with data on H. vernicosus from different parts of the Czech Republic. The studied species grows in similar vegetation types in all of the Czech localities, including the Bohemian Forest. However, in the Bohemian Forest sites, chemical compo- − sition of water differs markedly, particularly in Ca, Mg and NO3 contents. Key words: bryophytes, Czech Republic, fens, Šumava Mts., vegetation, water chemistry INTRODUCTION Hamatocaulis vernicosus is a red-list moss species throughout most of Europe, attaining even the official listing of the Bern Convention (COUNCIL DIRECTIVE 92/43/EEC 1992). An increased focus on Hamatocaulis vernicosus because of its protection under the EU Habitat Directive led to a more detailed exploration of its habitat requirements in Europe (e.g., HU- GONNOT 2003, MÜLLER & BAUMANN 2004).
    [Show full text]
  • Bryophyte and Sedge Inventory of Wetlands on Chemult Ranger District Fremont-Winema National Forests USDA Forest Service Region 6
    Bryophyte and Sedge Inventory of Wetlands on Chemult Ranger District Fremont-Winema National Forests USDA Forest Service Region 6 January 2010 The northeastern edge of Stimson Fen Prepared by: Missy Anderson, West Zone Botanist, Fremont-Winema National Forests Rick Dewey, Assistant Forest Botanist, Deschutes National Forest INTRODUCTION: This project was funded by the Region 6 Interagency Special Status/Sensitive Species Program (ISSSSP). The objectives were to: 1) Determine the abundance, distribution, and habitat condition of rare bryophytes and sedges on Chemult Ranger District of the Fremont-Winema National Forest. 2) Increase Forest knowledge of habitat and identification of these species, and create a voucher collection for future reference. The Bryophyte and Sedge inventory was conducted on approximately 530 acres of wetlands during July-September 2009. See attached map. BACKROUND: A number of bryophyte and Carex species were added to the Region 6 sensitive species list in January 2008. Incidental finds of some of these species had been previously located on Chemult District. Pseudocalliergon trifarium, Splachnum ampullaceum, and Tomentypnum nitens were located at a single fen on Chemult. The Pseudocalliergon and Splachnum are only known to occur on the Winema NF in Region 6. The Chemult site is one of three known locations of Pseudocalliergon and one of two sites of Splachnum; the other sites occur on Klamath District. Also on Chemult District, Carex capitata was found in Parker Meadow and Carex lasiocarpa var. americana at Stimson Meadow. Both sedges are currently only known from two sites on the Forest. Additional suitable habitat for these bryophytes and sedges, and possibly other wetland species (marked with *), is present on Chemult, but has not been explored.
    [Show full text]
  • Biodiversity
    Appendix I Biodiversity Appendix I1 Literature Review – Biodiversity Resources in the Oil Sands Region of Alberta Syncrude Canada Ltd. Mildred Lake Extension Project Volume 3 – EIA Appendices December 2014 APPENDIX I1: LITERATURE REVIEW – BIODIVERSITY RESOURCES IN THE OIL SANDS REGION OF ALBERTA TABLE OF CONTENTS PAGE 1.0 BIOTIC DIVERSTY DATA AND SUMMARIES ................................................................ 1 1.1 Definition ............................................................................................................... 1 1.2 Biodiversity Policy and Assessments .................................................................... 1 1.3 Environmental Setting ........................................................................................... 2 1.3.1 Ecosystems ........................................................................................... 2 1.3.2 Biota ...................................................................................................... 7 1.4 Key Issues ............................................................................................................. 9 1.4.1 Alteration of Landscapes and Landforms ............................................. 9 1.4.2 Ecosystem (Habitat) Alteration ........................................................... 10 1.4.3 Habitat Fragmentation and Edge Effects ............................................ 10 1.4.4 Cumulative Effects .............................................................................. 12 1.4.5 Climate Change .................................................................................
    [Show full text]