Produktinformation

Total Page：16

File Type：pdf, Size：1020Kb

Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PELO (Human) Recombinant Protein Gene Alias: CGI-17, PRO1770 (P01) Gene Summary: This gene encodes a protein which contains a conserved nuclear localization signal. The Catalog Number: H00053918-P01 encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. [provided Regulation Status: For research use only (RUO) by RefSeq] Product Description: Human PELO full-length ORF ( AAH05889.1, 1 a.a. - 385 a.a.) recombinant protein with GST-tag at N-terminal. Sequence: MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVG DSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDF DSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFT LAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLA HICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERF YEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQ QAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDP TVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLK QVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDS VKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPEL SDQEGDSSSEED Host: Wheat Germ (in vitro) Theoretical MW (kDa): 69.8 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 53918 Gene Symbol: PELO Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Adaptin, a Component of Clathrin-Coated Vesicles Associated with the Golgi Apparatus
Cloning and Expression of -Adaptin, a Component of Clathrin-coated Vesicles Associated with the Golgi Apparatus Margaret S. Robinson Department of Clinical Biochemistry, University of Cambridge, Addenbrooke's Hospital, Cambridge CB2 2QR England Abstract. Adaptins are the major components of all. Weaker homology was seen between ~/- and adaptors, the protein complexes that link clathrin to /~-adaptins. Like both a- and #-adaptins, 3,-adaptin has transmembrane proteins (e.g., receptors) in coated pits a proline and glycine-rich hinge region, dividing it and vesicles. The plasma membrane adaptor contains into NH2- and COOH-terminal domains. A chimeric an ot-adaptin subunit and a/~-adaptin subunit, while 3,-adaptin was constructed from the mouse and bovine the Golgi adaptor contains a 3,-adaptin subunit and a cDNAs and transfected into Rat 1 fibroblasts. Im- /~'-adaptin subunit. A partial cDNA clone encoding munofluorescence microscopy was carded out using an 3,-adaptin was isolated from a bovine brain expression mAb which recognizes an epitope present on the chi- library by screening with antibodies, and was used to mera but not found on the rodent protein. The con- obtain a cDNA clone from a mouse brain library con- struct was found to have a distribution typical of en- taining the full coding sequence. The identity of the dogenous "¥-adaptin. Using this transfection system, it clones was confirmed by protein sequencing. The should now be possible to exchange domains between deduced amino acid sequence of 3,-adaptin was found or- and "r-adaptins, to try to find out how adaptors are to be homologous to that of c~-adaptin, with several targeted to the appropriate membrane compartment of stretches of identical amino acids or conservative sub- the cell, and how they recruit the appropriate recep- stitutions in the first *70 kD, and 25 % identity over- tors into the coated vesicle.
[Show full text]
And Thermo-Adaptation in Hyperthermophilic Archaea: Identification of Compatible Solutes, Accumulation Profiles, and Biosynthetic Routes in Archaeoglobus Spp
Universidade Nova de Lisboa Osmo- andInstituto thermo de Tecnologia-adaptation Química e Biológica in hyperthermophilic Archaea: Subtitle Subtitle Luís Pedro Gafeira Gonçalves Osmo- and thermo-adaptation in hyperthermophilic Archaea: identification of compatible solutes, accumulation profiles, and biosynthetic routes in Archaeoglobus spp. OH OH OH CDP c c c - CMP O O - PPi O3P P CTP O O O OH OH OH OH OH OH O- C C C O P O O P i Dissertation presented to obtain the Ph.D degree in BiochemistryO O- Instituto de Tecnologia Química e Biológica | Universidade Nova de LisboaP OH O O OH OH OH Oeiras, Luís Pedro Gafeira Gonçalves January, 2008 2008 Universidade Nova de Lisboa Instituto de Tecnologia Química e Biológica Osmo- and thermo-adaptation in hyperthermophilic Archaea: identification of compatible solutes, accumulation profiles, and biosynthetic routes in Archaeoglobus spp. This dissertation was presented to obtain a Ph. D. degree in Biochemistry at the Instituto de Tecnologia Química e Biológica, Universidade Nova de Lisboa. By Luís Pedro Gafeira Gonçalves Supervised by Prof. Dr. Helena Santos Oeiras, January, 2008 Apoio financeiro da Fundação para a Ciência e Tecnologia (POCI 2010 – Formação Avançada para a Ciência – Medida IV.3) e FSE no âmbito do Quadro Comunitário de apoio, Bolsa de Doutoramento com a referência SFRH / BD / 5076 / 2001. ii ACKNOWNLEDGMENTS The work presented in this thesis, would not have been possible without the help, in terms of time and knowledge, of many people, to whom I am extremely grateful. Firstly and mostly, I need to thank my supervisor, Prof. Helena Santos, for her way of thinking science, her knowledge, her rigorous criticism, and her commitment to science.
[Show full text]
A Yeast Phenomic Model for the Influence of Warburg Metabolism on Genetic Buffering of Doxorubicin Sean M
Santos and Hartman Cancer & Metabolism (2019) 7:9 https://doi.org/10.1186/s40170-019-0201-3 RESEARCH Open Access A yeast phenomic model for the influence of Warburg metabolism on genetic buffering of doxorubicin Sean M. Santos and John L. Hartman IV* Abstract Background: The influence of the Warburg phenomenon on chemotherapy response is unknown. Saccharomyces cerevisiae mimics the Warburg effect, repressing respiration in the presence of adequate glucose. Yeast phenomic experiments were conducted to assess potential influences of Warburg metabolism on gene-drug interaction underlying the cellular response to doxorubicin. Homologous genes from yeast phenomic and cancer pharmacogenomics data were analyzed to infer evolutionary conservation of gene-drug interaction and predict therapeutic relevance. Methods: Cell proliferation phenotypes (CPPs) of the yeast gene knockout/knockdown library were measured by quantitative high-throughput cell array phenotyping (Q-HTCP), treating with escalating doxorubicin concentrations under conditions of respiratory or glycolytic metabolism. Doxorubicin-gene interaction was quantified by departure of CPPs observed for the doxorubicin-treated mutant strain from that expected based on an interaction model. Recursive expectation-maximization clustering (REMc) and Gene Ontology (GO)-based analyses of interactions identified functional biological modules that differentially buffer or promote doxorubicin cytotoxicity with respect to Warburg metabolism. Yeast phenomic and cancer pharmacogenomics data were integrated to predict differential gene expression causally influencing doxorubicin anti-tumor efficacy. Results: Yeast compromised for genes functioning in chromatin organization, and several other cellular processes are more resistant to doxorubicin under glycolytic conditions. Thus, the Warburg transition appears to alleviate requirements for cellular functions that buffer doxorubicin cytotoxicity in a respiratory context.
[Show full text]
Characterization of Chronic Lymphocytic Leukemia by Acgh/MLPA
UNIVERSIDADE DE LISBOA FACULDADE DE CIÊNCIAS DEPARTAMENTO DE BIOLOGIA VEGETAL Characterization of Chronic Lymphocytic Leukemia by aCGH/MLPA Diana Cristina Antunes Candeias Adão Mestrado em Biologia Molecular e Genética Dissertação orientada por: Professora Doutora Isabel Maria Marques Carreira Professor Doutor Manuel Carmo Gomes 2018 Agradecimentos Começo por agradecer ao CIMAGO e à ACIMAGO por todo o apoio prestado no âmbito do desenvolvimento deste trabalho, tanto a nível logístico como financeiro. Agradeço também ao Laboratório de Citogenética e Genómica e ao Laboratório de Oncologia e Hematologia da FMUC, pelo fornecimento dos equipamentos e bens necessários à realização deste projeto. À Professora Doutora Isabel Marques Carreira, muito obrigada por me permitir desenvolver o meu projeto de tese de mestrado no Laboratório de Citogenética e Genómica da FMUC e por orientar este trabalho. Agradeço tudo o que me ensinou, o apoio e, acima de tudo, o exemplo que é como profissional na área da Genética Humana, que em muito contribuiu para o meu desenvolvimento e crescimento a nível académico e profissional. Ao Professor Doutor Manuel Carmo Gomes, pela sempre célere e incondicional orientação durante este ano. Mostrou-se sempre disponível para responder às minhas dúvidas e questões, e por isso demonstro o meu agradecimento. À Professora Doutora Ana Bela Sarmento Ribeiro, pela proposta que me apresentou para trabalhar no âmbito da Leucemia Linfocítica Crónica, pelo apoio nas correções necessárias, e pela possibilidade que me deu de realizar alguns passos do meu trabalho nas instalações do Laboratório de Oncologia e Hematologia da FMUC. Ao Miguel Pires, por todos os ensinamentos ao nível do trabalho laboratorial, pela enorme disponibilidade e apoio na realização desta tese, bem como pela amizade e conselhos que me deu.
[Show full text]
Genome-Wide Association Meta-Analysis Using a Recessive Model Illuminates Genetic Architecture of Type 2 Diabetes Mark J
medRxiv preprint doi: https://doi.org/10.1101/2021.07.08.21258700; this version posted July 8, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted medRxiv a license to display the preprint in perpetuity. It is made available under a CC-BY-NC-ND 4.0 International license . Genome-Wide Association Meta-Analysis Using a Recessive Model Illuminates Genetic Architecture of Type 2 Diabetes Mark J. O’Connor 1, 2, 3, 4, 5, Alicia Huerta-Chagoya 6, Paula Cortés-Sánchez 7, Silvía Bonàs-Guarch 7, Joanne B. Cole 4, 5, 8, 9, David Torrents 7, 10, Kumar Veerapen 8, 11, 12, Niels Grarup 13, Mitja Kurki 8, 11, 12, Carsten F. Rundsten 13, Oluf Pedersen 13, Ivan Brandslund 14, 15, Allan Linneberg 16, 17, Torben Hansen 13, Aaron Leong 1, 2, 3, 4, 5, 8, 18,#, Jose C. Florez 1, 2, 3, 4, 5, 8,#, Josep M. Mercader 3, 4, 5, 8,# 1. Department of Medicine, Massachusetts General Hospital, Boston, MA, USA. 2. Endocrine Division, Massachusetts General Hospital, Boston, MA, USA. 3. Diabetes Unit, Massachusetts General Hospital, Boston, MA, USA. 4. Center for Genomic Medicine, Massachusetts General Hospital, Boston, MA, USA. 5. Programs in Metabolism and Medical and Population Genetics, Broad Institute of Harvard and MIT, Cambridge, MA, USA. 6. Consejo Nacional de Ciencia y Tecnología (CONACYT), Instituto Nacional de Ciencias Médicas y Nutrición Salvador Zubirán, Mexico City, Mexico. 7. Barcelona Supercomputing Center (BSC), Barcelona, Spain. 8. Department of Medicine, Harvard Medical School, Boston, MA, USA. 9.
[Show full text]
Suppression of the Pelo Protein by Wolbachia and Its Effect on Dengue Virus in Aedes Aegypti
RESEARCH ARTICLE Suppression of the pelo protein by Wolbachia and its effect on dengue virus in Aedes aegypti Sultan Asad1, Mazhar Hussain1¤, Leon Hugo2, Solomon Osei-Amo1, Guangmei Zhang1, Daniel Watterson3, Sassan Asgari1* 1 Australian Infectious Disease Research Centre, School of Biological Sciences, The University of Queensland, Brisbane Australia, 2 QIMR Berghofer Medical Research Institute, Herston, Australia, 3 School of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane Australia ¤ Current address: School of Biomedical Sciences, Institute of Health and Biomedical Innovation, Queensland University of Technology, QIMR Berghofer Medical Research Institute, Herston Australia a1111111111 * [email protected] a1111111111 a1111111111 a1111111111 Abstract a1111111111 The endosymbiont Wolbachia is known to block replication of several important arboviruses, including dengue virus (DENV), in the mosquito vector Aedes aegypti. So far, the exact mechanism of this viral inhibition is not fully understood. A recent study in Drosophila mela- OPEN ACCESS nogaster has demonstrated an interaction between the pelo gene and Drosophila C virus. In Citation: Asad S, Hussain M, Hugo L, Osei-Amo S, this study, we explored the possible involvement of the pelo protein, that is involved in pro- Zhang G, Watterson D, et al. (2018) Suppression of tein translation, in Wolbachia-mediated antiviral response and mosquito-DENV interaction. the pelo protein by Wolbachia and its effect on We found that pelo is upregulated during DENV replication and its silencing leads to reduced dengue virus in Aedes aegypti. PLoS Negl Trop Dis DENV virion production suggesting that it facilities DENV replication. However, in the pres- 12(4): e0006405. https://doi.org/10.1371/journal.
[Show full text]
The Genome 10K Project: a Way Forward
The Genome 10K Project: A Way Forward Klaus-Peter Koepfli,1 Benedict Paten,2 the Genome 10K Community of Scientists,Ã and Stephen J. O’Brien1,3 1Theodosius Dobzhansky Center for Genome Bioinformatics, St. Petersburg State University, 199034 St. Petersburg, Russian Federation; email: [email protected] 2Department of Biomolecular Engineering, University of California, Santa Cruz, California 95064 3Oceanographic Center, Nova Southeastern University, Fort Lauderdale, Florida 33004 Annu. Rev. Anim. Biosci. 2015. 3:57–111 Keywords The Annual Review of Animal Biosciences is online mammal, amphibian, reptile, bird, fish, genome at animal.annualreviews.org This article’sdoi: Abstract 10.1146/annurev-animal-090414-014900 The Genome 10K Project was established in 2009 by a consortium of Copyright © 2015 by Annual Reviews. biologists and genome scientists determined to facilitate the sequencing All rights reserved and analysis of the complete genomes of10,000vertebratespecies.Since Access provided by Rockefeller University on 01/10/18. For personal use only. ÃContributing authors and affiliations are listed then the number of selected and initiated species has risen from ∼26 Annu. Rev. Anim. Biosci. 2015.3:57-111. Downloaded from www.annualreviews.org at the end of the article. An unabridged list of G10KCOS is available at the Genome 10K website: to 277 sequenced or ongoing with funding, an approximately tenfold http://genome10k.org. increase in five years. Here we summarize the advances and commit- ments that have occurred by mid-2014 and outline the achievements and present challenges of reaching the 10,000-species goal. We summarize the status of known vertebrate genome projects, recommend standards for pronouncing a genome as sequenced or completed, and provide our present and futurevision of the landscape of Genome 10K.
[Show full text]
The Role of Nuclear Positioning in Muscle Function
UNIVERSIDADE DE LISBOA Faculdade de Medicina The role of nuclear positioning in muscle function Mafalda Ramos de Melo Pimentel Orientador: Prof. Doutor Edgar Rodrigues Almeida Gomes Tese especialmente elaborada para obtenção do grau de Doutor em Ciências Biomédicas especialidade em Biologia Celular e Molecular 2019 UNIVERSIDADE DE LISBOA Faculdade de Medicina The role of nuclear positioning in muscle function Mafalda Ramos de Melo Pimentel Orientador: Prof. Doutor Edgar Rodrigues Almeida Gomes Tese especialmente elaborada para obtenção do grau de Doutor em Ciências Biomédicas especialidade em Biologia Celular e Molecular Júri: Presidente: Doutor João Eurico Cortez Cabral da Fonseca, Professor Catedrático e Vice-Presidente do Conselho Cientifico da Faculdade de Medicina da Universidade de Lisboa Vogais: Doctor Antoine Guichet, Group Leader and Principal Investigator, Institut Jacques Monod, Université Paris Diderot; Doutor Reto Gassmann, Group Leader and Investigador do Instituto de Biologia Molecular e Celular da Universidade do Porto; Doutor Ramiro Daniel Carvalho de Almeida, Professor Auxiliar do Departamento de Ciências Médicas da Universidade de Aveiro; Doutora Solveig Thorsteinsdottir, Professora Associada com Agregação da Faculdade de Ciências da Universidade de Lisboa; Doutora Maria do Carmo Salazar Velez Roque da Fonseca, Professora Catedrática da Faculdade de Medicina da Universidade de Lisboa; Doutor Edgar Rodrigues Almeida Gomes, Professor Associado Convidado da Faculdade de Medicina da Universidade de Lisboa; Instituição Financiadora: Fundação para a Ciência e Tecnologia SFRH/BD/52227/2013 2019 A impressão desta tese foi aprovada pelo Conselho Científico da Faculdade de Medicina de Lisboa em reunião de 16 de Outubro de 2018. As opiniões expressas nesta publicação são da exclusiva respondabilidade do seu autor.
[Show full text]
ABCE1 Acts As a Positive Regulator of Exogenous RNA Decay
viruses Communication ABCE1 Acts as a Positive Regulator of Exogenous RNA Decay 1,2, 1, 1 1 1 Takuto Nogimori y , Koichi Ogami y , Yuka Oishi , Ryoya Goda , Nao Hosoda , Yoshiaki Kitamura 3 , Yukio Kitade 3,4 and Shin-ichi Hoshino 1,* 1 Department of Biological Chemistry, Graduate School of Pharmaceutical Sciences, Nagoya City University, Nagoya 467-8603, Japan; [email protected] (T.N.); [email protected] (K.O.); [email protected] (Y.O.); [email protected] (R.G.); [email protected] (N.H.) 2 Laboratory of Immunosenescence, National Institutes of Biomedical Innovation, Health and Nutrition, Ibaraki-City, Osaka 567-0085, Japan 3 Department of Biomolecular Science, Graduate School of Engineering, Gifu University, 1-1 Yanagido, Gifu 501-1193, Japan; [email protected] (Y.K.); [email protected] (Y.K.) 4 Department of Applied Chemistry, Faculty of Engineering, Aichi Institute of Technology, 1247 Yachigusa, Yakusa-cho, Toyota, Aichi 470-0392, Japan * Correspondence: [email protected]; Tel./Fax: +81-52-836-3427 These authors contributed equally to this work. y Received: 12 December 2019; Accepted: 3 February 2020; Published: 4 February 2020 Abstract: The 20-50-oligoadenylate synthetase (OAS)/RNase L system protects hosts against pathogenic viruses through cleavage of the exogenous single-stranded RNA. In this system, an evolutionally conserved RNA quality control factor Dom34 (known as Pelota (Pelo) in higher eukaryotes) forms a surveillance complex with RNase L to recognize and eliminate the exogenous RNA in a manner dependent on translation. Here, we newly identiﬁed that ATP-binding cassette sub-family E member 1 (ABCE1), which is also known as RNase L inhibitor (RLI), is involved in the regulation of exogenous RNA decay.
[Show full text]
Pelota-Interacting G Protein Hbs1 Is Required for Spermatogenesis In
www.nature.com/scientificreports OPEN Pelota-interacting G protein Hbs1 is required for spermatogenesis in Drosophila Received: 11 January 2018 Zhaohui Li1,2, Fu Yang2, Yang Xuan2, Rongwen Xi2,3 & Rui Zhao2,4 Accepted: 8 January 2019 Hbs1, which is homologous to the GTPase eRF3, is a small G protein implicated in mRNA quality control. Published: xx xx xxxx It interacts with a translation-release factor 1-like protein Dom34/Pelota to direct decay of mRNAs with ribosomal stalls. Although both proteins are evolutionarily conserved in eukaryotes, the biological function of Hbs1 in multicellular organisms is yet to be characterized. In Drosophila, pelota is essential for the progression through meiosis during spermatogenesis and germline stem cell maintenance. Here we show that homozygous Hbs1 mutant fies are viable, female-fertile, but male-sterile, which is due to defects in meiosis and spermatid individualization, phenotypes that are also observed in pelota hypomorphic mutants. In contrast, Hbs1 mutants have no obvious defects in germline stem cell maintenance. We show that Hbs1 genetically interacts with pelota during spermatid individualization. Furthermore, Pelota with a point mutation on the putative Hbs1-binding site cannot substitute the wild type protein for normal spermatogenesis. These data suggest that Pelota forms a complex with Hbs1 to regulate multiple processes during spermatogenesis. Our results reveal a specifc requirement of Hbs1 in male gametogenesis in Drosophila and indicate an essential role for the RNA surveillance complex Pelota-Hbs1 in spermatogenesis, a function that could be conserved in mammals. Spermatogenesis in Drosophila is initiated by the asymmetric divisions of germline stem cells (GSCs) that give rise to the respective diferentiated gonialblasts, each of which then undergoes four rounds of mitotic divisions to produce 16 spermatocytes.
[Show full text]
Bioinformatics and Expression Analysis of the Xeroderma
ISSN 1519-6984 (Print) ISSN 1678-4375 (Online) THE INTERNATIONAL JOURNAL ON NEOTROPICAL BIOLOGY THE INTERNATIONAL JOURNAL ON GLOBAL BIODIVERSITY AND ENVIRONMENT Original Article Bioinformatics and expression analysis of the Xeroderma Pigmentosum complementation group C (XPC) of Trypanosoma evansi in Trypanosoma cruzi cells Análises de bioinformática e da expressão do gene Xeroderma Pigmentosum complementation group C (XPC) de Trypanosoma evansi em células de Trypanosoma cruzi K. M. Souza1* , I. C. Mendes2 , D. M. Dall’Igna1,3 , B. M. Repolês2 , B. C. Resende2 , R. S. Moreira1,4 , L. C. Miletti1 , C. R. Machado2 and C. I. G. Vogel1 1Universidade do Estado de Santa Catarina, Departamento de Produção Animal e Alimentos, Lages, SC, Brasil 2Universidade Federal de Minas Gerais, Instituto de Ciências Biológicas, Departamento de Bioquímica e Imunologia, Belo Horizonte, MG, Brasil 3Universidade do Planalto Catarinense, Lages, SC, Brasil 4Instituto Federal de Santa Catarina, Departamento de Ensino, Pesquisa e Extensão, Lages, SC, Brasil Abstract Nucleotide excision repair (NER) acts repairing damages in DNA, such as lesions caused by cisplatin. Xeroderma Pigmentosum complementation group C (XPC) protein is involved in recognition of global genome DNA damages during NER (GG-NER) and it has been studied in different organisms due to its importance in other cellular processes. In this work, we studied NER proteins in Trypanosoma cruzi and Trypanosoma evansi, parasites of humans and animals respectively. We performed three-dimensional models of XPC proteins from T. cruzi and T. evansi and observed few structural differences between these proteins. In our tests, insertion of XPC gene from T. evansi (TevXPC) in T. cruzi resulted in slower cell growth under normal conditions.
[Show full text]
Defects in Translation-Dependent Quality Control Pathways Lead To
RESEARCH ARTICLE Defects in translation-dependent quality control pathways lead to convergent molecular and neurodevelopmental pathology Markus Terrey1,2, Scott I Adamson3,4, Jeffrey H Chuang3,4, Susan L Ackerman1* 1Howard Hughes Medical Institute, Department of Cellular and Molecular Medicine, Section of Neurobiology, Division of Biological Sciences, University of California San Diego, La Jolla, United States; 2Graduate School of Biomedical Sciences and Engineering, University of Maine, Orono, United States; 3The Jackson Laboratory for Genomic Medicine, Farmington, United States; 4Department of Genetics and Genome Sciences, Institute for Systems Genomics, UConn Health, Farmington, United States Abstract Translation-dependent quality control pathways such as no-go decay (NGD), non-stop decay (NSD), and nonsense-mediated decay (NMD) govern protein synthesis and proteostasis by resolving non-translating ribosomes and preventing the production of potentially toxic peptides derived from faulty and aberrant mRNAs. However, how translation is altered and the in vivo defects that arise in the absence of these pathways are poorly understood. Here, we show that the NGD/NSD factors Pelo and Hbs1l are critical in mice for cerebellar neurogenesis but expendable for survival of these neurons after development. Analysis of mutant mouse embryonic fibroblasts revealed translational pauses, alteration of signaling pathways, and translational reprogramming. Similar effects on signaling pathways, including mTOR activation, the translatome and mouse cerebellar development were observed upon deletion of the NMD factor Upf2. Our data reveal *For correspondence: that these quality control pathways that function to mitigate errors at distinct steps in translation [email protected] can evoke similar cellular responses. Competing interests: The authors declare that no competing interests exist.
[Show full text]