DOCSLIB.ORG

19--Shelbysmile

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
19--Shelbysmile equineline.com Product 40P 09/02/21 10:34:18 EDT 19--Shelbysmile Dark Bay or Brown Colt; Mar 22, 2019 Sadler's Wells, 81 b El Prado (IRE), 89 gr Lady Capulet, 74 ro Medaglia d'Oro, 99 dk b/ Bailjumper, 74 b Unnamed Cappucino Bay, 89 b Dubbed In, 73 ch Foaled in Ireland Mr. Prospector, 70 b Smart Strike, 92 b Shelbysmile, 13 b Classy 'n Smart, 81 b Storm Cat, 83 dk b/ Sultana, 99 ch Sierra Madre (FR), 91 gr/ro By MEDAGLIA D'ORO (1999). Stakes winner of $5,754,720 USA, Travers S. [G1] (SAR, $600,000), etc. Among the leading sires twice, sire of 14 crops of racing age, 2246 foals, 1556 starters, 154 stakes winners, 7 champions, 1009 winners of 2971 races and earning $163,356,644 USA, including Golden Sixty (Champion in Hong Kong, to 6, 2021, $9,855,341 USA, Longines Hong Kong Mile [G1], etc.), Songbird (Champion twice, $4,692,000, Breeders' Cup Juvenile Fillies [G1] (KEE, $1,100,000), etc.), Rachel Alexandra (Horse of the year in U.S., $3,506,730, BlackBerry Preakness S. [G1] (PIM, $660,000), etc.), Vancouver (AUS) (Champion in Australia, $1,845,530 USA, Tooheys New Golden Slipper [G1], etc.). 1st dam SHELBYSMILE, by Smart Strike. 5 wins in 10 starts at 3 and 4, $166,981(USA), River Memories S. (WO, $60,000(CAN)). Dam of 3 foals-- Unnamed (c. by Medaglia d'Oro). See below. 2nd dam SULTANA, by Storm Cat. Winner at 3, $19,200. Sister to ALJABR ($593,796 (USA), European Champion 2-year-old colt, Champagne Lanson Sussex S. [G1], etc., sire). Dam of 7 winners-- DERBAAS (c. by Seeking the Gold). 8 wins, 2 to 7 in ENG and UAE, $521,638 (USA), Commercial Bank of Dubai Al Fahidi Fort [G2], National Day Cup [L], 2nd Commercial Bank of Dubai Zabeel Mile [G2], National Day Cup [L], 3rd Somerville Tattersall S. [G3], National Day Cup [L], Betfred Support the Harley Slack Fund Superior Mile [L], Weatherbys Bank Stonehenge S. [L]. Sire. CHIEFDOM (g. by The Factor). 4 wins at 4 and 5, placed at 6, 2021 in UAE, $236,044 (USA), Derrinstown Stud Jebel Ali Mile [G3], 2nd Emirates SkyCargo Burj Nahaar [G3], 3rd Shadwell Jebel Ali S. [L]. SHELBYSMILE (f. by Smart Strike). Black type winner, see above. Jaleela (f. by Kingmambo). Winner at 3 in ENG, $14,014 (USA). Dam of-- Raihaana (f. by Dynaformer). Unraced. Dam of-- =Silent Night (SWE) (f. by =Night of Thunder (IRE)). 6 wins in 12 starts, 2 to 3 in SWE and NOR, placed at 3 in UAE, $243,774 (USA), 2nd Mohammed Bin Rashid Al Maktoum City District One Meydan Classic [L], 3rd Lanwades Stud S. [L]. Caval (f. by Blame). Winner at 2, $60,200. Isteefaa (f. by Eddington). 2 wins at 4, $40,218. Producer. Elston (g. by Declaration of War). Winner in 2 starts at 4, 2021, $27,310. Jadwa (f. by Invasor (ARG)). Unplaced. Dam of-- BLAME DEBBIE (f. by Blame). 4 wins, 2 to 4, 2021, $285,150(USA), Rood and Riddle Dowager S. [G3] (KEE, $75,000), Searching S. (PIM, $60,000), 3rd Demoiselle S. [G2] (AQU, $30,000). 3rd dam SIERRA MADRE (FR), by Baillamont. 4 wins at 2 and 3 in FR , $414,769 (USA), Prix Marcel Boussac Criterium des Pouliches [G1], Prix Vermeille [G1], Coupe du Fonds Europeen de l'Elevage [L], 3rd Prix d'Aumale [G3]. Half-sister to =Perle d'Irlande ($63,594 (USA), 2nd Prix Ronde de Nuit [L]). Dam of 5 winners-- ALJABR (c. by Storm Cat). 5 wins in 9 starts, 2 to 4 in ENG and FR , $593,796 (USA), European Champion 2-year-old colt, Champagne Lanson Sussex S. [G1], Juddmonte Lockinge S. [G1], Prix de la Salamandre [G1], Lanson Champagne Vintage S. [G3], 2nd St. James's Palace S. [G1]. Sire. Sultana (f. by Storm Cat). See above. Jabaar (c. by Silver Hawk). Winner at 3 and 4 in ENG, $86,283 (USA). Thekraa (f. by Elusive Quality). Winner at 3, $33,695. Makaarem (c. by Danzig). Winner in 1 start at 2 in FR , $16,156 (USA). Sire. Copyright © 2021 The Jockey Club Information Systems, Inc. Page 1 of 2 equineline.com Product 40P 09/02/21 10:34:18 EDT 19--Shelbysmile Dark Bay or Brown Colt; Mar 22, 2019 Hasilah (f. by Hard Spun). Placed at 3, $10,461. Producer. Raaya (f. by Giant's Causeway). Unraced. Dam of-- =Voices From War (IRE) (g. by =Poet's Voice (GB)). Winner at 2, placed at 4, 2021 in ITY, $45,126 (USA), 2nd Premio Criterium di Pisa [L]. Ekleel (IRE) (f. by Danehill). Unraced. Dam of-- Muqaawel (c. by Daaher). Winner at 2 and 3 in ENG and FR , $41,241 (USA), 3rd Prix de la Californie [L]. Nabat Seif (f. by Street Sense). Unplaced in 1 start in ENG. Dam of-- SPEED FRANCO (g. by Declaration of War). 4 wins, 2 to 5, placed at 6, 2021, $206,290, Dania Beach S. [G3] (GP, $59,520), Pulpit S. (GP, $43,710), 2nd Palm Beach S. [G3] (GP, $19,600), Cutler Bay S. (GP, $24,750). 4th dam MARIE D'IRLANDE (FR), by =Kalamoun (GB). Winner at 3 in FR , $21,419 (USA). Sister to =DOM RACINE (FR) ($91,642 (USA), Prix Jean Prat-G2, etc., sire). Dam of 5 winners, including-- SIERRA MADRE (FR) (f. by Baillamont). Black type winner, see above. =Perle d'Irlande (f. by =Top Ville (IRE)). 3 wins at 2 and 4 in FR , $63,594 (USA), 2nd Prix Ronde de Nuit [L]. =PARAIYOR (GB) (c. by Lomitas (GB)). 5 wins at 2 and 3 in FR , $138,341 (USA), Prix Edellic [L], Grand Prix du Nord [L]. =Excelerate (IRE) (g. by Mujadil). 3 wins at 3 and 4 in IRE, $142,482 (USA), 2nd Coolmore Stud Home of Champions Concorde S. [G3], Knockaire S. [L], 3rd Amethyst S. [G3]. RACE RECORD for Unnamed: Unraced. Copyright © 2021 The Jockey Club Information Systems, Inc. Page 2 of 2.
Load more

Recommended publications
  • We Cover the Risk So You Can Focus on the Reward
    CRT - Mixed Sale February 2019 1 WE COVER THE RISK SO YOU CAN FOCUS ON THE REWARD. You’ve worked hard for your assets. Protect them against misfortune. KUDA COVERS YOUR RACEHORSE: Mortality Cover, Lifesaving Surgery and Critical Care Cover, Medical Care Cover, and Public Liability Cover. KUDA COVERS EVERYTHING ELSE: We cover all your valued assets: Personal and Commercial Insurance, Sport Horse Insurance, and Game and Wildlife Insurance. If you trust us with covering your valued thoroughbred, you can trust us to cover all your assets. CALL US TODAY FOR COVER FROM THE LUXURY LIFESTYLE INSURANCE SPECIALISTS. WÉHANN SMITH +27 82 337 4555 JO CAMPHER +27 82 334 4940 ninety9cents 42088T ninety9cents Kuda Holdings - Authorised Financial Services Provider, FSP number: 38382. All policies are on a Co-Insurance basis between Infiniti Insurance and various syndicates of Lloyds. Kuda Holdings approved Lloyds coverholder PIN 112897CJS. 2 CRT - Mixed Sale February 2019 42088T Kuda Turf Directory Print Ad Luxury lifestyle insurance 210 x 148 FA2.indd 1 2018/12/19 2:48 PM CRT - Mixed Sale February 2019 3 VENDOR INDEX Lot Colour Sex Breeding On Account of Cheveley Stud. (As Agent) 43 Chestnut Mare Oxbow Lake by Fort Wood (USA) 45 Chestnut Mare Tippuana by Fort Wood (USA) 51 Chestnut Mare Silent Treatment by Jet Master 56 Chestnut Mare Rachel Leigh by Fort Wood (USA) 70 Bay Mare Miss K by Kahal (GB) 72 Chestnut Mare Giant's Slipper (AUS) by Giant's Causeway (USA) 76 Grey Mare Ado Annie by Trippi (USA) 84 Bay Mare Lavender Bells by Al Mufti (USA) On Account of Harold Crawford Racing.
    [Show full text]
  • LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu)
    LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu) Northern Dancer Nearctic Storm Bird Natalma South Ocean New Providence Storm Cat Shining Sun Secretariat Bold Ruler Terlingua Somethingroyal Crimson Saint Crimson Satan LUCIFER SAM[USA] Bolero Rose (b - 2005) Raise a Native Native Dancer Mr. Prospector Raise You Gold Digger Nashua Rafina Sequence Halo Hail to Reason Coup de Folie Cosmah Raise the Standard Hoist the Flag Natalma Lucifer Sam[USA] won 1 race at 2 (1400 m.), $ 47,179 and placed incl. 2nd in Tattersalls Millions Acomb Stakes, Gr.3, etc. Retired to stud in 2009. Sire from 3 crops of 43 named foals, 39 starters, 18 winners, 2 black- type performers, 35 wins, Rs. 1,53,39,544 viz. Lucy Diamond (2 wins, Rs. 16,64,635 and placed incl. 2nd in Smt Teegala Sulochana Reddy Memorial Byerly Turk Million, Gr.3, VIF Stud Godolphin Barb Million, Gr.3, 3rd in Deccan Bookmakers Fillies' Championship Stakes, Gr.3, etc), Lucia (1 win, Rs. 12,58,963 and placed incl. 3rd in Bangalore 1000 Guineas, Gr.2), ANCILLARY (4 wins, Rs. 15,31,000), SPINNING CHAKRAM (4 wins, Rs. 11,07,407), VIGOROUS (3 wins, Rs. 13,19,830), JAMAICAN (3 wins, Rs. 11,93,200), GRAND APPLAUSE (3 wins, Rs. 8,26,625), JACKIE OH (3 wins, Rs. 7,97,305), SMOKEY SID (2 wins, Rs. 7,61,905), PLATINUM PEARL, DOFANTASY, IMPRESSION, LUC DIVINE, DIVINE RULER, BATTLE EMPRESS, ALL IN, SAM HOUSTON and CHRISTMAS CAKE. His fourth crop is in training. This is his fifth crop.
    [Show full text]
  • To Consignors Hip Color & No
    Index to Consignors Hip Color & No. Sex Name,Year Foaled Sire Dam Barn 36 Property of Adena Springs Broodmares 735 dk. b./br. m. Salvadoria, 2005 Macho Uno Skipping Around 813 b. m. Witch Tradition, 1999 Holy Bull Hall's Lake Fire 833 dk. b./br. m. Beautiful Sky, 2003 Forestry Forty Carats 837 dk. b./br. m. Big City Danse, 2002 Joyeux Danseur Big City Bound 865 b. m. City Bird, 2004 Carson City Eishin Houlton 886 dk. b./br. m. Devine Will, 2002 Saint Ballado In the Will 889 dk. b./br. m. Distinguished Lady, 2004 Smart Strike Distinguish Forum 894 b. m. Dreamers Glory, 1999 Holy Bull Regal Victress 917 ch. m. Feisty Woman, 2003 El Prado (IRE) Joustabout 919 ch. m. First At the Wire, 2004 Awesome Again Zip to the Wire 925 b. m. Galica, 2001 Dixieland Brass Air Flair 927 ch. m. Getback Time, 2003 Gilded Time Shay 1029 gr/ro. m. Out of Pride, 1999 Out of Place I'm Proud 1062 ch. m. Ring True, 2003 Is It True Notjustanotherbird Barn 35 Property of Ann Marie Farm Broodmares 970 dk. b./br. m. Lake Merced, 2001 Salt Lake Little Miss Molly 1019 b. m. My Lollipop, 2005 Lemon Drop Kid Runaway Cherokee Barn 33 Consigned by Baccari Bloodstock LLC, Agent I Broodmare 831 dk. b./br. m. Bear and Grin It, 2002 Golden Missile Notable Sword Yearlings 775 ch. c. unnamed, 2009 Speightstown Surf Light 832 dk. b./br. c. unnamed, 2009 With Distinction Bear and Grin It 846 b. f. unnamed, 2009 Songandaprayer Broken Flower 892 ch.
    [Show full text]
  • EUROPEAN PEDIGREE for WHOLE GRAIN (GB) - Three Dams
    EUROPEAN PEDIGREE for WHOLE GRAIN (GB) - Three Dams Danzig (USA) Northern Dancer Sire: (Bay 1977) Pas de Nom (USA) POLISH PRECEDENT (USA) (Bay 1986) Past Example (USA) Buckpasser WHOLE GRAIN (GB) (Chesnut 1976) Bold Example (USA) (Bay mare 2001) Mill Reef (USA) Never Bend Dam: (Bay 1968) Milan Mill MILL LINE (Bay 1985) Quay Line High Line (Bay 1976) Dark Finale WHOLE GRAIN (GB) (2001 mare by POLISH PRECEDENT (USA)); in GB/IRE, unplaced at 2 years, placed once, £434 at 3 years, unplaced at 4 years, unplaced at 5 years; in France, placed twice, £2,872 at 4 years; dam of 6 known foals; 1 known runner; 1 known winner. Tioman Two (GB) (2007 gelding by RED RANSOM (USA)), unraced in GB/IRE. LOUIS THE PIOUS (GB) (2008 gelding by HOLY ROMAN EMPEROR (IRE)); in GB/IRE, placed once, £265 at 2 years, won 4 races and placed 4 times, £29,057 at 3 years, placed 4 times, £29,946 at 4 years, won 1 race and placed once, £44,455 at 5 years, placed once, £9,625 at 6 years. (2009 mare by TEOFILO (IRE)). Oatmeal (GB) (2011 filly by DALAKHANI (IRE)), unraced in GB/IRE, exported to France. Swaheen (GB) (2012 colt by LAWMAN (FR)), unraced in GB/IRE. (2013 colt by SIR PERCY (GB)). No Return in 2010. 1st dam. MILL LINE (1985 mare by MILL REEF (USA)); in GB/IRE, won 1 race and placed 3 times, £3,473 at 3 years, WON Royal British Legion Stakes, Doncaster, 1988, SECOND Links Stakes, Redcar, 1988, exported to USA; dam of 13 known foals; 11 known runners; 9 known winners.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • MARINO MARINI Gr/Ro, 2000
    MARINO MARINI gr/ro, 2000 height 16.1 Dosage (8-5-9-0-0); DI: 3.89; CD: 0.95 RACE AND (STAKES) RECORD See gray pages—Nearctic Northern Dancer, 1961 Nearctic, by Nearco Age Starts 1st 2nd 3rd Earned 18s, SW, $580,647 2 in Eng, Ire 6 2(1) 1(1) 1(1) $117,993 Storm Bird, 1978 636 f, 147 SW, 5.10 AEI Natalma, by Native Dancer 3 in NA, Ire 5 1 1(1) 2(2) $89,366 6s, SW, $169,181 South Ocean, 1967 New Providence, by Bull Page 4 5 0 2(2) 1(1) $87,025 682 f, 64 SW, 2.27 AEI Storm Cat, dkb/br, 1983 22s, SW, $70,147 Totals 16 3(1) 4(4) 4(4) $294,384 8s, SW, $570,610 12 f, 9 r, 9 w, 4 SW Shining Sun, by Chop Chop Won At 2 in Ireland 1,414 f, 181 SW, 2.95 AEI Secretariat, 1970 Bold Ruler, by Nasrullah 7.08 AWD Sara Lee Marble Hill S ($55,272, 5f in 1:04.80, by 21s, SW, $1,316,808 Terlingua, 1976 653 f, 57 SW, 2.95 AEI Somethingroyal, by Princequillo 2½, dftg. Luminata, Petite Histoire, Flamingo Bay). 17s, SW, $423,896 A maiden weight for age race at Cor ($17,836, 6f). 11 f, 9 r, 6 w, 2 SW Crimson Saint, 1969 Crimson Satan, by Spy Song 2nd Independent Waterford Wedgwood Phoenix S (Ire-I, 11s, SW, $91,770 6f, to Spartacus, dftg. Polar Force, Daganya, Ontario, 11 f, 8 r, 7 w, 4 SW Bolero Rose, by Bolero Cassis, Luminata, Petite Histoire, Hold That Tiger).
    [Show full text]
  • View California Thoroughbred Stallion Directory
    Entered Stud in 2015 STORMBERG ch, 2008 Dosage (7-3-8-0-0); DI: 3.50; CD: 0.94 See gray pages—Nearctic RACE RECORD Northern Dancer, 1961 Nearctic, by Nearco Age Starts 1st 2nd 3rd Earned 18s, BTW, $580,647 Storm Bird, 1978 636 f, 147 BTW, 4.11 AEI Natalma, by Native Dancer 2 1 0 0 0 $2,250 6s, BTW, $169,181 3 5 0 1 0 $11,209 682 f, 63 BTW, 2.26 AEI South Ocean, 1967 New Providence, by Bull Page 22s, BTW, $70,147 4 3 2 1 0 $80,000 Storm Cat, dkb/br, 1983 8s, BTW, $570,610 12 f, 9 r, 9 w, 4 BTW Shining Sun, by Chop Chop 5 1 0 0 0 $506 1,414 f, 177 BTW, 2.94 AEI 6 4 0 0 2 $14,900 Secretariat, 1970 Bold Ruler, by Nasrullah 7.08 AWD 21s, BTW, $1,316,808 Totals 14 2 2 2 $108,865 Terlingua, 1976 653 f, 54 BTW, 2.98 AEI Somethingroyal, by Princequillo 17s, BTW, $423,896 Won At 4 11 f, 9 r, 6 w, 2 BTW Crimson Saint, 1969 Crimson Satan, by Spy Song A race at SA ($75,750, abt 6.5f, turf in 1:12.12, dftg. 11s, BTW, $91,770 Kumiva, Maui Mark, Aliza’s Dream, Warren’s Dr. 11 f, 8 r, 7 w, 4 BTW Bolero Rose, by Bolero Yang, Clinton). Blushing Groom, 1974 Red God, by Nasrullah A maiden special weight race at SA ($73,500, abt 10s, BTW, $407,153 6.5f, turf in 1:13.05, dftg.
    [Show full text]
  • (With VAT) the Property of Hever Stud Farm Ltd
    HORSE OUT OF TRAINING, consigned by Hever Stud Farm The Property of Hever Stud Farm Ltd. Lot 1 (With VAT) Royal Applause Acclamation Harbour Watch (IRE) Princess Athena Woodman Gorband JANE CAMILLE Sheroog (GB) Alhaarth Unfuwain April 9th, 2016 Emulate (GB) Irish Valley (2004) Kenmare Bay Filly Aquarelle Aquamarine E.B.F. Nominated. JANE CAMILLE (GB): ran a few times at 3 years, 2019. Sold as she stands (see Conditions of Sale). FLAT 5 starts LAST THREE STARTS Latest BHA Rating 40 (Flat) (prior to compilation) 09/11/19 11/14 Class 6 (WFA AWT) Southwell 1m 13y 26/10/19 9/13 Class 6 (WFA AWT) Chelmsford City 7f 07/10/19 6/10 Class 5 (WFA Maiden) Windsor 6f 12y 1st dam EMULATE (GB): winner at 2 years and £6855; dam of 2 winners from 4 runners and 9 foals: Sandra (GB) (2010 f. by Three Valleys (USA)): 2 wins at 3 and 6 years in Bulgaria and in Germany and £9842 and placed 14 times. Manton Grange (GB) (2013 g. by Siyouni (FR)): 2 wins at 4 years, 2017 and £22,345 and placed 9 times. Dale Doback (GB) (2015 g. by Medicean (GB)): ran twice in N.H. Flat Races. Jane Camille (GB) (2016 f. by Harbour Watch (IRE)): see above. She also has a yearling filly by Harbour Watch (IRE) and a colt foal by Lethal Force (IRE). 2nd dam AQUARELLE (GB): winner at 2 years in France and £15,898; dam of 4 winners inc.: Coastline (GB): 3 wins in France and £18,132; dam of 3 winners inc.: Pain Perdu (FR): 9 wins in France and in Germany and £300,776, 2nd Prix La Force, Longchamp, Gr.3, Prix Francois Mathet, Saint-Cloud, L.
    [Show full text]
  • California Thoroughbred Stallion Directory
    MANY RIVERS ch, 2005 Dosage (7-4-8-1-0); DI: 3.00; CD: 0.85 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Northern Dancer, 1961 Nearctic, by Nearco 18s, BTW, $580,647 Age Starts 1st 2nd 3rd Earned Storm Bird, 1978 636 f, 147 BTW, 4.11 AEI Natalma, by Native Dancer 2 8 1 2 1(1) $45,180 6s, BTW, $169,181 3 8 1 0 1 $26,526 682 f, 63 BTW, 2.26 AEI South Ocean, 1967 New Providence, by Bull Page 22s, BTW, $70,147 4 0 0 0 0 — Storm Cat, dkb/br, 1983 8s, BTW, $570,610 12 f, 9 r, 9 w, 4 BTW Shining Sun, by Chop Chop 5 2 0 0 0 $800 1,414 f, 177 BTW, 2.94 AEI Secretariat, 1970 Bold Ruler, by Nasrullah Totals 18 2 2 2(1) $72,506 7.08 AWD 21s, BTW, $1,316,808 Won At 2 Terlingua, 1976 653 f, 54 BTW, 2.98 AEI Somethingroyal, by Princequillo 17s, BTW, $423,896 A maiden special weight race at BM ($40,200, 5.5f in 11 f, 9 r, 6 w, 2 BTW Crimson Saint, 1969 Crimson Satan, by Spy Song 1:04.47, dftg. Kentucky Twostep, Autism 11s, BTW, $91,770 Awareness, Vadheim, Forearlthepearl, Strong 11 f, 8 r, 7 w, 4 BTW Bolero Rose, by Bolero Suggestion, Sweetville, Searchforthetruth, etc.). Exclusive Native, 1965 Raise a Native, by Native Dancer 3rd Gold Rush S (8f, AW, to El Gato Malo, Bert’s Law, 13s, BTW, $169,013 dftg.
    [Show full text]
  • Palmarès Dettori
    Lanfranco DETTORI pour la famille AL MAKTOUM Victoires de Groupes 1 (par année) GR.1 FR Class. Année Prix Pays Hippodrome Cheval Entraineur Propriétaire 1 0 0 2012 Gold Cup GB Royal Ascot Colour Vision Saeed Bin Suroor Godolphin 9 1 2 2011 Irish Oaks IRE Curragh Blue Bunting Mahmood Al Zarooni Godolphin 2011 1000 Guinées GB Newmarket Blue Bunting Mahmood Al Zarooni Godolphin 2011 Prince of Wales's Stakes GB Royal Ascot Rewilding Mahmood Al Zarooni Godolphin 2011 Yorkshire Oaks GB York Blue Bunting Mahmood Al Zarooni Godolphin 2011 Fillie's Mile GB Newmarket Lyric of Light Mahmood Al Zarooni Godolphin 2011 Dubai Sheema Classic UAE Meydan Rewilding Mahmood Al Zarooni Godolphin 2011 Opéra FRA Longchamp Nahrain Roger Varian Cheik Ahmed Al Maktoum 2011 Preis von Europa GER Cologne Campanologist Saeed Bin Suroor Godolphin 2011 Gran Premio del Jockey-Club ITY Milan Campanologist Saeed Bin Suroor Godolphin 7 0 1 2010 Deutschland Preis GER Hambourg Campanologist Saeed Bin Suroor Godolphin 2010 Fillie's Mile GB Ascot White Moonstone Saeed Bin Suroor Godolphin 2010 Queen Elizabeth II Stakes GB Ascot Poet's Voice Saeed Bin Suroor Godolphin 2010 Racing Post Trophy GB Doncaster Casamento Michael Halford (IRE) Cheik Moh. Al Maktoum 2010 Vittorio di Capua ITY Milan Rio de la Plata Saeed Bin Suroor Godolphin 2010 Roma ITY Rome Rio de la Plata Saeed Bin Suroor Godolphin 2010 Mehl-Mulhens Rennen (German 2000 Guinées (Gr.2) GER Cologne Frozen Power Mahmood Al Zarooni Godolphin 2010 Hong-Kong Vase HK Sha Tin Mastery Saeed Bin Suroor Godolphin 2 1 1 2009 Gran Premio del Jockey-Club ITY Milan Schiaparelli Saeed Bin Suroor Godolphin 2009 Critérium de Saint-Cloud FRA Saint-Cloud Passion For Gold Saeed Bin Suroor Godolphin 2009 Derby italien (Gr.2) ITY Rome Mastery Saeed Bin Suroor Godolphin 4 0 0 2008 Lockinge St.
    [Show full text]
  • FREUD B, 1998
    FREUD b, 1998 Dosage (6-3-13-0-0); DI: 2.38; CD: 0.68 RACE AND (STAKES) RECORD See gray pages—Nearctic Northern Dancer, 1961 Nearctic, by Nearco Age Starts 1st 2nd 3rd Earned 18s, SW, $580,647 2 in Eng, Ire 3 0 1 0 $9,743 Storm Bird, 1978 636 f, 147 SW, 5.10 AEI Natalma, by Native Dancer 3 in Eng, Ire, Fr 9 1 1 1(1) $34,273 6s, SW, $169,181 681 f, 63 SW, 2.27 AEI South Ocean, 1967 New Providence, by Bull Page Totals 12 1 2 1(1) $44,016 Storm Cat, dkb/br, 1983 22s, SW, $70,147 3rd Cork and Orrery S (Eng-II, 6f). 8s, SW, $570,610 12 f, 9 r, 9 w, 4 SW Shining Sun, by Chop Chop 1,414 f, 181 SW, 2.97 AEI Secretariat, 1970 Bold Ruler, by Nasrullah SIRE LINE 7.08 AWD 21s, SW, $1,316,808 Freud is by STORM CAT, sire of 181 stakes winners, Terlingua, 1976 653 f, 57 SW, 2.95 AEI Somethingroyal, by Princequillo including champions GIANT’S CAUSEWAY (Horse of the 17s, SW, $423,896 BLACK 11 f, 9 r, 6 w, 2 SW Crimson Saint, 1969 Crimson Satan, by Spy Song Year in Eur, champion 3yo colt in Eng and Ire), 11s, SW, $91,770 MINNALOUSHE (champion 3yo colt in Ire), ONE COOL 11 f, 8 r, 7 w, 4 SW Bolero Rose, by Bolero CAT (champion 2yo colt in Eur, champion 3yo colt in Eng and Ire), STORM FLAG FLYING (champion 2yo filly), Blushing Groom, 1974 Red God, by Nasrullah 10s, SW, $407,153 SWEET CATOMINE (champion 2yo filly), HOLD THAT Rahy, 1985 512 f, 92 SW, 3.96 AEI Runaway Bride, by Wild Risk TIGER (champion 2yo colt in Eur), ALJABR (champion 13s, SW, $347,767 2yo colt in Eur), HEART SHAPED (champion 2yo filly in 1,130 f, 95 SW, 2.24 AEI Glorious Song, 1976 Halo, by Hail to Reason Mariah's Storm, b, 1991 34s, SW, $1,004,534 Ire), DENEBOLA (champion 2yo filly in Fr), etc.
    [Show full text]
  • AUTONOMY (IRE) Bay Horse; Foaled 1997 Never Bend Mill Reef
    AUTONOMY (IRE) Bay Horse; foaled 1997 Never Bend Mill Reef .......................... Milan Mill Doyoun ............................ Kashmir II Dumka .............................. Faizebad (FR) AUTONOMY (IRE) *Sea-Bird Arctic Tern ........................ Bubbling Beauty Debbie's Next .................... (1986) Raise a Native Babes Sis .......................... Sleek Dancer By DOYOUN (1985). Classic winner of $356,189, General Accident Two Thou - sand Guineas [G1] , etc. Sire of 15 crops of racing age, 446 foals, 319 starters, 25 black-type winners, 202 winners of 695 races and earning $16,577,070, 5 champions, including Daylami ($4,614,762, Dubai Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Kalanisi ($2,148,836, Breeders' Cup Turf [G1] , etc.), and of Manndar (IRE) [G1] (4 wins, $1,128,835), Margarula [G1] ($280,244), Manntari [G1] ($105,496). 1st dam DEBBIE'S NEXT, by Arctic Tern. Placed at 3 in England. Dam of 16 registered foals, 16 of racing age, 14 to race, 11 winners, including-- CAFFE LATTE (IRE) (f. by Seattle Dancer). 2 wins in 3 starts at 3, 34,758, in France, Prix Melisande; 3 wins at 4, $640,137, in N.A./U.S., €Ramona H. [G1] , Santa Barbara H. [G2] , 2nd Yellow Ribbon S. [G1] , San Clemente H. [G2] . (Total: $676,885). Dam of 5 winners, including-- Expresso Star (c. by War Chant). 4 wins at 3 and 4, £104,432, in Eng - land, 3rd Extrabet.com Huxley S. [G3] . (Total: $156,624). AUTONOMY (IRE) (c. by Doyoun). Black-type winner, see record. La Gomera (IRE) (f. by Hamas (IRE)). Winner at 4, 23,650, in France. (Total: $25,283).
    [Show full text]