DOCSLIB.ORG

THOROUGHBRED DAILY NEWS H EUROPEAN EDITION H Tuesday, October 2, 2001

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
THOROUGHBRED DAILY NEWS H EUROPEAN EDITION H Tuesday, October 2, 2001 The TDN is delivered each morning by 5 a.m. Eastern. For subscription information, please call (732) 747-8060. THOROUGHBRED Tuesday, DAILY NEWS October 2, 2001 P INTERNATIONAL P THE LOGICAL CHOICE TATTERSALLS HOUGHTON GETS UNDERWAY Queen's Logic (Ire) (Grand Lodge) beat Sophisticat Tattersalls Marketing Manager Jimmy George was (Storm Cat) by 1 1/4 lengths the G2 Lowther S. at York confident yesterday that the British company's flagship Aug. 23 and rates the nod again in today’s G1 Houghton Yearling Sale, which begins this evening at Shadwell Stud Cheveley Park S. at Newmarket. Trainer 5:30, will be largely unaffected by gloomy global eco- Mick Channon's filly defied a three-pound penalty with nomic prospects. “Obviously, there are economic uncer- that victory, a penalty she picked up in winning the G3 tainties, but we have a world-class catalogue which has Queen Mary S. at Royal Ascot June 20, where she beat been well received from the word go,” said George. Sophisticat by a half length at level weights. “The paddocks have been busy since the weekend and Sophisticat came back to be a fine third to Quarter Houghton graduates have excelled themselves through- Moon (Ire) in the G1 Moyglare Stud S. going seven out the world all year.” With an increasing number of furlongs at The Curragh Sept. 2 and warrants respect the best yearlings not appearing at public auction and dropping back down in trip. The connections of Silent several vendors waiting with some lots for Tattersalls’ Honor (Ire) (Sunday Silence), third in the Lowther, have October Sale, this year's catalogue is the smallest ever, made significant comments about their filly in the with just 190 lots. But Coolmore and the Maktoum run-up to this race. Silent Honor carried a five-pound family, the two protagonists who annually account for penalty at York due to a short head success in the G2 the bulk of turnover at this sale, have been as busy as Cherry Hinton S. at Newmarket July 10. Last time out, ever at the select sales this year and are expected to she led until approaching the final furlong, but had no play a prominent part at the Houghton in Newmarket. answer in the closing stages under her weight burden. With 27 entries, champion sire Sadler's Wells accounts The David Loder team remain convinced of her ability for one in seven of the catalogue. Among those that and they will adopt different tactics this time. stand out are Lot 14, Bosra's Valentine, a colt out of Tuesday, Newmarket, Britain, post time: 2:05 p.m. Classic winner Bosra Sham (Woodman) offered for SHADWELL STUD CHEVELEY PARK S.-G1, £150,000, Wafic Said through Watership Down Stud. Simon 2yo, f, 6fT Marsh, manager of Watership Down, said, “I think this SC PP HORSE SIRE TRAINER is a wonderful horse--he’s a very loose mover and very 1 13 Good Girl (Ire) College Chapel (GB) T Easterby typical of Sadler’s Wells, but he has got an awful lot of 2 11 Lahinch (Ire) Danehill Dancer (Ire) A O’Brien the mare in him as well.” Peintre Celebre (Nureyev) is 3 9 Leggy Lou (Ire) Mujadil Noseda the best-represented first-season sire with 14 entries, 4 2 Massarra (GB) Danehill J Dunlop while Desert Prince (Ire) (Green Desert) perhaps boasts 5 7 Misterah (GB) Alhaarth (Ire) Tregoning the best quality of any freshman. Lot 126, his colt out 6 10 Morouj Gone West Loder of Irish champion Park Express (Ire) (Ahonoora {GB}) 7 8 Pastel (GB) Lion Cavern Meehan from Lodge Park Stud, and Lot 155, a half brother to 8 3 Queen s Logic (Ire) Grand Lodge Channon G1 Vodafone Derby winner Oath (Ire), are among his 9 4 Silent Honor (Ire) Sunday Silence Loder potential stars. Of the lots offered as foals, none made 10 12 Sophisticat Storm Cat A O’Brien more than Lot 32, a Keeneland July withdrawal. By 11 6 Steaming Home Salt Lake Weld King Of Kings (Ire), he realised $425,000 at Keeneland 12 1 Sweet Deimos (GB) Green Desert Grassick November. He is consigned by Ashtown House Stud of 13 5 Ziria (Ire) Danehill Dancer (Ire) Laffon-Parias Coolmore's Paul Shanahan. One notable withdrawal is All carry 123 pounds. Lot 82, a Zafonic half-brother to leading sire Grand Lodge who made two million guineas as a foal. The colt You may also pick up a copy of today’s TDN at: sustained an injury and now could race for the Howard Tattersalls Houghton Yearling Sale & de Walden family's Plantation Stud, his breeder. Selling Fasig-Tipton Eastern Fall Yearling Sale starts at 4 p.m. tomorrow and at 5:30 p.m. Thursday. $50,000 Live Foal “The Awesome Again’s look like runners.” - Racing Update ADENA SPRINGS Kentucky AWESOME AGAIN Deputy Minister Inquiries to Jack Brothers Toll Free 1-877-945-2020 $900,000 Keeneland September filly S $300,000 colt THOROUGHBRED DAILY NEWS H EUROPEAN EDITION H Tuesday, October 2, 2001 2.15 Southwell, Alan And Joan Jane 35th Anniversary H B R I T A I N H EBF Novice Median Auction S. (Class E) (Div 1) (Cond), £5,300, 2yo, 1m (AWT), 1:45.30, stn. EXTRA DAY FOR OCTOBER SALES ESHRAAG (GB) (c, 2, Lion Cavern {USA}--Val D’Erica Doncaster Bloodstock Sales yesterday announced {Ire} {Ch. 2yo & 3yo Filly-Ire, MG1SW-Ity, G1SP-Fr}, that they will stage an extra day at this year's October by Ashmore {Fr}), a 14,000gns TATDEC yearling pur- Yearling Sales. This year's sale will start at noon on chase, raced in fifth as Omey Strand (Ire) (Desert Style Wednesday Oct. 24 "due to an unprecedented number {Ire}) led, but made headway to join the leader at the of entries for the sale," according to the sales com- halfway mark. The half to Verardi (Ire) (Mill Reef pany. The sale will continue until Friday, the first day {USA}), GSW-Ity, went to the front in early stretch and kept on well thereafter to hold off his rival by two of the Racing Post Trophy meeting at Doncaster. Fri- lengths as the 11-8 punter’s choice. Lifetime Record: day's racing also features the DBS October Yearling S. 4-1-1-0, £4,490. which is only open to graduates of last year's Sale. O-M Al Salem; B-Financiera Forinvest Inc; T-Paul D’Arcy; J-Jamie Spencer. BLACK SAM BELLAMY DEBUTS Trainer Aidan O'Brien will send Black Sam Bellamy 3.15 Southwell, Alan And Joan Jane 35th Anniversary (Ire) (Sadler's Wells {USA}) to the Lifestyle Financial EBF Novice Median Auction S. (Class E) (Div 2) (Cond), Services Maiden S. at Newmarket this afternoon. The £5,280, 2yo, 1m (AWT), 1:44.00, stn. colt's full-brother Galileo (Ire) was successful by 14 WELENSKA (GB) (c, 2, Danzig Connection {USA}--Fairy lengths in his debut in a Leopardstown maiden last Story {Ire}, by Persain Bold {Ire}) raced in a close sec- October. ond as Gone’n’dunnett (Ire) (Petardia {GB}) held a slight lead and went to the front soon after halfway mark. Yesterday’s Results: The 8-13 market leader drifted wide into the straight, 4.00 Bath, Manny Bernstein Tax Free Now Conditions S. was ridden along from the quarter-mile marker and was (Class C), £10,475, 3yo/up, 1m 5ydsT, 1:40.00, gd. pushed out late to beat the persistent Lapadar (Ire) CAUGHNAWAGA (FR) (c, 3, Indian Ridge {Ire}-- (Woodborough {USA}) by a cozy 1 3/4 lengths. Life- Wakria {Ire}, by Sadler’s Wells {USA}), the 13-8 time Record: 3-2-0-1, £7,603. favourite, broke well from the gate and went straight O-The Fairy Story Partnership; B-Deepwood Farm Stud; T-Paul Cole; J-Darren Williams. to the front in advance of Amicable (Ire) (Common Grounds {GB}). He was ridden along when challenged at the quarter-mile marke and was pushed clear from the eighth pole to beat Gleaming Blade (USA) (Diesis MOVING ??? {GB}) by a decisive 2½ lengths. Lifetime Record: For just a day or forever... 9-2-3-1, £19,713. Call us with your new fax number. O-Lady Harrison; B-Sultan Ben Mohamed Al Kabeer; (732) 747-8060 T-Henry Cecil; J-Richard Quinn. MUTAMAM - Canadian International Stakes, Grade 1 Three Grade 1 sold Tattersalls Houghton Yearling Sale by Biddestone Stud to Shadwell Estate Company for 185,000 gns Winners in two days TIMBOROA - Turf Classic Invitational, Grade 1 3 sold Tattersalls December Yearling Sale by Ted Voute (Agent) to Panetta Bloodstock for 24,000 gns JANET - Yellow Ribbon Stakes, Grade 1 Tel: +44 sold Tattersalls Autumn Yearling Sale 1638 665931 Fax: +44 1638 660850 by Fares Stables to O Pedroni for 6,500 gns [email protected] TDN H EUROPEAN • 10/02/01 • PAGE 2 1.30 Bath, Manny Bernstein 0800 821 821 Tax Free Esteem {Ire}) by four lengths. Lifetime Record: 3-1-2-0, Maiden S. (Class D) (Div 1), £5,495, 2yo, 5f 61ydsT, £6,085. 1:11.40, gd. O-E Hankinson; B-Oceanic; T-M Bell; J-M Fenton. +ROSIE’S POSY (GB) (f, 2, Suave Dancer {USA}--My 3.30 Bath, Manny Bernstein Credit/Deposit/Trade Ac- Branch {GB} {MSW-GB, G1SP-GB & Ire, $206,524}, by counts Maiden Fillies’ S. (Class D), £4,320, 3yo/up, Distant Relative {Ire}), a 10-1 chance, settled far back f/m, 10f 46ydsT, 2:08.20, gd. early as Rellim (GB) (Rudimentary {USA}) led, but made NAJAH (IRE) (f, 3, Nashwan {USA}--Mehthaaf {USA} progress from halfway mark as 4-6 favourite Zargus {Hwt 3yo-Ire at 7-9f, G1SW-Ire, GSW & G1SP-GB, (GB) (Zamindar {USA}) took over.
Load more

Recommended publications
  • We Cover the Risk So You Can Focus on the Reward
    CRT - Mixed Sale February 2019 1 WE COVER THE RISK SO YOU CAN FOCUS ON THE REWARD. You’ve worked hard for your assets. Protect them against misfortune. KUDA COVERS YOUR RACEHORSE: Mortality Cover, Lifesaving Surgery and Critical Care Cover, Medical Care Cover, and Public Liability Cover. KUDA COVERS EVERYTHING ELSE: We cover all your valued assets: Personal and Commercial Insurance, Sport Horse Insurance, and Game and Wildlife Insurance. If you trust us with covering your valued thoroughbred, you can trust us to cover all your assets. CALL US TODAY FOR COVER FROM THE LUXURY LIFESTYLE INSURANCE SPECIALISTS. WÉHANN SMITH +27 82 337 4555 JO CAMPHER +27 82 334 4940 ninety9cents 42088T ninety9cents Kuda Holdings - Authorised Financial Services Provider, FSP number: 38382. All policies are on a Co-Insurance basis between Infiniti Insurance and various syndicates of Lloyds. Kuda Holdings approved Lloyds coverholder PIN 112897CJS. 2 CRT - Mixed Sale February 2019 42088T Kuda Turf Directory Print Ad Luxury lifestyle insurance 210 x 148 FA2.indd 1 2018/12/19 2:48 PM CRT - Mixed Sale February 2019 3 VENDOR INDEX Lot Colour Sex Breeding On Account of Cheveley Stud. (As Agent) 43 Chestnut Mare Oxbow Lake by Fort Wood (USA) 45 Chestnut Mare Tippuana by Fort Wood (USA) 51 Chestnut Mare Silent Treatment by Jet Master 56 Chestnut Mare Rachel Leigh by Fort Wood (USA) 70 Bay Mare Miss K by Kahal (GB) 72 Chestnut Mare Giant's Slipper (AUS) by Giant's Causeway (USA) 76 Grey Mare Ado Annie by Trippi (USA) 84 Bay Mare Lavender Bells by Al Mufti (USA) On Account of Harold Crawford Racing.
    [Show full text]
  • 138904 02 Classic.Pdf
    breeders’ cup CLASSIC BREEDERs’ Cup CLASSIC (GR. I) 30th Running Santa Anita Park $5,000,000 Guaranteed FOR THREE-YEAR-OLDS & UPWARD ONE MILE AND ONE-QUARTER Northern Hemisphere Three-Year-Olds, 122 lbs.; Older, 126 lbs.; Southern Hemisphere Three-Year-Olds, 117 lbs.; Older, 126 lbs. All Fillies and Mares allowed 3 lbs. Guaranteed $5 million purse including travel awards, of which 55% of all monies to the owner of the winner, 18% to second, 10% to third, 6% to fourth and 3% to fifth; plus travel awards to starters not based in California. The maximum number of starters for the Breeders’ Cup Classic will be limited to fourteen (14). If more than fourteen (14) horses pre-enter, selection will be determined by a combination of Breeders’ Cup Challenge winners, Graded Stakes Dirt points and the Breeders’ Cup Racing Secretaries and Directors panel. Please refer to the 2013 Breeders’ Cup World Championships Horsemen’s Information Guide (available upon request) for more information. Nominated Horses Breeders’ Cup Racing Office Pre-Entry Fee: 1% of purse Santa Anita Park Entry Fee: 1% of purse 285 W. Huntington Dr. Arcadia, CA 91007 Phone: (859) 514-9422 To Be Run Saturday, November 2, 2013 Fax: (859) 514-9432 Pre-Entries Close Monday, October 21, 2013 E-mail: [email protected] Pre-entries for the Breeders' Cup Classic (G1) Horse Owner Trainer Declaration of War Mrs. John Magnier, Michael Tabor, Derrick Smith & Joseph Allen Aidan P. O'Brien B.c.4 War Front - Tempo West by Rahy - Bred in Kentucky by Joseph Allen Flat Out Preston Stables, LLC William I.
    [Show full text]
  • LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu)
    LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu) Northern Dancer Nearctic Storm Bird Natalma South Ocean New Providence Storm Cat Shining Sun Secretariat Bold Ruler Terlingua Somethingroyal Crimson Saint Crimson Satan LUCIFER SAM[USA] Bolero Rose (b - 2005) Raise a Native Native Dancer Mr. Prospector Raise You Gold Digger Nashua Rafina Sequence Halo Hail to Reason Coup de Folie Cosmah Raise the Standard Hoist the Flag Natalma Lucifer Sam[USA] won 1 race at 2 (1400 m.), $ 47,179 and placed incl. 2nd in Tattersalls Millions Acomb Stakes, Gr.3, etc. Retired to stud in 2009. Sire from 3 crops of 43 named foals, 39 starters, 18 winners, 2 black- type performers, 35 wins, Rs. 1,53,39,544 viz. Lucy Diamond (2 wins, Rs. 16,64,635 and placed incl. 2nd in Smt Teegala Sulochana Reddy Memorial Byerly Turk Million, Gr.3, VIF Stud Godolphin Barb Million, Gr.3, 3rd in Deccan Bookmakers Fillies' Championship Stakes, Gr.3, etc), Lucia (1 win, Rs. 12,58,963 and placed incl. 3rd in Bangalore 1000 Guineas, Gr.2), ANCILLARY (4 wins, Rs. 15,31,000), SPINNING CHAKRAM (4 wins, Rs. 11,07,407), VIGOROUS (3 wins, Rs. 13,19,830), JAMAICAN (3 wins, Rs. 11,93,200), GRAND APPLAUSE (3 wins, Rs. 8,26,625), JACKIE OH (3 wins, Rs. 7,97,305), SMOKEY SID (2 wins, Rs. 7,61,905), PLATINUM PEARL, DOFANTASY, IMPRESSION, LUC DIVINE, DIVINE RULER, BATTLE EMPRESS, ALL IN, SAM HOUSTON and CHRISTMAS CAKE. His fourth crop is in training. This is his fifth crop.
    [Show full text]
  • BAY COLT Barn 45 Hip No
    Consigned by Wavertree Stables, Inc. (Ciaran Dunne), Agent XVIII Hip No. Barn 108 BAY COLT 45 Foaled April 6, 2010 Mr. Prospector Gone West ........................ Secrettame Elusive Quality.................. Hero's Honor Touch of Greatness ........... Ivory Wand BAY COLT Danzig Green Desert..................... Foreign Courier Brocatelle (GB) ................. (1996) Habitat Brocade............................. Canton Silk By ELUSIVE QUALITY (1993). Black-type winner of $413,284, Poker H. [G3]- nwr, etc. Leading sire, sire of 11 crops of racing age, 1547 foals, 1025 starters, 72 black-type winners, 696 winners of 1865 races and earning $66,936,931, including champions Smarty Jones ($7,613,155, Kentucky Derby [G1] (CD, $5,884,800), etc.), Sepoy ($3,990,138, AAMI Golden Slipper [G1], etc.), Maryfield [G1] ($1,334,331), Elusive Kate [G1] (4 wins, $332,597), and of Raven’s Pass [G1] (hwt. at 3 in England, $3,658,556). 1st dam BROCATELLE (GB), by Green Desert. Placed in 2 starts at 3, €3,049, in France; placed in 2 starts at 3 in England. (Total: $4,136). Dam of 9 other registered foals, 9 of racing age, including a 2-year-old of 2012, 8 to race, 3 winners-- Fusaichi Hokutosei (IRE) (c. by Machiavellian). 6 wins, 2 to 5, ¥150,299,000, in Japan, 2nd Baden-Baden Cup, 3rd Keio Hai Nisai S. (Total: $1,358,504). Ahlaain (c. by Bernstein). Winner at 2, £11,653, in England, 3rd Weather- bys Bank Stonehenge S.; placed at 3 and 4, 2012, 343,384 dirhams, in U.A.E., 2nd Emirates Airline Al Bastakiya S., Al Taher Motors Meydan Classic.
    [Show full text]
  • =Unnamed B+ Based on the Cross of Storm Cat and His Sons and Grandsons/Rahy Variant = 2.11 Breeder: Mr
    02/27/11 01:02:26 EST =Unnamed B+ Based on the cross of Storm Cat and his sons and grandsons/Rahy Variant = 2.11 Breeder: Mr. ML Niall (AUS) Northern Dancer, 61 b Storm Bird, 78 b South Ocean, 67 b Storm Cat, 83 dk b/ Secretariat, 70 ch Terlingua, 76 ch Crimson Saint, 69 ch Giant's Causeway, 97 ch Blushing Groom (FR), 74 Rahy, 85 ch ch Mariah's Storm, 91 b Glorious Song, 76 b Roberto, 69 b Immense, 79 b Shamardal, 02 b Imsodear, 67 b Raise a Native, 61 ch Mr. Prospector, 70 b Gold Digger, 62 b Machiavellian, 87 dk b/ Halo, 69 dk b/ Coup de Folie, 82 b Raise the Standard, 78 b Helsinki (GB), 93 b =Petingo (GB), 65 b =Troy (GB), 76 b =La Milo (GB), 63 ch Helen Street (GB), 82 b Riverman, 69 b =Waterway (FR), 76 ch =Unnamed =Boulevard (IRE), 68 ch Chestnut Filly Foaled Nov 06, 2009 *Nasrullah, 40 b in Australia Red God, 54 ch Spring Run, 48 b Blushing Groom (FR), 74 ch =Wild Risk (FR), 40 b Runaway Bride (GB), 62 b =Aimee (GB), 57 b Rahy, 85 ch Hail to Reason, 58 br Halo, 69 dk b/ Cosmah, 53 b Glorious Song, 76 b *Herbager, 56 b Ballade, 72 dk b/ Miss Swapsco, 65 dk b/ =Mysteries (AUS), 00 ch Polynesian, 42 br Native Dancer, 50 gr Geisha, 43 ro Raise a Native, 61 ch Case Ace, 34 b Raise You, 46 ch Lady Glory, 34 br So Very Fine, 87 ch Northern Dancer, 61 b Nijinsky II, 67 b Flaming Page, 59 b Lucky Us, 76 b =Court Harwell (GB), 54 br *La Sevillana, 66 dk b/ =Giraldilla, 54 ch Note on terminology in this report: Direct Cross refers to Dosage Profile: 8 1 14 1 0 Inbreeding: Rahy: 4S X 2D Dosage Index: 2.00 Northern Dancer: 5S X 5D the exact sire over exact broodmare sire; Rated Cross is Center of Distribution: +0.67 Blushing Groom (FR): 5S X 3D the cross used to base the TrueNicks rating and may differ Glorious Song: 5S X 3D from the direct cross to maintain statistical significance; Raise a Native: 5S X 3D AEI: Average Earnings Index; AWD: Average Winning Halo: 5S X 4D Distance (in furlongs).
    [Show full text]
  • To Consignors Hip Color & No
    Index to Consignors Hip Color & No. Sex Name,Year Foaled Sire Dam Barn 36 Property of Adena Springs Broodmares 735 dk. b./br. m. Salvadoria, 2005 Macho Uno Skipping Around 813 b. m. Witch Tradition, 1999 Holy Bull Hall's Lake Fire 833 dk. b./br. m. Beautiful Sky, 2003 Forestry Forty Carats 837 dk. b./br. m. Big City Danse, 2002 Joyeux Danseur Big City Bound 865 b. m. City Bird, 2004 Carson City Eishin Houlton 886 dk. b./br. m. Devine Will, 2002 Saint Ballado In the Will 889 dk. b./br. m. Distinguished Lady, 2004 Smart Strike Distinguish Forum 894 b. m. Dreamers Glory, 1999 Holy Bull Regal Victress 917 ch. m. Feisty Woman, 2003 El Prado (IRE) Joustabout 919 ch. m. First At the Wire, 2004 Awesome Again Zip to the Wire 925 b. m. Galica, 2001 Dixieland Brass Air Flair 927 ch. m. Getback Time, 2003 Gilded Time Shay 1029 gr/ro. m. Out of Pride, 1999 Out of Place I'm Proud 1062 ch. m. Ring True, 2003 Is It True Notjustanotherbird Barn 35 Property of Ann Marie Farm Broodmares 970 dk. b./br. m. Lake Merced, 2001 Salt Lake Little Miss Molly 1019 b. m. My Lollipop, 2005 Lemon Drop Kid Runaway Cherokee Barn 33 Consigned by Baccari Bloodstock LLC, Agent I Broodmare 831 dk. b./br. m. Bear and Grin It, 2002 Golden Missile Notable Sword Yearlings 775 ch. c. unnamed, 2009 Speightstown Surf Light 832 dk. b./br. c. unnamed, 2009 With Distinction Bear and Grin It 846 b. f. unnamed, 2009 Songandaprayer Broken Flower 892 ch.
    [Show full text]
  • Bay Filly Barn 8 Hip No
    Consigned by Niall Brennan Stables, Agent IX Barn Bay Filly Hip No. 8 489 A.P. Indy Pulpit ................................ Preach Tapit .................................. Unbridled Tap Your Heels .................. Bay Filly Ruby Slippers April 30, 2012 Mr. Prospector Fusaichi Pegasus .............. Angel Fever Pursuit of Glory (IRE) ....... (2006) Storm Cat Sophisticat ........................ Serena's Song By TAPIT (2001). Black-type winner of $557,300, Wood Memorial S. [G1] (AQU, $450,000), etc. Among the leading sires, sire of 7 crops of racing age, 779 foals, 523 starters, 45 black-type winners, 384 winners of 1020 races and earning $51,257,369, 4 champions, including Stardom Bound ($1,861,610, Breeders' Cup Juvenile Fillies [G1] (OSA, $1,080,000), etc.), Hansen [G1] (5 wins, $1,810,805), and of Tapitsfly [G1] ($1,495,503), Zazu [G1] ($691,985), Testa Matta [G1] ($4,791,677), Joyful Victory [G1] . 1st dam , by Fusaichi Pegasus. Winner at 2, 8,784, in Ireland; Pursuit of Glory (IRE) € placed at 2, £25,606, in England, 3rd 32red.com Cheveley Park S. [G1] . (Total: $59,764). Dam of 1 registered foal, above. 2nd dam , by Storm Cat. Winner at 2, 53,666, in Ireland, 2nd Eircell Silver SOPHISTICAT € Flash S., 3rd Moyglare Stud S. [G1] ; winner at 3, £209,350, in England, Coronation S. [G1] , 2nd Shadwell Stud Cheveley Park S. [G1] , Peugeot Lowther S. , Queen Mary S. ; winner at 3, 73,005, in France, Prix [G2] [G3] € de la Grotte [G3] , 3rd Gainsborough Poule d'Essai des Pouliches-French One Thousand Guineas [G1] . (Total: $443,393). Sister to GRAND RE- WARD , SCHRAMSBERG . Dam of 7 foals, 5 to race, 3 winners, incl.-- SEFROUA (f.
    [Show full text]
  • EUROPEAN PEDIGREE for WHOLE GRAIN (GB) - Three Dams
    EUROPEAN PEDIGREE for WHOLE GRAIN (GB) - Three Dams Danzig (USA) Northern Dancer Sire: (Bay 1977) Pas de Nom (USA) POLISH PRECEDENT (USA) (Bay 1986) Past Example (USA) Buckpasser WHOLE GRAIN (GB) (Chesnut 1976) Bold Example (USA) (Bay mare 2001) Mill Reef (USA) Never Bend Dam: (Bay 1968) Milan Mill MILL LINE (Bay 1985) Quay Line High Line (Bay 1976) Dark Finale WHOLE GRAIN (GB) (2001 mare by POLISH PRECEDENT (USA)); in GB/IRE, unplaced at 2 years, placed once, £434 at 3 years, unplaced at 4 years, unplaced at 5 years; in France, placed twice, £2,872 at 4 years; dam of 6 known foals; 1 known runner; 1 known winner. Tioman Two (GB) (2007 gelding by RED RANSOM (USA)), unraced in GB/IRE. LOUIS THE PIOUS (GB) (2008 gelding by HOLY ROMAN EMPEROR (IRE)); in GB/IRE, placed once, £265 at 2 years, won 4 races and placed 4 times, £29,057 at 3 years, placed 4 times, £29,946 at 4 years, won 1 race and placed once, £44,455 at 5 years, placed once, £9,625 at 6 years. (2009 mare by TEOFILO (IRE)). Oatmeal (GB) (2011 filly by DALAKHANI (IRE)), unraced in GB/IRE, exported to France. Swaheen (GB) (2012 colt by LAWMAN (FR)), unraced in GB/IRE. (2013 colt by SIR PERCY (GB)). No Return in 2010. 1st dam. MILL LINE (1985 mare by MILL REEF (USA)); in GB/IRE, won 1 race and placed 3 times, £3,473 at 3 years, WON Royal British Legion Stakes, Doncaster, 1988, SECOND Links Stakes, Redcar, 1988, exported to USA; dam of 13 known foals; 11 known runners; 9 known winners.
    [Show full text]
  • HORSE out of TRAINING, Consigned by Godolphin
    HORSE OUT OF TRAINING, consigned by Godolphin Will Stand at Park Paddocks, Somerville Paddock Q, Box 343 Nureyev (USA) Polar Falcon (USA) 140 (WITH VAT) Marie d'Argonne (FR) Pivotal (GB) Cozzene (USA) SILENT MORNING Fearless Revival (GB) Stufida (2016) Gone West (USA) Elusive Quality A Bay Filly Touch of Greatness Veil of Silence (IRE) (USA) (USA) (2006) Sadler's Wells (USA) Gossamer (GB) Brocade SILENT MORNING (GB), unraced, Own sister to HUSHING (GB). 1st Dam VEIL OF SILENCE (IRE), unraced; dam of four winners from 4 runners and 8 foals of racing age viz- SOUND AND SILENCE (GB) (2015 g. by Exceed And Excel (AUS)), won 4 races at 2 years at home and in France and £187,122 including Prix Eclipse, Maisons-Laffitte, Gr.3, Julia Graves Roses Stakes, York, L. and Windsor Castle Stakes, Ascot, L., placed 6 times including second in Godolphin Cornwallis Stakes, Newmarket, Gr.3, Prix d'Arenberg, Chantilly, Gr.3 and Qatar Juvenile Turf Sprint Stakes, Del Mar, L. SILENT BULLET (IRE) (2011 g. by Exceed And Excel (AUS)), won 2 races at 2 years and £38,678 and placed 3 times. HUSHING (GB) (2014 f. by Pivotal (GB)), won 1 race at 3 years and placed 4 times. STAY SILENT (IRE) (2012 f. by Cape Cross (IRE)), won 1 race at 2 years and placed twice, all her starts. Silent Morning (GB) (2016 f. by Pivotal (GB)), see above. (2017 f. by Dubawi (IRE)). She also has a 2018 filly by Exceed And Excel (AUS). 2nd Dam GOSSAMER (GB), Champion 3yr old filly in Ireland in 2002, won 4 races at 2 and 3 years and £322,559 including Meon Valley Stud Fillies' Mile Stakes, Ascot, Gr.1, Entenmann's Irish 1000 Guineas, Curragh, Gr.1 and Prestige Stakes, Goodwood, Gr.3, placed once viz third in Netjets Prix du Moulin de Longchamp, Longchamp, Gr.1; Own sister to BARATHEA (IRE); dam of seven winners from 7 runners and 11 foals of racing age including- IBN KHALDUN (USA) (c.
    [Show full text]
  • MARE, Consigned by European Sales Management
    MARE, consigned by European Sales Management Will Stand at Park Paddocks, Highflyer Paddock E, Box 58 Green Desert (USA) Cape Cross (IRE) 136 (WITH VAT) Park Appeal Sea The Stars (IRE) Miswaki (USA) SIVOLIERE (IRE) Urban Sea (USA) Allegretta (2012) Mr Prospector (USA) A Bay Mare Kingmambo (USA) Sefroua (USA) Miesque (USA) (2005) Storm Cat (USA) Sophisticat (USA) Serena's Song (USA) Covered by KINGMAN (GB). Last Service May 20th; believed in foal. Pregnancy Certificate available, see Conditions of Sale. SIVOLIERE (IRE), won 3 races at 2 years in France and £84,482 including Criterium du Bequet - Ventes Osarus, La Teste De Buch, L., placed twice including third in Longines Prix du Calvados, Deauville, Gr.3; Dam of: 2017 Seeyouinseptember (FR) (f. by Siyouni (FR)), realised €225,000 at yearling sales, 2018, unraced to date. 2018 Doctor Carl (GB) (c. by Fastnet Rock (AUS)), in training. 2019 (f. by Frankel (GB)), realised 360,000 guineas at Tattersalls December Foal Sale 2019. 1st Dam SEFROUA (USA), won 3 races at 3 years in France and £69,277 including Prix de Lieurey- Shadwell, Deauville, L., placed 4 times including second in Prix des Lilas, Saint-Cloud, L., Prix Amandine, Deauville, L. and third in Noble Damsel Handicap, Belmont Park, Gr.3; dam of two winners from 4 runners and 5 foals of racing age viz- SUPHALA (FR) (f. by Frankel (GB)), won 4 races at 2 and 3 years, 2019 in France and £114,839 including Prix Chloe, Chantilly, Gr.3 and Prix Volterra, Parislongchamp, L., placed twice including second in Prix Imprudence, Maisons-Laffitte, Gr.3.
    [Show full text]
  • HORSE out of TRAINING, Consigned by Godolphin
    HORSE OUT OF TRAINING, consigned by Godolphin Will Stand at Park Paddocks, Somerville Paddock S, Box 361 Dubai Millennium Seeking The Gold (USA) 251 (WITH VAT) (GB) Colorado Dancer Dubawi (IRE) Deploy CHANDERI (GB) Zomaradah (GB) (2016) Jawaher (IRE) A Chesnut Filly Darshaan Dalakhani (IRE) Silk Sari (GB) Daltawa (IRE) (2010) Rainbow Quest (USA) So Silk (GB) Gossamer (GB) CHANDERI (GB), unraced. 1st Dam SILK SARI (GB), won 4 races at 3 and 4 years and £223,864 including DFS Park Hill Stakes, Doncaster, Gr.2 and Chalice Stakes, Newbury, L., placed 4 times including second in Qipco British Champions Fillies/Mare Stakes, Ascot, Gr.1, third in Pinnacle Stakes, Haydock, Gr.3; dam of 2 foals of racing age viz- Chanderi (GB) (2016 f. by Dubawi (IRE)), see above. New Chapter (GB) (2017 c. by Invincible Spirit (IRE)), unraced to date. She also has a 2018 colt by Frankel (GB). 2nd Dam SO SILK (GB), unraced; dam of five winners from 7 runners and 8 foals of racing age including- SILK SARI (GB) (f. by Dalakhani (IRE)), see above. Fashion Fund (GB) (f. by Oasis Dream (GB)), won 3 races at 3 and 4 years in U.S.A. and £151,394 and placed 7 times including second in Riskaverse Stakes, Saratoga, L. 3rd Dam GOSSAMER (GB), Champion 3yr old filly in Ireland in 2002, won 4 races at 2 and 3 years including Meon Valley Stud Fillies' Mile Stakes, Ascot, Gr.1, Entenmann's Irish 1000 Guineas, Curragh, Gr.1 and Prestige Stakes, Goodwood, Gr.3, placed third in Netjets Prix du Moulin de Longchamp, Longchamp, Gr.1; Own sister to BARATHEA (IRE); dam of seven winners from 7 runners and 11 foals of racing age including- IBN KHALDUN (USA), won 4 races at 2 years including Racing Post Trophy, Doncaster, Gr.1 and Deloitte Autumn Stakes, Ascot, Gr.3, placed once.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]