DOCSLIB.ORG

AQAARID Barn 23 Hip No. 2031

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
AQAARID Barn 23 Hip No. 2031 Property of Shadwell Farm LLC Hip No. Barn 2031 AQAARID 23 Dark Bay or Brown Mare; foaled 1992 Red God Blushing Groom (FR)........ Runaway Bride (GB) Nashwan........................... Bustino Height of Fashion (FR)...... Highclere (GB) AQAARID Northern Dancer Lomond ............................ My Charmer Ashayer............................. (1985) Moulton Good Lassie (GB) ............. Violetta III By NASHWAN (1986). Hwt. in Europe, Ever Ready Epsom Derby [G1], etc. Sire of 13 crops of racing age, 602 foals, 428 starters, 36 stakes winners, 3 champions, 261 winners of 618 races and earning $3,292,008 & $1,980 (CAN) in N.A., including Wandesta (GB) [G1]. Sire of dams of stakes win- ners Haqwah (champion), Royal Dubai, Molomo, Solvig, Tamweel, Mar- aahel, Samando, Delfos, Pugin, Dash To The Top, Maidaan, Long Term Wish, Royal Highness, Tantina, Chartres, Songerie, Salydora. 1st dam ASHAYER, by Lomond. Winner at 2 in England, 2nd James Seymour S., 3rd Vodafone Nassau S. [G2], Hoover Mile [G2], May Hill E.B.F. S. [G3], 4th Child S. [G2]; winner at 2 and 3 in France, Prix Marcel Boussac [G1], Prix de Psyche [G3]. Dam of 3 registered foals, 3 of racing age, 3 to race, 3 winners, including-- AQAARID (f. by Nashwan). Stakes winner, see record. Insiyabi (c. by Mr. Prospector). Winner at 3 in England; winner in 2 starts at 4 in United Arab Emirates; placed at 5 and 6, $22,570, in N.A. 2nd dam Good Lassie (GB), by Moulton. Winner at 2 in England, 3rd Sir Charles Clore Memorial S. Half-sister to *FAVOLETTA (Irish One Thousand Guineas, Falmouth S., etc.), FURIOSO (GB) (Sandleford Priory S., 2nd Epsom Oaks-G1, etc.), Velotta (2nd Fifinella S., etc.), Laughing Girl (2nd Galtres S.), Parthica (3rd Sun Chariot S.). Dam of 3 winners, including-- ASHAYER (f. by Lomond). Stakes winner, above. DEVIL'S FORTUNE (g. by Devil's Bag). 5 wins, 4 to 6, $168,694, Neshaminy H. (PHA, $24,390), 2nd Budweiser Turf Classic S. [G3], 3rd Pennsylvania Governor's Cup H. [L] (PEN, $8,074), Battlefield S. (MTH, $4,400). RACE RECORD: In England. At 2, two wins (Fillies' Mile [G1]) in 2 starts; at 3, one win (Gainsborough Stud Fred Darling S. [G3]), once 2nd (Madagans One Thousand Guineas [G1]). Totals: 3 wins, once 2nd in 5 starts. Earned 169,114 pounds. PRODUCE RECORD: 1997 not pregnant; 2003 aborted single foal. 1998 Elmonjed, c. by Gulch. Winner at 2 in England; 4 wins, 4 to 7, 2005 in United Arab Emirates. 1999 Taaly, f. by Storm Cat. Sent to United Arab Emirates. Unraced. 2000 Alafdal, c. by Gone West. Placed at 3 in England. 2001 Anayid, f. by A.P. Indy. In England. Unraced. 2002 Ladeena, f. by Dubai Millennium. Placed at 2 and 3, 2005 in England. 2004 not pregnant; 2005 f. by Elusive Quality. Mated to Aljabr (Storm Cat--Sierra Madre (FR)), last service March 14, 2005. (Believed to be PREGNANT). NTRA. KEE 11/05.
Load more

Recommended publications
  • We Cover the Risk So You Can Focus on the Reward
    CRT - Mixed Sale February 2019 1 WE COVER THE RISK SO YOU CAN FOCUS ON THE REWARD. You’ve worked hard for your assets. Protect them against misfortune. KUDA COVERS YOUR RACEHORSE: Mortality Cover, Lifesaving Surgery and Critical Care Cover, Medical Care Cover, and Public Liability Cover. KUDA COVERS EVERYTHING ELSE: We cover all your valued assets: Personal and Commercial Insurance, Sport Horse Insurance, and Game and Wildlife Insurance. If you trust us with covering your valued thoroughbred, you can trust us to cover all your assets. CALL US TODAY FOR COVER FROM THE LUXURY LIFESTYLE INSURANCE SPECIALISTS. WÉHANN SMITH +27 82 337 4555 JO CAMPHER +27 82 334 4940 ninety9cents 42088T ninety9cents Kuda Holdings - Authorised Financial Services Provider, FSP number: 38382. All policies are on a Co-Insurance basis between Infiniti Insurance and various syndicates of Lloyds. Kuda Holdings approved Lloyds coverholder PIN 112897CJS. 2 CRT - Mixed Sale February 2019 42088T Kuda Turf Directory Print Ad Luxury lifestyle insurance 210 x 148 FA2.indd 1 2018/12/19 2:48 PM CRT - Mixed Sale February 2019 3 VENDOR INDEX Lot Colour Sex Breeding On Account of Cheveley Stud. (As Agent) 43 Chestnut Mare Oxbow Lake by Fort Wood (USA) 45 Chestnut Mare Tippuana by Fort Wood (USA) 51 Chestnut Mare Silent Treatment by Jet Master 56 Chestnut Mare Rachel Leigh by Fort Wood (USA) 70 Bay Mare Miss K by Kahal (GB) 72 Chestnut Mare Giant's Slipper (AUS) by Giant's Causeway (USA) 76 Grey Mare Ado Annie by Trippi (USA) 84 Bay Mare Lavender Bells by Al Mufti (USA) On Account of Harold Crawford Racing.
    [Show full text]
  • Fairlight Farm.Pdf
    Hip No. Barn 10E-F 134 Consigned by Fairlight Farm LLC, Agent V Makin’ a Bee Line Nearctic Northern Dancer . { Natalma Lomond . Poker { My Charmer . { Fair Charmer Makin’ a Bee Line . Double Jay Bay mare; Honey Jay . { Roman Honey foaled 1993 {Honey Parade . Mr. Leader (1984) { Follow the Flower . { Tall Flower By LOMOND (1980), Two Thousand Guineas S.-G1, etc. Sire of 30 black type winners, including champions Flutter Away (Moyglare Stud S.-G1, etc.), Dark Lomond (IRE) (Irish St. Leger [G1], etc.), Marling (IRE) [G1], Valanour (IRE), etc. Sire of dams of black type winners Little Audrey, Balisada, Union Place, Aqaarid, Inchinor, Misty Eyed, etc. 1st dam Honey Parade, by Honey Jay. Winner at 2, 3 and 4, $28,928, 3rd Loyalty S. [R] (TDN, $4,350). Dam of 9 foals of racing age, including a 2-year-old of 2003, six to race, 5 winners, including-- Personal Parade (g. by Personal Hope). 3 wins, 2 to 4, $76,460. Ten Kay (f. by Corporate Report). 3 wins at 4, $34,477. Irish Storm (c. by Personal Hope). 3 wins at 3 and 4, 2002, $25,583. 2nd dam Follow the Flower, by Mr. Leader. Winner at 2, 2nd Aphrodite S. Half- sister to TALL MEADOWS (16 wins, $183,468), Charlie High. Dam of 10 foals, all winners, including-- ON THE SCENT (g. by Stutz Blackhawk). 12 wins, 2 to 5, $373,035, Best of Ohio Endurance Championship H. [R] (BEU, $90,000)-ntr, Western Reserve H. [R] (TDN, $21,000), Buckeye H. [R] (TDN, $21,000), etc. OPEN AND NOTORIOUS (g.
    [Show full text]
  • LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu)
    LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu) Northern Dancer Nearctic Storm Bird Natalma South Ocean New Providence Storm Cat Shining Sun Secretariat Bold Ruler Terlingua Somethingroyal Crimson Saint Crimson Satan LUCIFER SAM[USA] Bolero Rose (b - 2005) Raise a Native Native Dancer Mr. Prospector Raise You Gold Digger Nashua Rafina Sequence Halo Hail to Reason Coup de Folie Cosmah Raise the Standard Hoist the Flag Natalma Lucifer Sam[USA] won 1 race at 2 (1400 m.), $ 47,179 and placed incl. 2nd in Tattersalls Millions Acomb Stakes, Gr.3, etc. Retired to stud in 2009. Sire from 3 crops of 43 named foals, 39 starters, 18 winners, 2 black- type performers, 35 wins, Rs. 1,53,39,544 viz. Lucy Diamond (2 wins, Rs. 16,64,635 and placed incl. 2nd in Smt Teegala Sulochana Reddy Memorial Byerly Turk Million, Gr.3, VIF Stud Godolphin Barb Million, Gr.3, 3rd in Deccan Bookmakers Fillies' Championship Stakes, Gr.3, etc), Lucia (1 win, Rs. 12,58,963 and placed incl. 3rd in Bangalore 1000 Guineas, Gr.2), ANCILLARY (4 wins, Rs. 15,31,000), SPINNING CHAKRAM (4 wins, Rs. 11,07,407), VIGOROUS (3 wins, Rs. 13,19,830), JAMAICAN (3 wins, Rs. 11,93,200), GRAND APPLAUSE (3 wins, Rs. 8,26,625), JACKIE OH (3 wins, Rs. 7,97,305), SMOKEY SID (2 wins, Rs. 7,61,905), PLATINUM PEARL, DOFANTASY, IMPRESSION, LUC DIVINE, DIVINE RULER, BATTLE EMPRESS, ALL IN, SAM HOUSTON and CHRISTMAS CAKE. His fourth crop is in training. This is his fifth crop.
    [Show full text]
  • ALL the NEWS COCHRAN VISITS BRAIN CHILD IT's SAFE to PRINT * * * * * * * * * Fen.Lo,I943 A.E. PLAJ.Ilsexpa..IIJSION "I've G
    NUMBER ONE * * -)l- * -)l- -)l- -)l- -)l- -)l- ALL THE NEWS IT'S SAFE TO PRINT * * * * * * * * * FEn.lO,I943 COCHRAN VISITS BRAIN CHILD A.E. PLAJ.IlSEXPA..IIJSION "I've got lots to tell you-and its good news Hammering and sawing won't stop with com- too.But right now there are some final details pletion of ready rooms now taking shape around which must be worked out before I can announce Aviation Enterprises' hangars, according to it." That's Jacqueline Cochran's answer to the Henry E. Kriegel, vice-president. Army plans to use pilots of the 3I9th. Fourteen buildings have been approved by the "You can say,though",Miss Cochran added~that F.T.C. at Ft.Worth. Adminstration,Operations, those who meet the standards will go directly Classroom,Mess Hall, Hospital and Link Build- in the Ferry Command. And they'll be qualified ings, and eight domitories will be blult on to fly AT 61s and AT I7's, not just liaison and the Cubstuff parking lot when CAA, owners of ordinary trainers." the land, grants approval. "In the Ferry Command",Miss Cochran continued, Aviation Enterprises started three years ago "they'll go to one of the six ferry bases in the with six employes. Today over 380 ( 30% women) United States.It takes 50 pilots to make up a work in the plane overhaul and flight programs. squadron, which is ledby a squadron commander. Miss Cochran selected A.E. for the 3I9th Each pilot will be qualified to fly 25 differ- after a personal visit and on CAA's recom- ent air planes,including the light grasshoppers~ mendation.In two days,A.E.
    [Show full text]
  • US Dressage Finals Presented by Adequanstall Chart and USDF Dressage in the Bluegrass
    US Dressage Finals presented by AdequanStall Chart and USDF Dressage in the Bluegrass Rider Name Horse Stall Number Abner, Laura Califa 2004 Abner, Laura Walter Bud 2003 Abrams, Katherine Zan's Blue Frost 2017 Aide, Pamela Bon De NiroTack 2129 Aide, Pamela Bon De Niro 2130 Alder-Schaller, Sarah Real Prada 22064 Allen, Jonni Celtic Grace 2026 Allen, Jonni FWF Princess Julia 2027 Anderson, Taryn AddisonTack 1913 Anderson, Taryn Addison 1915 Anderson, Taryn Romulus 1914 Ashker, Laine Atlas 2103 Aycock, Gretchen Deeno 24074 Aycock, Gretchen Grand AmbitionTack 24071 Aycock, Gretchen Royal Jester 24072 Aycock, Gretchen TrilogyTack 24070 Aycock, Gretchen Trilogy 24073 Baker, Michelle Collingwood 1826 Banyon, Olivia Chaman 23060 Barnes, Maia Benvica 22009 Barnhizer, Megan Fascination Starr 1843 Barrows, Morgan ZerleoneTack 2040 Barrows, Morgan Zerleone 2041 Barteau, Kayla Merlin 24031 Barteau, Kayla RaymondTack 24028 Barteau, Kayla Raymond 24029 US Dressage Finals presented by Adequan and USDF Dressage in the Bluegrass Rider Name Horse Stall Number Barteau, Kayla Sundance 24030 Basler, Heidi Le Mode 24042 Basselini, Lisa Rhapsody Von Star 22103 Basselini, Lisa Soberano Do Funch 22101 Batchelder, Nora Bahai 22033 Batchelder, Nora Faro SQF 22034 Batchelder, Nora Fifi MLW 22035 Batchelder, Nora Fifi MLWTack 22036 Batchelder, Nora Micanopy RH 22021 Bean, Angelia Capitano 2115 Bean, Angelia CapitanoTack 2116 Beasley, Jacqueline Heradore 1735 Becker, Kristen Amadeus 23010 Becker, Kristen Don VinoTack 23008 Becker, Kristen Don Vino 23009 Bedard, Kasey
    [Show full text]
  • To Consignors Hip Color & No
    Index to Consignors Hip Color & No. Sex Name,Year Foaled Sire Dam Barn 36 Property of Adena Springs Broodmares 735 dk. b./br. m. Salvadoria, 2005 Macho Uno Skipping Around 813 b. m. Witch Tradition, 1999 Holy Bull Hall's Lake Fire 833 dk. b./br. m. Beautiful Sky, 2003 Forestry Forty Carats 837 dk. b./br. m. Big City Danse, 2002 Joyeux Danseur Big City Bound 865 b. m. City Bird, 2004 Carson City Eishin Houlton 886 dk. b./br. m. Devine Will, 2002 Saint Ballado In the Will 889 dk. b./br. m. Distinguished Lady, 2004 Smart Strike Distinguish Forum 894 b. m. Dreamers Glory, 1999 Holy Bull Regal Victress 917 ch. m. Feisty Woman, 2003 El Prado (IRE) Joustabout 919 ch. m. First At the Wire, 2004 Awesome Again Zip to the Wire 925 b. m. Galica, 2001 Dixieland Brass Air Flair 927 ch. m. Getback Time, 2003 Gilded Time Shay 1029 gr/ro. m. Out of Pride, 1999 Out of Place I'm Proud 1062 ch. m. Ring True, 2003 Is It True Notjustanotherbird Barn 35 Property of Ann Marie Farm Broodmares 970 dk. b./br. m. Lake Merced, 2001 Salt Lake Little Miss Molly 1019 b. m. My Lollipop, 2005 Lemon Drop Kid Runaway Cherokee Barn 33 Consigned by Baccari Bloodstock LLC, Agent I Broodmare 831 dk. b./br. m. Bear and Grin It, 2002 Golden Missile Notable Sword Yearlings 775 ch. c. unnamed, 2009 Speightstown Surf Light 832 dk. b./br. c. unnamed, 2009 With Distinction Bear and Grin It 846 b. f. unnamed, 2009 Songandaprayer Broken Flower 892 ch.
    [Show full text]
  • EUROPEAN PEDIGREE for WHOLE GRAIN (GB) - Three Dams
    EUROPEAN PEDIGREE for WHOLE GRAIN (GB) - Three Dams Danzig (USA) Northern Dancer Sire: (Bay 1977) Pas de Nom (USA) POLISH PRECEDENT (USA) (Bay 1986) Past Example (USA) Buckpasser WHOLE GRAIN (GB) (Chesnut 1976) Bold Example (USA) (Bay mare 2001) Mill Reef (USA) Never Bend Dam: (Bay 1968) Milan Mill MILL LINE (Bay 1985) Quay Line High Line (Bay 1976) Dark Finale WHOLE GRAIN (GB) (2001 mare by POLISH PRECEDENT (USA)); in GB/IRE, unplaced at 2 years, placed once, £434 at 3 years, unplaced at 4 years, unplaced at 5 years; in France, placed twice, £2,872 at 4 years; dam of 6 known foals; 1 known runner; 1 known winner. Tioman Two (GB) (2007 gelding by RED RANSOM (USA)), unraced in GB/IRE. LOUIS THE PIOUS (GB) (2008 gelding by HOLY ROMAN EMPEROR (IRE)); in GB/IRE, placed once, £265 at 2 years, won 4 races and placed 4 times, £29,057 at 3 years, placed 4 times, £29,946 at 4 years, won 1 race and placed once, £44,455 at 5 years, placed once, £9,625 at 6 years. (2009 mare by TEOFILO (IRE)). Oatmeal (GB) (2011 filly by DALAKHANI (IRE)), unraced in GB/IRE, exported to France. Swaheen (GB) (2012 colt by LAWMAN (FR)), unraced in GB/IRE. (2013 colt by SIR PERCY (GB)). No Return in 2010. 1st dam. MILL LINE (1985 mare by MILL REEF (USA)); in GB/IRE, won 1 race and placed 3 times, £3,473 at 3 years, WON Royal British Legion Stakes, Doncaster, 1988, SECOND Links Stakes, Redcar, 1988, exported to USA; dam of 13 known foals; 11 known runners; 9 known winners.
    [Show full text]
  • Fasig-Tipton
    Barn D6 Hip No. Consigned by Wolf Creek Farm, Agent 1 Dark Bay or Brown Colt Damascus Private Account . { Numbered Account Unaccounted For . The Minstrel { Mrs. Jenney . { Mrs. Penny Dark Bay/Br. Colt . Raja Baba February 12, 2001 Nepal . { Dumtadumtadum {Imabaygirl . Droll Role (1988) { Drolesse . { Good Change By UNACCOUNTED FOR (1991), $998,468, Whitney H. [G1], etc. Sire of 5 crops, 8 black type winners, 88 winners, $6,780,555, including Grundlefoot (to 5, 2002, $616,780, Baltimore Breeders’ Cup H. [G3], etc.), Quick Tip (7 wins to 4, 2002, $464,387, Cardinal H. [G3], etc.), Tempest Fugit (to 5, 2002, $380,712), Go Figure ($284,633). 1st dam IMABAYGIRL, by Nepal. 7 wins, 2 to 4, $46,228. Dam of 4 other foals of racing age, one to race. 2nd dam DROLESSE, by Droll Role. Unplaced in 1 start. Dam of 7 winners, including-- ZESTER (g. by Time for a Change). 7 wins, 3 to 6, $199,512, Sea- gram Cup S. [L] (FE, $39,240). JAN R.’S BOY (c. by Norcliffe). 4 wins at 3, $69,230, Constellation H.-R, 3rd Resolution H.-L. Sire. Drolly. 2 wins at 3, $20,098. Mr. Mitch. 6 wins, 3 to 5. 3rd dam GOOD CHANGE, by Mongo. Dam of 5 winners, including-- Ram Good. 3 wins at 2 and 3, $35,317, 3rd Queen’s Plate-R, Yearling Sales S. Good Sparkle. 9 wins, 3 to 6, $63,093. 4th dam SEA-CHANGE, by Count Fleet. Winner at 2. Half-sister to NEXT MOVE (champion), When in Rome, Hula.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • MARINO MARINI Gr/Ro, 2000
    MARINO MARINI gr/ro, 2000 height 16.1 Dosage (8-5-9-0-0); DI: 3.89; CD: 0.95 RACE AND (STAKES) RECORD See gray pages—Nearctic Northern Dancer, 1961 Nearctic, by Nearco Age Starts 1st 2nd 3rd Earned 18s, SW, $580,647 2 in Eng, Ire 6 2(1) 1(1) 1(1) $117,993 Storm Bird, 1978 636 f, 147 SW, 5.10 AEI Natalma, by Native Dancer 3 in NA, Ire 5 1 1(1) 2(2) $89,366 6s, SW, $169,181 South Ocean, 1967 New Providence, by Bull Page 4 5 0 2(2) 1(1) $87,025 682 f, 64 SW, 2.27 AEI Storm Cat, dkb/br, 1983 22s, SW, $70,147 Totals 16 3(1) 4(4) 4(4) $294,384 8s, SW, $570,610 12 f, 9 r, 9 w, 4 SW Shining Sun, by Chop Chop Won At 2 in Ireland 1,414 f, 181 SW, 2.95 AEI Secretariat, 1970 Bold Ruler, by Nasrullah 7.08 AWD Sara Lee Marble Hill S ($55,272, 5f in 1:04.80, by 21s, SW, $1,316,808 Terlingua, 1976 653 f, 57 SW, 2.95 AEI Somethingroyal, by Princequillo 2½, dftg. Luminata, Petite Histoire, Flamingo Bay). 17s, SW, $423,896 A maiden weight for age race at Cor ($17,836, 6f). 11 f, 9 r, 6 w, 2 SW Crimson Saint, 1969 Crimson Satan, by Spy Song 2nd Independent Waterford Wedgwood Phoenix S (Ire-I, 11s, SW, $91,770 6f, to Spartacus, dftg. Polar Force, Daganya, Ontario, 11 f, 8 r, 7 w, 4 SW Bolero Rose, by Bolero Cassis, Luminata, Petite Histoire, Hold That Tiger).
    [Show full text]
  • Texas Takes the Titles at US Dressage Finals
    For Immediate Release Texas Takes the Titles at US Dressage Finals Lexington, KY ­ (Dec. 6, 2016) ­ The state of Texas was well­represented when Region 9 raked in the ribbons at the 2016 US Dressage Finals presented by Adequan®. Thirty­three of the region's 35 riders attending the Finals hailed from Texas with an almost even distribution of Adult Amateurs (16) and Open riders (19). Region 9 placed third in the US Dressage Finals Regions Cup in which the top three scoring riders of designated divisions competed on regional teams to win bragging rights for their respective USDF Region. Participants Bonnie Canter from the Houston area rode Fifinella GCF to win the championship in the Second Level Adult Amateur (AA) Finals with a 72.317 percent, Terri Sue Wensinger from the Dallas area rode Valentino in the AA Prix St. Georges Finals to earn a 65.263 percent, and Arkansas' Amanda Bailey and Les Paul scored a 69.621 percent in the AA Training Level Finals for a total regional score of 69.067 percent. "We were well­represented in Region 9," said Canter, adding that it was exciting to be among some of the elite in the sport at the event held at the Kentucky Horse Park in Lexington Nov. 10­13. "You felt like you were in the big­ leagues. It was fun to see a lot of the names you read about or have seen videos of actually riding. It was nice to be in the thick of things. That was a treat for us." She rode her 6­year­old 15.1 hand Hanoverian/Connemara cross mare (ES Fred Astaire­South Ridge Bliss) to victory in an AA Second Level Finals class of 30 riders.
    [Show full text]
  • S U P P L E M E
    EUROPEAN BLOODSTOCK NEWS 10k & UNDER SUPPLEMENT EUROPEAN BLOODSTOCK NEWS is delighted to present this special supplement devoted to flat stallions standing in the UK and Ireland at a fee of £10,000 or less in 2018. It is broken into two alphabetical sections, with the advertised stallions appearing first. 2018 Whilst every care has been taken to trace the qualifying sires, EBN takes no responsibility for errors or omissions. Please note that stallions standing at less than €1,000 are not included. All material contained within (excluding supplied advertisements) is the copyright of European Bloodstock News. STALLIONS STANDING FOR £10,000 OR LESS IN 2018 EUROPEAN BLOODSTOCK NEWS ADAAY ALHEBAYEB Kodiac – Lady Lucia (Royal Applause) Dark Angel– Miss Indigo (Indian Ridge) WHITSBURY MANOR STUD • Fee £6,000, 1st Oct SLF TARA STUD • Fee €5,000 Whitsbury Manor Stud stallion Adaay will have his first-crop Alhebayeb was an exceptionally fast and precocious son of foals on the ground this year. The son of Kodiac was extremely Dark Angel. A maiden winner on his debut at two, he soon well–supported with a three-figure book of mares in his first made up into a Stakes performer, finishing second in the season, and that level of popularity will surely continue. His Listed Windsor Castle Stakes at Royal Ascot and winning the own sire is a half-brother to breed–shaping sire Invincible Gr.2 July Stakes on his third start. He demonstrated his Spirit and exerts huge influence in his own right as the sire of versatility by finishing second in the Gr.3 Horris Hill Stakes such stars as Gr.1 Cheveley Park Stakes winner Tiggy Wiggy over seven furlongs on heavy ground later in his juvenile and Gr.2 Celebration Mile Stakes winner Kodi Bear.
    [Show full text]