Structural Basis of Mitochondrial Translation Shintaro Aibara1†, Vivek Singh1,2, Angelika Modelska3‡, Alexey Amunts1,2*
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Supplementary Materials: Evaluation of Cytotoxicity and Α-Glucosidase Inhibitory Activity of Amide and Polyamino-Derivatives of Lupane Triterpenoids
Supplementary Materials: Evaluation of cytotoxicity and α-glucosidase inhibitory activity of amide and polyamino-derivatives of lupane triterpenoids Oxana B. Kazakova1*, Gul'nara V. Giniyatullina1, Akhat G. Mustafin1, Denis A. Babkov2, Elena V. Sokolova2, Alexander A. Spasov2* 1Ufa Institute of Chemistry of the Ufa Federal Research Centre of the Russian Academy of Sciences, 71, pr. Oktyabrya, 450054 Ufa, Russian Federation 2Scientific Center for Innovative Drugs, Volgograd State Medical University, Novorossiyskaya st. 39, Volgograd 400087, Russian Federation Correspondence Prof. Dr. Oxana B. Kazakova Ufa Institute of Chemistry of the Ufa Federal Research Centre of the Russian Academy of Sciences 71 Prospeсt Oktyabrya Ufa, 450054 Russian Federation E-mail: [email protected] Prof. Dr. Alexander A. Spasov Scientific Center for Innovative Drugs of the Volgograd State Medical University 39 Novorossiyskaya st. Volgograd, 400087 Russian Federation E-mail: [email protected] Figure S1. 1H and 13C of compound 2. H NH N H O H O H 2 2 Figure S2. 1H and 13C of compound 4. NH2 O H O H CH3 O O H H3C O H 4 3 Figure S3. Anticancer screening data of compound 2 at single dose assay 4 Figure S4. Anticancer screening data of compound 7 at single dose assay 5 Figure S5. Anticancer screening data of compound 8 at single dose assay 6 Figure S6. Anticancer screening data of compound 9 at single dose assay 7 Figure S7. Anticancer screening data of compound 12 at single dose assay 8 Figure S8. Anticancer screening data of compound 13 at single dose assay 9 Figure S9. Anticancer screening data of compound 14 at single dose assay 10 Figure S10. -
Role of Mitochondrial Ribosomal Protein S18-2 in Cancerogenesis and in Regulation of Stemness and Differentiation
From THE DEPARTMENT OF MICROBIOLOGY TUMOR AND CELL BIOLOGY (MTC) Karolinska Institutet, Stockholm, Sweden ROLE OF MITOCHONDRIAL RIBOSOMAL PROTEIN S18-2 IN CANCEROGENESIS AND IN REGULATION OF STEMNESS AND DIFFERENTIATION Muhammad Mushtaq Stockholm 2017 All previously published papers were reproduced with permission from the publisher. Published by Karolinska Institutet. Printed by E-Print AB 2017 © Muhammad Mushtaq, 2017 ISBN 978-91-7676-697-2 Role of Mitochondrial Ribosomal Protein S18-2 in Cancerogenesis and in Regulation of Stemness and Differentiation THESIS FOR DOCTORAL DEGREE (Ph.D.) By Muhammad Mushtaq Principal Supervisor: Faculty Opponent: Associate Professor Elena Kashuba Professor Pramod Kumar Srivastava Karolinska Institutet University of Connecticut Department of Microbiology Tumor and Cell Center for Immunotherapy of Cancer and Biology (MTC) Infectious Diseases Co-supervisor(s): Examination Board: Professor Sonia Lain Professor Ola Söderberg Karolinska Institutet Uppsala University Department of Microbiology Tumor and Cell Department of Immunology, Genetics and Biology (MTC) Pathology (IGP) Professor George Klein Professor Boris Zhivotovsky Karolinska Institutet Karolinska Institutet Department of Microbiology Tumor and Cell Institute of Environmental Medicine (IMM) Biology (MTC) Professor Lars-Gunnar Larsson Karolinska Institutet Department of Microbiology Tumor and Cell Biology (MTC) Dedicated to my parents ABSTRACT Mitochondria carry their own ribosomes (mitoribosomes) for the translation of mRNA encoded by mitochondrial DNA. The architecture of mitoribosomes is mainly composed of mitochondrial ribosomal proteins (MRPs), which are encoded by nuclear genomic DNA. Emerging experimental evidences reveal that several MRPs are multifunctional and they exhibit important extra-mitochondrial functions, such as involvement in apoptosis, protein biosynthesis and signal transduction. Dysregulations of the MRPs are associated with severe pathological conditions, including cancer. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
MRPS25 (NM 022497) Human Tagged ORF Clone – RC201353
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC201353 MRPS25 (NM_022497) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: MRPS25 (NM_022497) Human Tagged ORF Clone Tag: Myc-DDK Symbol: MRPS25 Synonyms: COXPD50; MRP-S25; RPMS25 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC201353 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCATGAAGGGCCGCTTCCCCATCCGCCGCACCCTGCAATATCTGAGCCAGGGGAACGTGGTGTTCA AGGACTCCGTGAAGGTCATGACAGTGAATTACAACACGCATGGGGAGCTGGGCGAGGGCGCCAGGAAGTT TGTGTTTTTCAACATACCTCAGATTCAATACAAAAACCCTTGGGTGCAGATCATGATGTTTAAGAACATG ACGCCGTCACCCTTCCTGCGATTCTACTTAGATTCTGGGGAGCAGGTCCTGGTGGATGTGGAGACCAAGA GCAATAAGGAGATCATGGAGCACATCAGAAAAATCTTGGGGAAGAATGAGGAAACCCTCAGGGAAGAGGA GGAGGAGAAAAAGCAGCTTTCTCACCCAGCCAACTTCGGCCCTCGAAAGTACTGCCTGCGGGAGTGCATC TGTGAAGTGGAAGGGCAGGTGCCCTGCCCCAGCCTGGTGCCATTACCCAAGGAGATGAGGGGGAAGTACA AAGCCGCTCTGAAAGCCGATGCCCAGGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC201353 protein sequence Red=Cloning site Green=Tags(s) MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNM TPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECI CEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD -
WO 2019/079361 Al 25 April 2019 (25.04.2019) W 1P O PCT
(12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization I International Bureau (10) International Publication Number (43) International Publication Date WO 2019/079361 Al 25 April 2019 (25.04.2019) W 1P O PCT (51) International Patent Classification: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DJ, DK, DM, DO, C12Q 1/68 (2018.01) A61P 31/18 (2006.01) DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, C12Q 1/70 (2006.01) HR, HU, ID, IL, IN, IR, IS, JO, JP, KE, KG, KH, KN, KP, KR, KW, KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, (21) International Application Number: MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, PCT/US2018/056167 OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, (22) International Filing Date: SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, 16 October 2018 (16. 10.2018) TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW. (25) Filing Language: English (84) Designated States (unless otherwise indicated, for every kind of regional protection available): ARIPO (BW, GH, (26) Publication Language: English GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, TZ, (30) Priority Data: UG, ZM, ZW), Eurasian (AM, AZ, BY, KG, KZ, RU, TJ, 62/573,025 16 October 2017 (16. 10.2017) US TM), European (AL, AT, BE, BG, CH, CY, CZ, DE, DK, EE, ES, FI, FR, GB, GR, HR, HU, ΓΕ , IS, IT, LT, LU, LV, (71) Applicant: MASSACHUSETTS INSTITUTE OF MC, MK, MT, NL, NO, PL, PT, RO, RS, SE, SI, SK, SM, TECHNOLOGY [US/US]; 77 Massachusetts Avenue, TR), OAPI (BF, BJ, CF, CG, CI, CM, GA, GN, GQ, GW, Cambridge, Massachusetts 02139 (US). -
In-Cell Architecture of an Actively Transcribing-Translating Expressome
bioRxiv preprint doi: https://doi.org/10.1101/2020.02.28.970111; this version posted February 28, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. In-cell architecture of an actively transcribing-translating expressome Francis J. O’Reilly1, †, Liang Xue2,3, †, Andrea Graziadei1, †, Ludwig Sinn1, Swantje Lenz1, 5 Dimitry Tegunov4, Cedric Blötz5, Wim J. H. Hagen2, Patrick Cramer4, Jörg Stülke5, Julia Mahamid2,*, Juri Rappsilber1,6,* Affiliations: 1 Bioanalytics, Institute of Biotechnology, Technische Universität Berlin, 13355 Berlin, 10 Germany 2 Structural and Computational Biology Unit, European Molecular Biology Laboratory (EMBL), Meyerhofstraße 1, 69117 Heidelberg, Germany. 3 Collaboration for joint PhD degree between EMBL and Heidelberg University, Faculty of Biosciences 15 4 Department of Molecular Biology, Max-Planck-Institute for Biophysical Chemistry, Am Faßberg 11, 37077, Göttingen, Germany 5 Department of General Microbiology, Institute of Microbiology and Genetics, GZMB, Georg- August-University Göttingen, Grisebachstraße 8, 37077 Göttingen, Germany 6 Wellcome Centre for Cell Biology, University of Edinburgh, Max Born Crescent, Edinburgh, 20 EH9 3BF, UK *Correspondence to: [email protected], [email protected] †These authors contributed equally to this work. 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.02.28.970111; this version posted February 28, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. -
Whole Exome Sequencing in Families at High Risk for Hodgkin Lymphoma: Identification of a Predisposing Mutation in the KDR Gene
Hodgkin Lymphoma SUPPLEMENTARY APPENDIX Whole exome sequencing in families at high risk for Hodgkin lymphoma: identification of a predisposing mutation in the KDR gene Melissa Rotunno, 1 Mary L. McMaster, 1 Joseph Boland, 2 Sara Bass, 2 Xijun Zhang, 2 Laurie Burdett, 2 Belynda Hicks, 2 Sarangan Ravichandran, 3 Brian T. Luke, 3 Meredith Yeager, 2 Laura Fontaine, 4 Paula L. Hyland, 1 Alisa M. Goldstein, 1 NCI DCEG Cancer Sequencing Working Group, NCI DCEG Cancer Genomics Research Laboratory, Stephen J. Chanock, 5 Neil E. Caporaso, 1 Margaret A. Tucker, 6 and Lynn R. Goldin 1 1Genetic Epidemiology Branch, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 2Cancer Genomics Research Laboratory, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 3Ad - vanced Biomedical Computing Center, Leidos Biomedical Research Inc.; Frederick National Laboratory for Cancer Research, Frederick, MD; 4Westat, Inc., Rockville MD; 5Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; and 6Human Genetics Program, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD, USA ©2016 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol.2015.135475 Received: August 19, 2015. Accepted: January 7, 2016. Pre-published: June 13, 2016. Correspondence: [email protected] Supplemental Author Information: NCI DCEG Cancer Sequencing Working Group: Mark H. Greene, Allan Hildesheim, Nan Hu, Maria Theresa Landi, Jennifer Loud, Phuong Mai, Lisa Mirabello, Lindsay Morton, Dilys Parry, Anand Pathak, Douglas R. Stewart, Philip R. Taylor, Geoffrey S. Tobias, Xiaohong R. Yang, Guoqin Yu NCI DCEG Cancer Genomics Research Laboratory: Salma Chowdhury, Michael Cullen, Casey Dagnall, Herbert Higson, Amy A. -
Short-Term Western-Style Diet Negatively Impacts Reproductive Outcomes in Primates
Short-term Western-style diet negatively impacts reproductive outcomes in primates Sweta Ravisankar, … , Shawn L. Chavez, Jon D. Hennebold JCI Insight. 2021;6(4):e138312. https://doi.org/10.1172/jci.insight.138312. Research Article Metabolism Reproductive biology A maternal Western-style diet (WSD) is associated with poor reproductive outcomes, but whether this is from the diet itself or underlying metabolic dysfunction is unknown. Here, we performed a longitudinal study using regularly cycling female rhesus macaques (n = 10) that underwent 2 consecutive in vitro fertilization (IVF) cycles, one while consuming a low-fat diet and another 6–8 months after consuming a high-fat WSD. Metabolic data were collected from the females prior to each IVF cycle. Follicular fluid (FF) and oocytes were assessed for cytokine/steroid levels and IVF potential, respectively. Although transition to a WSD led to weight gain and increased body fat, no difference in insulin levels was observed. A significant decrease in IL-1RA concentration and the ratio of cortisol/cortisone was detected in FF after WSD intake. Despite an increased probability of isolating mature oocytes, a 44% reduction in blastocyst number was observed with WSD consumption, and time-lapse imaging revealed delayed mitotic timing and multipolar divisions. RNA sequencing of blastocysts demonstrated dysregulation of genes involved in RNA binding, protein channel activity, mitochondrial function and pluripotency versus cell differentiation after WSD consumption. Thus, short-term WSD consumption promotes a proinflammatory intrafollicular microenvironment that is associated with impaired preimplantation development in the absence of large-scale metabolic changes. Find the latest version: https://jci.me/138312/pdf RESEARCH ARTICLE Short-term Western-style diet negatively impacts reproductive outcomes in primates Sweta Ravisankar,1,2 Alison Y. -
Chapter 4.1 a 400 Kb Duplication, 2.4 Mb Triplication and 130 Kb
High-resolution karyotyping by oligonucleotide microarrays : the next revolution in cytogenetics Gijsbers, A.C.J. Citation Gijsbers, A. C. J. (2010, November 30). High-resolution karyotyping by oligonucleotide microarrays : the next revolution in cytogenetics. Retrieved from https://hdl.handle.net/1887/16187 Version: Corrected Publisher’s Version Licence agreement concerning inclusion of doctoral thesis in the License: Institutional Repository of the University of Leiden Downloaded from: https://hdl.handle.net/1887/16187 Note: To cite this publication please use the final published version (if applicable). Chapter 4.1 A 400 kb duplication, 2.4 Mb triplication and 130 kb duplication of 9q34.3 in a patient with severe mental retardation Antoinet CJ Gijsbers, Emilia K Bijlsma, Marjan M Weiss, Egbert Bakker, Martijn H Breuning, Mariëtte JV Hoffer and Claudia AL Ruivenkamp Center for Human and Clinical Genetics; Leiden University Medical Center (LUMC), Leiden, The Netherlands Eur J Med Genet 2008;51:479-487 Chapter 4 Abstract The presence of a duplication as well as a triplication in one chromosome is a rare rearrangement and not easy to distinguish with routine chromosomal analysis. Recent developments in array technologies, however, not only allow screening of the whole genome at a higher resolution, but also make it possible to characterize complex chromosomal rearrangements in more detail. Here we report a molecular cytogenetic analysis of a 16-year old female with severe mental retardation and an abnormality on the end of the long arm of chromosome 9. Subtelomeric multiplex ligation-dependent probe amplification (MLPA) analysis revealed that the extra material originated from the telomeric end of chromosome 9q. -
Expressomal Approach for Comprehensive Analysis and Visualization of Ligand Sensitivities of Xenoestrogen Responsive Genes
Expressomal approach for comprehensive analysis and visualization of ligand sensitivities of xenoestrogen responsive genes Toshi Shiodaa,b,1, Noël F. Rosenthala, Kathryn R. Cosera, Mizuki Sutoa, Mukta Phatakc, Mario Medvedovicc, Vincent J. Careyb,d, and Kurt J. Isselbachera,b,1 aMolecular Profiling Laboratory, Massachusetts General Hospital Center for Cancer Research, Charlestown, MA 02129; bDepartment of Medicine, Harvard Medical School, Boston, MA 02115; cLaboratory for Statistical Genomics and Systems Biology, Department of Environmental Health, University of Cincinnati College of Medicine, Cincinnati, OH 45267; and dChanning Laboratory, Brigham and Women’s Hospital, Boston, MA 02115 Contributed by Kurt J. Isselbacher, August 26, 2013 (sent for review June 17, 2013) Although biological effects of endocrine disrupting chemicals Evidence is accumulating that the EDCs may cause significant (EDCs) are often observed at unexpectedly low doses with occa- biological effects in humans or animals at doses far lower than sional nonmonotonic dose–response characteristics, transcriptome- the exposure limits set by regulatory agencies (8, 9). In addition wide profiles of sensitivities or dose-dependent behaviors of the to such low-dose effects, an increasing number of studies also EDC responsive genes have remained unexplored. Here, we describe support the concept of the nonmonotonic EDC effects, whose dose–response curves show U shapes or inverted-U shapes (8- expressome analysis for the comprehensive examination of dose- – dependent gene responses -
Using Edsurvey to Analyze NCES Data: an Illustration of Analyzing NAEP Primer
Using EdSurvey to Analyze NCES Data: An Illustration of Analyzing NAEP Primer Developed by Michael Lee, Paul Bailey, Ahmad Emad, Ting Zhang, Trang Nguyen, and Jiao Yu*† February 21, 2020 Overview of the EdSurvey Package National Assessment of Educational Progress (NAEP) datasets from the National Center for Education Statistics (NCES) require special statistical methods to analyze. Because of their scope and complexity, the EdSurvey package gives users functions to perform analyses that account for both complex sample survey designs and the use of plausible values. The EdSurvey package also seamlessly takes advantage of the LaF package to read in data only when required for an analysis. Users with computers that have insuÿcient memory to read in entire NAEP datasets can still do analyses without having to write special code to read in just the appropriate variables. This situation is addressed directly in the EdSurvey package—behind the scenes and without any special tuning by the user. Vignette Outline This vignette will describe the basics of using the EdSurvey package for analyzing NAEP data as follows. • Notes – Additional resources – Vignette notation – Software requirements • Setting up the environment for analyzing NCES data – Installing and loading EdSurvey – Philosophy of Conducting Analyses Using the EdSurvey Package – Downloading data – Reading in data – Getting to know the data format – Removing special values • Explore Variable Distributions with summary2 • Subsetting the data • Retrieving data for further manipulation with getData *This publication was prepared for NCES under Contract No. ED-IES-12-D-0002 with the American Institutes for Research. Mention of trade names, commercial products, or organizations does not imply endorsement by the U.S. -
PDF Output of CLIC (Clustering by Inferred Co-Expression)
PDF Output of CLIC (clustering by inferred co-expression) Dataset: Num of genes in input gene set: 13 Total number of genes: 16493 CLIC PDF output has three sections: 1) Overview of Co-Expression Modules (CEMs) Heatmap shows pairwise correlations between all genes in the input query gene set. Red lines shows the partition of input genes into CEMs, ordered by CEM strength. Each row shows one gene, and the brightness of squares indicates its correlations with other genes. Gene symbols are shown at left side and on the top of the heatmap. 2) Details of each CEM and its expansion CEM+ Top panel shows the posterior selection probability (dataset weights) for top GEO series datasets. Bottom panel shows the CEM genes (blue rows) as well as expanded CEM+ genes (green rows). Each column is one GEO series dataset, sorted by their posterior probability of being selected. The brightness of squares indicates the gene's correlations with CEM genes in the corresponding dataset. CEM+ includes genes that co-express with CEM genes in high-weight datasets, measured by LLR score. 3) Details of each GEO series dataset and its expression profile: Top panel shows the detailed information (e.g. title, summary) for the GEO series dataset. Bottom panel shows the background distribution and the expression profile for CEM genes in this dataset. Overview of Co-Expression Modules (CEMs) with Dataset Weighting Scale of average Pearson correlations Num of Genes in Query Geneset: 13. Num of CEMs: 1. 0.0 0.2 0.4 0.6 0.8 1.0 Rps29 Rps28 Fau Rps6 Mrps2 Rps18 Mrps6 Rps25