Produktinformation
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Systemic Surfaceome Profiling Identifies Target Antigens for Immune-Based Therapy in Subtypes of Advanced Prostate Cancer
Systemic surfaceome profiling identifies target antigens for immune-based therapy in subtypes of advanced prostate cancer John K. Leea,b,c, Nathanael J. Bangayand, Timothy Chaie, Bryan A. Smithf, Tiffany E. Parivaf, Sangwon Yung, Ajay Vashishth, Qingfu Zhangi,j, Jung Wook Parkf, Eva Coreyk, Jiaoti Huangi, Thomas G. Graeberc,d,l,m, James Wohlschlegelh, and Owen N. Wittec,d,f,n,o,1 aDivision of Hematology and Oncology, Department of Medicine, University of California, Los Angeles, CA 90095; bInstitute of Urologic Oncology, Department of Urology, University of California, Los Angeles, CA 90095; cJonsson Comprehensive Cancer Center, University of California, Los Angeles, CA 90095; dDepartment of Molecular and Medical Pharmacology, University of California, Los Angeles, CA 90095; eStanford University School of Medicine, Palo Alto, CA 94305; fDepartment of Microbiology, Immunology, and Medical Genetics, University of California, Los Angeles, CA 90095; gYale School of Medicine, New Haven, CT 06510; hDepartment of Biological Chemistry, University of California, Los Angeles, CA 90095; iDepartment of Pathology, Duke University School of Medicine, Durham, NC 27708; jDepartment of Pathology, China Medical University, 110001 Shenyang, People’s Republic of China; kDepartment of Urology, University of Washington School of Medicine, Seattle, WA 98195; lCrump Institute for Molecular Imaging, University of California, Los Angeles, CA 90095; mUCLA Metabolomics Center, University of California, Los Angeles, CA 900095; nParker Institute for Cancer Immunotherapy, -
FXYD2 Monoclonal Antibody (M01), Human Gene Nomenclature for the Family Is Clone 1C3-B3 FXYD-Domain Containing Ion Transport Regulator
FXYD2 monoclonal antibody (M01), human gene nomenclature for the family is clone 1C3-B3 FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). Catalog Number: H00000486-M01 FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. Regulatory Status: For research use only (RUO) FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been Product Description: Mouse monoclonal antibody shown to induce channel activity in experimental raised against a full length recombinant FXYD2. expression systems. Transmembrane topology has been established for two family members (FXYD1 and Clone Name: 1C3-B3 FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Immunogen: FXYD2 (AAH05302.1, 1 a.a. ~ 64 a.a) The Type III integral membrane protein encoded by this full-length recombinant protein with GST tag. MW of the gene is the gamma subunit of the Na,K-ATPase present GST tag alone is 26 KDa. on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, Sequence: it is thought that the gamma subunit modulates the MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFI enzyme's activity by inducing ion channel activity. VGLLILLSRRFRCGGNKKRRQINEDEP Mutations in this gene have been associated with renal Host: Mouse hypomagnesaemia. Alternatively spliced transcript variants encoding different isoforms have been found for Reactivity: Human this gene. [provided by RefSeq] Applications: ELISA, IHC-P, S-ELISA, WB-Ce, WB-Re References: (See our web site product page for detailed applications 1. -
Single-Cell Transcriptomes Reveal a Complex Cellular Landscape in the Middle Ear and Differential Capacities for Acute Response to Infection
fgene-11-00358 April 9, 2020 Time: 15:55 # 1 ORIGINAL RESEARCH published: 15 April 2020 doi: 10.3389/fgene.2020.00358 Single-Cell Transcriptomes Reveal a Complex Cellular Landscape in the Middle Ear and Differential Capacities for Acute Response to Infection Allen F. Ryan1*, Chanond A. Nasamran2, Kwang Pak1, Clara Draf1, Kathleen M. Fisch2, Nicholas Webster3 and Arwa Kurabi1 1 Departments of Surgery/Otolaryngology, UC San Diego School of Medicine, VA Medical Center, La Jolla, CA, United States, 2 Medicine/Center for Computational Biology & Bioinformatics, UC San Diego School of Medicine, VA Medical Center, La Jolla, CA, United States, 3 Medicine/Endocrinology, UC San Diego School of Medicine, VA Medical Center, La Jolla, CA, United States Single-cell transcriptomics was used to profile cells of the normal murine middle ear. Clustering analysis of 6770 transcriptomes identified 17 cell clusters corresponding to distinct cell types: five epithelial, three stromal, three lymphocyte, two monocyte, Edited by: two endothelial, one pericyte and one melanocyte cluster. Within some clusters, Amélie Bonnefond, Institut National de la Santé et de la cell subtypes were identified. While many corresponded to those cell types known Recherche Médicale (INSERM), from prior studies, several novel types or subtypes were noted. The results indicate France unexpected cellular diversity within the resting middle ear mucosa. The resolution of Reviewed by: Fabien Delahaye, uncomplicated, acute, otitis media is too rapid for cognate immunity to play a major Institut Pasteur de Lille, France role. Thus innate immunity is likely responsible for normal recovery from middle ear Nelson L. S. Tang, infection. The need for rapid response to pathogens suggests that innate immune The Chinese University of Hong Kong, China genes may be constitutively expressed by middle ear cells. -
A High-Throughput Approach to Uncover Novel Roles of APOBEC2, a Functional Orphan of the AID/APOBEC Family
Rockefeller University Digital Commons @ RU Student Theses and Dissertations 2018 A High-Throughput Approach to Uncover Novel Roles of APOBEC2, a Functional Orphan of the AID/APOBEC Family Linda Molla Follow this and additional works at: https://digitalcommons.rockefeller.edu/ student_theses_and_dissertations Part of the Life Sciences Commons A HIGH-THROUGHPUT APPROACH TO UNCOVER NOVEL ROLES OF APOBEC2, A FUNCTIONAL ORPHAN OF THE AID/APOBEC FAMILY A Thesis Presented to the Faculty of The Rockefeller University in Partial Fulfillment of the Requirements for the degree of Doctor of Philosophy by Linda Molla June 2018 © Copyright by Linda Molla 2018 A HIGH-THROUGHPUT APPROACH TO UNCOVER NOVEL ROLES OF APOBEC2, A FUNCTIONAL ORPHAN OF THE AID/APOBEC FAMILY Linda Molla, Ph.D. The Rockefeller University 2018 APOBEC2 is a member of the AID/APOBEC cytidine deaminase family of proteins. Unlike most of AID/APOBEC, however, APOBEC2’s function remains elusive. Previous research has implicated APOBEC2 in diverse organisms and cellular processes such as muscle biology (in Mus musculus), regeneration (in Danio rerio), and development (in Xenopus laevis). APOBEC2 has also been implicated in cancer. However the enzymatic activity, substrate or physiological target(s) of APOBEC2 are unknown. For this thesis, I have combined Next Generation Sequencing (NGS) techniques with state-of-the-art molecular biology to determine the physiological targets of APOBEC2. Using a cell culture muscle differentiation system, and RNA sequencing (RNA-Seq) by polyA capture, I demonstrated that unlike the AID/APOBEC family member APOBEC1, APOBEC2 is not an RNA editor. Using the same system combined with enhanced Reduced Representation Bisulfite Sequencing (eRRBS) analyses I showed that, unlike the AID/APOBEC family member AID, APOBEC2 does not act as a 5-methyl-C deaminase. -
Rett Syndrome – Biological Pathways Leading from MECP2 to Disorder Phenotypes Friederike Ehrhart1,2* , Susan L
Ehrhart et al. Orphanet Journal of Rare Diseases (2016) 11:158 DOI 10.1186/s13023-016-0545-5 REVIEW Open Access Rett syndrome – biological pathways leading from MECP2 to disorder phenotypes Friederike Ehrhart1,2* , Susan L. M. Coort2, Elisa Cirillo2, Eric Smeets1, Chris T. Evelo1,2 and Leopold M. G. Curfs1 Abstract Rett syndrome (RTT) is a rare disease but still one of the most abundant causes for intellectual disability in females. Typical symptoms are onset at month 6–18 after normal pre- and postnatal development, loss of acquired skills and severe intellectual disability. The type and severity of symptoms are individually highly different. A single mutation in one gene, coding for methyl-CpG-binding protein 2 (MECP2), is responsible for the disease. The most important action of MECP2 is regulating epigenetic imprinting and chromatin condensation, but MECP2 influences many different biological pathways on multiple levels although the molecular pathways from gene to phenotype are currently not fully understood. In this review the known changes in metabolite levels, gene expression and biological pathways in RTT are summarized, discussed how they are leading to some characteristic RTT phenotypes and therefore the gaps of knowledge are identified. Namely, which phenotypes have currently no mechanistic explanation leading back to MECP2 related pathways? As a result of this review the visualization of the biologic pathways showing MECP2 up- and downstream regulation was developed and published on WikiPathways which will serve as template for future omics data driven research. This pathway driven approach may serve as a use case for other rare diseases, too. Keywords: Rett syndrome, MECP2, Systems biology, Bioinformatics, Data integration, DNA methylation, Epigenetics Background a RTT like phenotype, i.e. -
A Single-Cell Transcriptome Atlas of the Mouse Glomerulus
RAPID COMMUNICATION www.jasn.org A Single-Cell Transcriptome Atlas of the Mouse Glomerulus Nikos Karaiskos,1 Mahdieh Rahmatollahi,2 Anastasiya Boltengagen,1 Haiyue Liu,1 Martin Hoehne ,2 Markus Rinschen,2,3 Bernhard Schermer,2,4,5 Thomas Benzing,2,4,5 Nikolaus Rajewsky,1 Christine Kocks ,1 Martin Kann,2 and Roman-Ulrich Müller 2,4,5 Due to the number of contributing authors, the affiliations are listed at the end of this article. ABSTRACT Background Three different cell types constitute the glomerular filter: mesangial depending on cell location relative to the cells, endothelial cells, and podocytes. However, to what extent cellular heteroge- glomerular vascular pole.3 Because BP ad- neity exists within healthy glomerular cell populations remains unknown. aptation and mechanoadaptation of glo- merular cells are key determinants of kidney Methods We used nanodroplet-based highly parallel transcriptional profiling to function and dysregulated in kidney disease, characterize the cellular content of purified wild-type mouse glomeruli. we tested whether glomerular cell type sub- Results Unsupervised clustering of nearly 13,000 single-cell transcriptomes identi- sets can be identified by single-cell RNA fied the three known glomerular cell types. We provide a comprehensive online sequencing in wild-type glomeruli. This atlas of gene expression in glomerular cells that can be queried and visualized using technique allows for high-throughput tran- an interactive and freely available database. Novel marker genes for all glomerular scriptome profiling of individual cells and is cell types were identified and supported by immunohistochemistry images particularly suitable for identifying novel obtained from the Human Protein Atlas. -
The Use of Genetic Analyses and Functional Assays for the Interpretation of Rare Variants in Pediatric Heart Disease
The use of genetic analyses and functional assays for the interpretation of rare variants in pediatric heart disease A dissertation submitted to the Division of Graduate Studies and Research, University of Cincinnati in partial fulfillment of the requirements for the degree of Doctor of Philosophy in Molecular Genetics by Jeffrey A. Schubert Bachelor of Science, Mount St. Joseph University, 2012 Committee Chair: Stephanie M. Ware, M.D., Ph.D. Edmund Choi, Ph.D. Benjamin Landis, M.D. Anil Menon, Ph.D. David Wieczorek, Ph.D. Molecular Genetics, Biochemistry, and Microbiology Graduate Program College of Medicine, University of Cincinnati Cincinnati, Ohio, USA, 2018 ABSTRACT The use of next generation technologies such as whole exome sequencing (WES) has paved the way for discovering novel causes of Mendelian diseases. This has been demonstrated in pediatric heart diseases, including cardiomyopathy (CM) and familial thoracic aortic aneurysm (TAA). Each of these conditions carries a high risk of a serious cardiac event, including sudden heart failure or aortic rupture, which are often fatal. Patients with either disease can be asymptomatic before presenting with these events, which necessitates early diagnosis. Though there are many known genetic causes of disease for both conditions, there is still room for discovery of novel pathogenic genes and variants, as many patients have an undefined genetic diagnosis. WES covers the protein-coding portion of the genome, which yields a massive amount of data, though it comprises only 1% of the genome. Sorting and filtering sequencing information to identify (sometimes) a single base pair change responsible for the patient phenotype is challenging. Further, interpreting identified candidate variants must be done according to strict standards, which makes it difficult to definitively say whether a coding change is pathogenic or benign. -
Comprehensive Analysis Reveals Novel Gene Signature in Head and Neck Squamous Cell Carcinoma: Predicting Is Associated with Poor Prognosis in Patients
5892 Original Article Comprehensive analysis reveals novel gene signature in head and neck squamous cell carcinoma: predicting is associated with poor prognosis in patients Yixin Sun1,2#, Quan Zhang1,2#, Lanlin Yao2#, Shuai Wang3, Zhiming Zhang1,2 1Department of Breast Surgery, The First Affiliated Hospital of Xiamen University, School of Medicine, Xiamen University, Xiamen, China; 2School of Medicine, Xiamen University, Xiamen, China; 3State Key Laboratory of Cellular Stress Biology, School of Life Sciences, Xiamen University, Xiamen, China Contributions: (I) Conception and design: Y Sun, Q Zhang; (II) Administrative support: Z Zhang; (III) Provision of study materials or patients: Y Sun, Q Zhang; (IV) Collection and assembly of data: Y Sun, L Yao; (V) Data analysis and interpretation: Y Sun, S Wang; (VI) Manuscript writing: All authors; (VII) Final approval of manuscript: All authors. #These authors contributed equally to this work. Correspondence to: Zhiming Zhang. Department of Surgery, The First Affiliated Hospital of Xiamen University, Xiamen, China. Email: [email protected]. Background: Head and neck squamous cell carcinoma (HNSC) remains an important public health problem, with classic risk factors being smoking and excessive alcohol consumption and usually has a poor prognosis. Therefore, it is important to explore the underlying mechanisms of tumorigenesis and screen the genes and pathways identified from such studies and their role in pathogenesis. The purpose of this study was to identify genes or signal pathways associated with the development of HNSC. Methods: In this study, we downloaded gene expression profiles of GSE53819 from the Gene Expression Omnibus (GEO) database, including 18 HNSC tissues and 18 normal tissues. -
Mouse Fxyd5 Conditional Knockout Project (CRISPR/Cas9)
http://www.alphaknockout.com/ Mouse Fxyd5 Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Fxyd5 conditional knockout mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Fxyd5 gene ( NCBI Reference Sequence: NM_001287217 ; Ensembl: ENSMUSG00000009687 ) is located on mouse chromosome 7. 9 exons are identified , with the ATG start codon in exon 2 and the TGA stop codon in exon 9 (Transcript: ENSMUST00000009831). Exon 4~8 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the mouse Fxyd5 gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-327F20 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 4~8 is not frameshift exon, and covers 65.92% of the coding region. The size of intron 3 for 5'-loxP site insertion: 1088 bp, and the size of intron 8 for 3'-loxP site insertion: 2190 bp. The size of effective cKO region: ~4385 bp. This strategy is designed based on genetic information in existing databases. Due to the complexity of biological processes, all risk of loxP insertion on gene transcription, RNA splicing and protein translation cannot be predicted at existing technological level. The transcript Fxyd5-212 may be affected by inserting the second loxP. Page 1 of 8 http://www.alphaknockout.com/ Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 3 4 5 6 7 8 9 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Exon of mouse Fxyd5 Homology arm cKO region loxP site Page 2 of 8 http://www.alphaknockout.com/ Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats. -
Mechanistic Models of Signaling Pathways Reveal the Drug Action Mechanisms Behind Gender-Specific Gene Expression for Cancer Treatments
cells Article Mechanistic Models of Signaling Pathways Reveal the Drug Action Mechanisms behind Gender-Specific Gene Expression for Cancer Treatments Cankut Çubuk 1,2,3, Fatma E. Can 1,4, María Peña-Chilet 1,5,6 and Joaquín Dopazo 1,5,6,7,* 1 Clinical Bioinformatics Area, Fundación Progreso y Salud (FPS), CDCA, Hospital Virgen del Rocio, 41013 Sevilla, Spain; [email protected] (C.Ç.); [email protected] (F.E.C.); [email protected] (M.P.-C.) 2 Division of Genetics and Epidemiology, Institute of Cancer Research, London SW7 3RP, UK 3 William Harvey Research Institute, Queen Mary University, London EC1M 6BQ, UK 4 Department of Biostatistics, Faculty of Medicine, Izmir Katip Celebi University, 35620 Balatçık, Turkey 5 Bioinformatics in Rare Diseases (BiER), Centro de Investigación Biomédica en Red de Enfermedades Raras (CIBERER), FPS, Hospital Virgen del Rocio, 41013 Sevilla, Spain 6 Computational Systems Medicine, Institute of Biomedicine of Seville (IBIS), 41013 Sevilla, Spain 7 FPS-ELIXIR-ES, Hospital Virgen del Rocío, 41013 Sevilla, Spain * Correspondence: [email protected]; Tel.: +34-677-91-0685 Received: 31 May 2020; Accepted: 24 June 2020; Published: 29 June 2020 Abstract: Despite the existence of differences in gene expression across numerous genes between males and females having been known for a long time, these have been mostly ignored in many studies, including drug development and its therapeutic use. In fact, the consequences of such differences over the disease mechanisms or the drug action mechanisms are completely unknown. Here we applied mechanistic mathematical models of signaling activity to reveal the ultimate functional consequences that gender-specific gene expression activities have over cell functionality and fate. -
WO 2014/028907 Al 20 February 2014 (20.02.2014) P O P C T
(12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2014/028907 Al 20 February 2014 (20.02.2014) P O P C T (51) International Patent Classification: (74) Agents: EVANS, Judith et al; P.O. Box 23 1, Manassas, C12Q 1/68 (2006.01) G01N 33/00 (2006.01) VA 20108 (US). (21) International Application Number: (81) Designated States (unless otherwise indicated, for every PCT/US20 13/055469 kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, (22) International Filing Date: BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, 16 August 2013 (16.08.2013) DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, (25) Filing Language: English HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KN, KP, KR, KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, (26) Publication Language: English MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, (30) Priority Data: OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, 61/684,029 16 August 2012 (16.08.2012) US SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, 61/718,468 25 October 2012 (25. 10.2012) US TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, 61/745,207 2 1 December 2012 (21. 12.2012) US ZW. (71) Applicant: THE TRUSTEES OF COLUMBIA UNI¬ (84) Designated States (unless otherwise indicated, for every VERSITY IN THE CITY OF NEW YORK [US/US]; kind of regional protection available): ARIPO (BW, GH, 412 Low Memorial Library, 535 West 116th Street, New GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, SZ, TZ, York, NY 10027 (US). -
1 Supplementary Information ADCK2 Haploinsufficiency Reduces
Supplementary information ADCK2 haploinsufficiency reduces mitochondrial lipid oxidation and causes myopathy associated with CoQ deficiency.. Luis Vázquez-Fonseca1,8,§, Jochen Schäfer2,§, Ignacio Navas-Enamorado1,7, Carlos Santos-Ocaña1,10, Juan D. Hernández-Camacho1,10, Ignacio Guerra1, María V. Cascajo1,10, Ana Sánchez-Cuesta1,10, Zoltan Horvath2#, Emilio Siendones1, Cristina Jou3,10, Mercedes Casado3,10, Purificación Gutiérrez1, Gloria Brea-Calvo1,10, Guillermo López-Lluch1,10, Daniel M. Fernández-Ayala1,10, Ana B. Cortés- Rodríguez1,10, Juan C. Rodríguez-Aguilera1,10, Cristiane Matté4, Antonia Ribes5,10, Sandra Y. Prieto- Soler6, Eduardo Dominguez-del-Toro6, Andrea di Francesco8, Miguel A. Aon8, Michel Bernier8, Leonardo Salviati9, Rafael Artuch3,10, Rafael de Cabo8, Sandra Jackson2 and Plácido Navas1,10 1 Supplementary Results Case report The male index patient (subject II-3, Fig. S1A) presented to our clinic at 45 years of age with a 15-year history of slowly progressive muscle weakness and myalgia, which occurred at rest but worsened with exercise. Past medical history was unremarkable except for renal disease of unknown cause in childhood, which spontaneously improved. Family history was negative for neurological disease. On examination, moderate proximal symmetrical myopathy, more pronounced in the arms, was noted and the patient was unable to lift his arms above the horizontal position. The patient had a hyperlordotic, waddling gait and was only able to walk 100 meters without the aid of crutches. Bilateral scapular winging was present, and bilateral atrophy of the biceps, triceps, and quadriceps was noted, whilst the deltoid muscles were well preserved. Calf hypertrophy was present. The Trendelenburg sign was positive, and the patient was unable to rise from squatting.