A G E N D A

Date: Wednesday, 28 March 2018

Time: 9.0am

Venue: Council Chambers William Street Paeroa

L D Cavers Chief Executive

Members:

J P Tregidga (His Worship the Mayor) Cr D A Adams Cr P D Buckthought Cr C Daley Cr R Harris Cr G R Leonard Cr M McLean Cr P A Milner Cr A Rattray Cr D Smeaton Cr A M Spicer Cr D H Swales Cr J H Thorp

Distribution:

Elected Members: Staff : Public copies: (His Worship the Mayor) Cr D A Adams L Cavers Paeroa Office Cr P D Buckthought A de Laborde Plains Area Office Cr C Daley P Thom Waihi Area Office Cr R Harris S Fabish Cr G R Leonard D Peddie Cr M McLean M Buttimore Cr P A Milner Council Secretary Cr A Rattray Cr D Smeaton Cr A M Spicer Cr D H Swales Cr J H Thorp

COUNCIL AGENDA

Wednesday, 28 March 2018 – 9.00am - Council Office, William Street, Paeroa

10.30am Presenter: OceanaGold Limited Subject: Update on Recent Exploration Results and Future Plans

11.45am Presenter: Waikato Regional Council (WRC) Subject: Presentation of WRC Long Term Plan 2018-28

Order of Business Pages

1. Apologies. 2. Declarations of Late Items 3. Declarations of Interests 4. Confirmation of Council Minutes - 28-02-18 (2350652) 4 5. Confirmation of Extraordinary Council Minutes - 14-03-18 (2356554) 12 6. Receipt and adoption of Audit and Risk Committee Minutes - 21-02-18 (2352559) 18 7. 2018 Consultation Document Ratification (2358462) 26 8. Review of Delegations Community Services and Development and Council (2358383) 29 9. Waikato Regional Council - Construction of Access Bridge Maukoro Landing Road 33 (2358385)

10. Legal Boundary Encroachment - 65 Kent Crescent Waihi (2357936) 36 11. Award of LED Streetlight Contract (2359398) 40

12. Revocation of Resolution: Extension to the Taramaire Drainage District, Kaiaua 45 2357949)

13. Muggeridge’s Pump (2357957) 49 14. Dog Registration Fees 2018-18 (2357876) 54 15. Draft Hauraki District Growth Strategy 2050 (2358019) 60 16. CEO Monthly Report for March 2018 (2358318) 104 17. Council Financial Report - for the period to 28 February 2018 (2358390) 107 18. Planning and Environmental Services Monthly Report - February 2018 (2358265) 114

1 Council Agenda - 28-03-18 Doc ref: 2358655 19. Transport Report - February 2018 (2357947) 123 20. Water Services Report to Council - February 2018 (2357884) 127 Appendix A: Stormwater Diversion Report -28 Willoughby St Paeroa) - (2356426) 133 Appendix B: Preferred Solution Route Plans (2359262) 137 Appendix C: Tiaki Structural Inspection Report (2359272) 141

21. Solid Waste Report - February 2018 (2357955) 144 22. District Drainage Report to 28 February 2018 (2357944) 150 23. Receipt and adoption of Western Plains District Drainage Committee Minutes (22-02-18) (2356341) 153 24. Receipt and adoption of Eastern Plains District Drainage Committee Minutes (22-02-18) (2357091) 158

2 Council Agenda - 28-03-18 Doc ref: 2358655 Council Agenda - 28-03-18 Page 4

HAURAKI DISTRICT COUNCIL MEETING

MINUTES OF A MEETING OF THE HAURAKI DISTRICT COUNCIL HELD IN THE COUNCIL CHAMBERS, WILLIAM STREET, PAEROA ON WEDNESDAY, 28 FEBRUARY 2018 COMMENCING AT 9.00AM PRESENT J P Tregidga (His Worship the Mayor), Cr D A Adams (Deputy Mayor), Cr P D Buckthought, Cr C Daley, Cr R Harris, Cr G R Leonard, Cr M McLean, Cr P A Milner, Cr A Rattray, Cr A M Spicer, Cr D H Swales and Cr J H Thorp

IN ATTENDANCE Messrs L D Cavers (Chief Executive), A de Laborde (Group Manager - Engineering Services), D Peddie (Group Manager - Corporate Services), P Thom (Group Manager - Planning & Environmental Services), S Baker (Finance Manager), D Sales (Community Services Manager), J McIver (Community Engagement Manager), D Lees (Property Manager), M Buttimore (Strategic Planning Projects Manager), Ms C Mischewski (Policy Analyst), G Thomsen (Transportation Manager), E J Wentzel (Water Services Manager), L de Haast (Team Leader - Roading), S de Laborde (Manager, Planning and Infrastructure Systems) and Ms C Black (Council Secretary)

APOLOGIES

RESOLVED

THAT the apology of Cr D Smeaton be received and sustained.

C18/41 Tregidga/Milner CARRIED

LATE ITEMS

There were no late items.

DECLARATIONS OF INTERESTS

There were no declarations.

CONFIRMATION OF COUNCIL MINUTES – 31-01-18 (2326905)

The Mayor presented the minutes.

RESOLVED

THAT the minutes of the meeting of the Hauraki District Council held on Wednesday, 31 January 2018 are confirmed and are a true and correct record.

C18/42 Tregidga/Milner CARRIED

COUNCIL GOVERNANCE STRUCTURES AND APPOINTMENTS (2347611)

The Mayor presented a report which advised councillors of proposed changes to be made to the governance structure and to recommend changes to the appointments to certain Council organisations.     &RXQFLO0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 5

RESOLVED

THAT the report be received.

C18/43 Tregidga/Swales CARRIED

RESOLVED

THAT Council approve the position of Finance Portfolio and adopt the Job Description (as amended), and

THAT Council appoint Deputy Mayor Toby Adams as the Finance Portfolio holder, and

THAT Council note the Mayors decision that Deputy Mayor Toby Adams be appointed Chair of the Community Services and Development Committee and Cr Paul Milner be appointed as Deputy Chair effective from the 1 March 2018, and

THAT Council note the Mayors decision that Councillor Ross Harris be appointed Chair of the Economic Development Subcommittee and Councillor Gill Leonard remain as Deputy Chair, effective from the 1 March 2018, and

THAT Councillor Paul Milner be the Council appointee to Positive Paeroa Incorporated effective from 1 March 2018.

C18/44 Leonard/Thorp CARRIED

KAIAUA COAST EVENT FINANCIAL UPDATE (2348049)

The Finance Manager presented a report which provided an update on the two finance programmes (Kaiaua Coast Disaster Relief Fund and Welfare Activities) of work resulting from the adverse weather event which occurred on 5 January 2018 significantly affecting the Kaiaua community.

RESOLVED

THAT the report be received.

C18/45 Tregidga/Daley CARRIED

FINANCIAL BUILDING CONSENT ASSISTANCE FOR KAIAUA (2347366)

The Group Manager – Planning and Environmental Services presented a report which requested Council to consider what funding assistance be provided for the building consent costs for raising of houses inundated over their floor level or who were at risk of flooding in the January 2018 flood event affecting the community of Kaiaua.

RESOLVED

THAT the report be received.

C18/46 Tregidga/Swales CARRIED

    &RXQFLO0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 6

RESOLVED

THAT Council approves provision of up to $2,000 for the payment or waiver of Building Consent fees for each application for those property owners at risk from flooding by the Kaiaua Coast storm event in January 2018 who are lifting their building; provided:

y The building consent is issued with a section 72 notice under the Building Act 2004. y An ex gratia offer is signed by the applicant as outlined in Appendix A. y This provision is only for 10 consent applications per financial year.

C18/47 Swales/Buckthought CARRIED

REGIONAL COMMUNITY FACILITIES FUNDING FRAMEWORK (2347432) APPENDIX A - REGIONAL COMMUNITY FACILITIES FUNDING FRAMEWORK (2344507)

The Chief Executive spoke to a report which presented the final Waikato Region Community Facilities Funding Framework to be applied and to guide decisions about the funding of sub-regional and regional community facilities.

The Community Engagement Manager was in attendance in support of the item.

RESOLVED

THAT the report be received.

C18/48 McLean/Rattray CARRIED

RESOLVED

THAT Council adopts the Waikato Regional Community Facilities Funding Framework.

C18/49 Adams/Harris CARRIED

ROAD NAMING REPORT - BLUEBERRY LANE AND KARAMU PLACE (2347729)

The Transport Manager presented a report which sought Councils approval of a request to name two new roads created by subdivision on SH2, Waihi.

RESOLVED

THAT the report be received.

C18/50 Tregidga/Milner CARRIED

RESOLVED

THAT the new roads created by subdivision at 9139 State Highway 2, Waihi be named Blueberry Lane and Karamu Place.

C18/51 McLean/Rattray CARRIED

    &RXQFLO0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 7

PLANNING AND ENVIRONMENTAL MONTHLY REPORT – DECEMBER 2017 – JANUARY 2018 (2347365)

The Group Manager - Planning and Environmental Services presented the monthly planning and regulatory report covering the months of December 2017 and January 2018.

RESOLVED

THAT the report be received.

C18/52 Milner/Spicer CARRIED

Mangrove Management Bill – Endorsement of Submission

The Mayor, acting under delegation, approved and signed the submission on the Management of Mangroves Bill on behalf of Council to the Governance and Administration Select Committee. The member’s endorsement of the submission was sought.

RESOLVED

THAT Council endorse the submission to the Governance and Administration Select Committee on the Mangrove Management Bill.

C18/53 Thorp/Swales CARRIED

PRESENTATION: AUSTRALASIAN MANAGEMENT CHALLENGE

Council has once again entered a team into the Australasian Management Challenge. The Challenge day is on 14 March in Wellington. As part of the pre-challenge task, the staff team (Hauraki Trailblazers) had to produce a five-minute video and an associated three-page report on the issues/challenges the Council will likely face in 2030 and our proposed solutions to these challenges. They also had to discuss the challenges and proposed solutions with members of the community to receive feedback and make some high level recommendations to the Council. The aim was to think of innovative ideas for the Council.

Staff team members were in attendance for the presentation of the video.

The meeting adjourned at 10.25am The meeting reconvened at 10.40am

REPORT ON MfE COASTAL HAZARD AND CLIMATE CHANGE GUIDANCE (2347440)

The Policy Analyst presented a report which summarised the Ministry for the Environment’s guidance for local government on coastal hazards and climate change.

RESOLVED

THAT the report be received.

C18/54 Tregidga/Milner CARRIED

RESOLVED

THAT the 2017 Ministry for the Environment guidance on Coastal Hazards and Climate Change inform the 2018/19 climate change work programme which will assess the implications of climate change and the Council’s response, and     &RXQFLO0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 8

THAT staff incorporate the most recent sea-level rise data for the District in the Hauraki District Plan as part of the future plan change requirements.

C18/55 McLean/Spicer CARRIED

LEASE AGREEMENT ERIC AU AND HAURAKI DISTRICT COUNCIL (2347887) APPENDIX A - MAP OF ERIC AU PROPOSED LEASE AREA (2347890)

The Property Manager presented a report which sought the approval of Council to lease Council and area of land at Tetley’s Quarry in Waitakaruru, to Mr Eric Au to set up a yard for the construction of concrete walls for buildings in the Ngatea North subdivision in Ngatea.

RESOLVED

THAT the report be received.

C18/56 McLean/Swales CARRIED

RESOLVED

THAT the Council approves the Deed of Lease between Mr. Eric Au and the Hauraki District Council for the lease of 1.2 hectares at Tetley’s Quarry, Steen Road for the period of 5 years, and

THAT the lease be subject to the conditions set out in the report.

C18/57 Daley/Swales CARRIED

 HAURAKI HOUSE UPGRADE PROGRESS (2347889)

The Property Manager, for the information of the members, presented a report which updated on the Hauraki House upgrade/earthquake proofing project currently underway. He informed of variations to the project and on additional costs which have been incurred due to the installation of fire doors and emergency lighting.

RESOLVED

THAT the report be received.

C18/58 Milner/Daley CARRIED

 TRANSPORT REPORT - JANUARY 2018 (2347688)

The Transport Manager and Team Leader - Roading presented the transport activity report for the month of January 2018.

RESOLVED

THAT the report be received.

C18/59 Adams/Harris CARRIED

    &RXQFLO0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 9

Rahu Road Under Slip – Remedial Options

The Team Leader – Roading presented the remedial options report to address the historical slip on Rahu Road.

RESOLVED

THAT the proposed way forward for the Rahu Road under slip project (*as outlined in the report) is approved.

C18/60 Adams/McLean CARRIED

WATER SERVICES REPORT TO COUNCIL - FEBRUARY 2018 (2347492) APPENDIX A - SAFETY ISSUES SKETCH (WATER SERVICE DEPARTMENT) (2347505)

The Water Services Manager presented a report which provided the water services activity to February 2018.

RESOLVED THAT the report be received.

C18/61 Harris/Daley CARRIED

Stormwater System - Whiritoa

Due to a major event earlier in the year, an open drain was inundated with silt, requiring the drain to be cleared and other remedial work to be undertaken. The cost for this work is estimated to be in the order of $12,000. There is no budget provision for stormwater upgrades in Whiritoa in the Annual Plan. The Whiritoa Stormwater Fund has a substantial surplus so the upgrade will be funded from this budget.

RESOLVED

THAT $12,000.00 be made available from the Whiritoa Stormwater Cash Reserves for safety upgrades to the stormwater system in Whiritoa.

C18/62 Thorp/Spicer CARRIED

The meeting adjourned at 12.10pm. The meeting reconvened at 12.50pm.

CEO MONTHLY REPORT FOR FEBRUARY 2018 (2347484)

The Chief Executive presented his monthly report for the month of February 2018.

The report highlighted recent staff changes within the organisation and updated on the activities and topics of discussion at the February Mayoral Forum.

RESOLVED

THAT the report be received.

C18/63 Tregidga/Milner CARRIED

    &RXQFLO0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 10

SOLID WASTE REPORT TO COUNCIL - JANUARY 2018 (2347513)

The Manager, Planning and Infrastructure Systems presented the solid waste activity report for the month of January 2018.

RESOLVED

THAT the report be received.

C18/64 McLean/Buckthought CARRIED

Key matters raised:

y Update on Waihi Refuse Transfer Station. y Concern raised as to the standard of the Paeroa Refuse Transfer Station. y Members queried what process could be used to address the accountability of contractors to adhere to their service level agreements with Council.

DISTRICT DRAINAGE REPORT TO 31 JANUARY 2018 (2347511)

The Manager, Planning and Infrastructure Systems presented the district drainage activity report for the month of January 2018.

RESOLVED

THAT the report be received.

C18/65 Swales/Harris CARRIED

The minutes of the Western and Eastern District Drainage Committee meetings held in November 2017 were presented.

RECEIPT OF WESTERN PLAINS DISTRICT DRAINAGE MINUTES - 30-11-17 (2344307)

RESOLVED

THAT the minutes of the Western Plains Drainage District Committee meeting held on Thursday, 30 November 2017 be received and the recommendations therein adopted.

C18/66 Thorp/Buckthought CARRIED

RECEIPT OF EASTERN PLAINS DISTRICT DRAINAGE MINUTES - 30-11-17 (2344306)

RESOLVED

THAT the minutes of the Eastern Plains Drainage District Committee meeting held on Thursday, 30 November 2017 be received and the recommendations therein adopted.

C18/67 Swales/Thorp CARRIED

A discussion was held as to the need for the District Drainage Committee minutes to be considered earlier in the month by Council to ensure any recommendations made at these meetings can be received and considered by Council in a timelier way.

    &RXQFLO0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 11

COUNCIL FINANCIAL REPORT FOR THE PERIOD TO 31 JANUARY 2018 (2347757)

The Group Manager - Corporate Services presented the financial report to 31 January 2018.

RESOLVED

THAT the report be received.

C18/68 Milner/Daley CARRIED

The meeting closed at 1.55pm.

CONFIRMED

J P Tregidga Mayor

28 March 2018

    &RXQFLO0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 12

HAURAKI DISTRICT

EXTRAORDINARY MEETING OF COUNCIL

MINUTES OF AN EXTRAORDINARY MEETING OF THE HAURAKI DISTRICT COUNCIL HELD IN THE COUNCIL CHAMBERS, WILLIAM STREET, PAEROA ON WEDNESDAY, 14 MARCH 2018 COMMENCING AT 9.30AM

PRESENT J P Tregidga (His Worship the Mayor), Cr D A Adams (Deputy Mayor), Cr P D Buckthought, Cr C Daley, Cr R Harris, Cr G R Leonard, Cr M McLean, Cr P A Milner, Cr A Rattray, Cr D Smeaton Cr A M Spicer and Cr J H Thorp

IN ATTENDANCE Messrs L D Cavers (Chief Executive), A de Laborde (Group Manager - Engineering Services), D Peddie (Group Manager - Corporate Services), P Thom (Group Manager - Planning & Environmental Services), S Fabish (Group Manager - Community Services and Development), L Robcke (Senior Project Planner), Ms K Quinlan (Senior Strategic Planner), Ms S Holmes (Strategic Planner), Ms T Casey (Strategic Planner) and Ms C Black (Council Secretary)

APOLOGIES

RESOLVED

THAT the apology of Cr D Swales be received and sustained.

C18/69 Milner/McLean CARRIED

LATE ITEMS

Pursuant to Section 46A(7) of the Local Government Official Information and Meetings Act 1987, the Chairperson called for late items to be accepted.

RESOLVED

THAT pursuant to Section 46A(7) of the Local Government Official Information and Meetings Act 1987, the following late items be accepted for discussion.

- Underwriting of Kopu Section of Hauraki Rail Trail

The item was not on the agenda because the item was unavailable at the time of the agenda deadline.

Discussion on the item could not be delayed because the item required Council approval as soon as practicable as MBIE required confirmation urgently so the funding application could be progressed.

C18/70 Tregidga/Harris CARRIED

DECLARATIONS OF INTERESTS

There were no declarations.

1 Extraordinary Meeting of Council Minutes - 14-03-18 Doc. Ref: 2356554 Council Agenda - 28-03-18 Page 13

APPOINTMENT OF RMA COMMISSIONER (235351

The Senior Planning Project Planner presented a report which sought approval of the appointment of a commissioner to hear and decide on the RMA Section 95 (notification) and Section 104 (Consideration of applications) matters in relation to the proposed Tailings Storage Facility 2 (“TSF2”) Crest Raise project and the proposed change of resource consent conditions for the Extended Martha Mine Project (“EMMA”).

RESOLVED

THAT the report be received.

C18/71 Thorp/Leonard CARRIED

RESOLVED

THAT pursuant to section 34A (1) of the Resource Management Act 1991 Mr Alan Watson be appointed as Commissioner to consider and decide on the Section 95 notification report for the proposed Tailings Storage Facility 2 Crest Raise project; and

THAT pursuant to section 34A (1) of the Resource Management Act 1991 Mr Alan Watson be appointed as Commissioner to consider and decide on the application for the proposed Tailings Storage Facility 2 Crest Raise project; and

THAT pursuant to section 34A (1) of the Resource Management Act 1991 Mr Alan Watson be appointed as Commissioner to consider and decide on the Section 95 notification report for the proposed Extended Martha Mine change of conditions of resource consent application; and

THAT pursuant to section 34A (1) of the Resource Management Act 1991 Mr Alan Watson be appointed as Commissioner to consider and decide on the application for the proposed Extended Martha Mine change of conditions of resource consent application.

C18/72 Milner/Thorp CARRIED

2018-28 DRAFT REVENUE AND FINANCING POLICY AND RATES REMISSION AND POSTPONEMENT POLICIES (2353682)

A report from the Group Manager - Corporate Services was presented which sought approval and adoption of the consultation process of the Draft Revenue and Financing Policy and Rates Remission and Postponement Policies. A copy of the policies was attached.

RESOLVED

THAT the report be received.

C18/73 Tregidga/Rattray CARRIED

RESOLVED

THAT the Council adopts the draft Revenue & Financing Policy, and

THAT the Council adopts the draft Rates Remission & Postponement Policies, and

2 Extraordinary Meeting of Council Minutes - 14-03-18 Doc. Ref: 2356554 Council Agenda - 28-03-18 Page 14

THAT if needed, the Senior Strategic Planner, in consultation with the Chief Executive be authorised to correct any minor errors or omissions in any of the policies before the policies are made publicly available, and

THAT consultation on the draft Revenue & Financing Policy and the draft Rates Remission & Postponement Policies be undertaken concurrently with the 2018 long term plan special consultative procedure.

C18/74 McLean/Buckthought CARRIED

ADOPTION OF FEES AND CHARGES STATEMENT OF PROPOSAL (2353262)

The Strategic Policy Planner presented a report which provided Council with the statement of proposal (SOP) for the resource management and cemetery fees and charges, in order to be considered for adoption and subsequent consultation with the public between 23 March 2018 and 30 April 2018 (within the long term plan consultation process). A copy of the Statement of Proposal was attached.

RESOLVED

THAT the report be received.

C18/75 Harris/Daley CARRIED

RESOLVED

THAT the resource management and cemetery fees and charges statement of proposal (SOP) be adopted for public consultation in accordance with section 82 and 83 of the Local Government Act 2002, and

THAT consultation on the resource management and cemetery fees and charges be undertaken concurrently with the 2018 long term plan special consultative procedure, and

THAT the Council approves the following consultation timeframes:

1. The consultation material will be made publicly available on 23 March 2018.

2. The period for providing feedback will run from 23 March 2018 to 30 April 2018, with an additional opportunity to be heard by the Mayor and all Councillors on 16 May 2018.

3. All public feedback will be considered at extraordinary council meetings on 16 and 17 May 2018.

4. Changes as a result will be provided for in a draft schedule of fees and charges to be adopted by the Council when it meets on 27 June 2018.

C18/76 Harris/Daley CARRIED

2018 LTP - SUPPORTING INFORMATION (2353820) APPENDIX A: 2018 LTP SUPPORTING INFORMATION (2353942)

The Senior Strategic Planner provided a report which presented the supporting information which provides the basis of the 2018-28 Long Term Plan in support of the consultation document which presents the major Long Term Plan matters and choices facing Council. A copy of the supporting information was attached.

3 Extraordinary Meeting of Council Minutes - 14-03-18 Doc. Ref: 2356554 Council Agenda - 28-03-18 Page 15

RESOLVED

THAT the report be received.

C18/77 Milner/Rattray CARRIED

RESOLVED

THAT the Council adopts the supporting documents that provide the basis for the preparation of the 2018-28 Long Term Plan and that are relied on by the content of the consultation document adopted under section 93A, including:

y Our district profile y Our financial and other general assumptions y Our direction y Draft financial strategy y Draft infrastructure strategy y Our services y Significant negative effects y Capital projects y Our service providers y Dollars and cents including funding and financial statements, rates implications and fees and charges y Asset management plan executive summaries, and

THAT the Council approves the new proposed service level statement and targets for the Iwi liaison activity (as set out in the ‘Our Services’ supporting information), to:

1. agree on memoranda of partnerships with mana whenua within 15 months of each signed settlement, and

2. establish a mana whenua forum within 18 months of the collective signed settlement.

THAT if needed, the Senior Strategic Planner, in consultation with the Chief Executive be authorised to correct any minor errors or omissions in any of the supporting documents before the consultation document is made publicly available, and

THAT the Council notes that it has already adopted the following documents which will form part of its 2018-28 long term plan supporting information:

y Significance and engagement policy y Financial contributions policy y Liability management policy y Investment policy, and

THAT the Council notes that the following proposals are presented for approval to form the basis of consultation processes in separate agenda items:

y draft revenue and financing policy y draft rates remission and postponement policies y statement of proposal for changes to resource management and cemetery fees

4 Extraordinary Meeting of Council Minutes - 14-03-18 Doc. Ref: 2356554 Council Agenda - 28-03-18 Page 16

THAT Council acknowledges that in the first three years of the draft plan that its operating revenue for some activities is forecast at a level that is insufficient to meet its operating expenditure in those activities, and that overall revenue is insufficient to meet overall expenditure in the first two years of the plan, and

THAT Council considers it financially prudent to set operating revenue at the levels specified in the Consultation Document and Long Term Plan draft supporting documentation, despite this not always matching expenditure in every activity.

C18/78 Milner/Rattray CARRIED

2018 LTP CONSULTATION DOCUMENT (2353752)

The Senior Strategic Planner presented a report which outlined the draft long term plan (LTP) consultation document for adoption and a community engagement programme for approval. A copy of the consultation document was attached.

RESOLVED

THAT the report be received.

C18/79 CARRIED

RESOLVED

THAT the Council adopts the consultation document ‘We need to talk – Me kÛrero ng¢tahi t¢tou’ for consultation required by section 93A of the Local Government Act 2002, and

THAT the Audit NZ report required by section 93C (4) of the Act be received and included in the consultation document, and

THAT if needed, the Senior Strategic Planner, in consultation with the Chief Executive be authorised to correct any minor errors or omissions in the consultation document before it is made publicly available, and

THAT the Council undertakes the special consultative procedure required by section 93A of the Local Government Act 2002 in manner set out in the community engagement programme attached as Appendix B, and

THAT the Council approves the following consultation timeframes:

1. The consultation material will be made publicly available on 23 March 2018. 2. The period for providing feedback will run from 23 March 2018 to 30 April 2018, with an additional opportunity to be heard by the Mayor and all Councillors on 16 May 2018. 3. All public feedback will be considered at extraordinary council meetings on 16 and 17 May 2018. 4. Changes as a result will be provided for in a draft long term plan to be adopted by the Council when it meets on 27 June 2018.

C18/80 Tregidga/Spicer CARRIED

5 Extraordinary Meeting of Council Minutes - 14-03-18 Doc. Ref: 2356554 Council Agenda - 28-03-18 Page 17

LATE ITEM

UNDERWRITING OF SHORTFALL ON CONSTRUCTION OF THE KAIAUA TO PpKOROKORO / MIRANDA SECTION OF THE HAURAKI RAIL TRAIL (2355690)

The Group Manager – Engineering Services presented a report seeking Council support of funding towards any shortfall in the construction costs for the Pókorokoro-Miranda section of the Hauraki Rail Trail.

RESOLVED

THAT the report be received.

C18/81 Tregidga/Adams CARRIED

The Hauraki Rail Trail Charitable Trust (HRTCT) has applied to the Ministry of Business Innovation and Employment (MBIE) for funding to complete the original Hauraki Rail Trail (the Kaiaua to Pƻkorokoro / Miranda section) and to extend the trail from Te Aroha to Matamata. This is a $6.9M project and the funding model is split 50:50 with MBIE and the Councils – Matamata-Piako and Hauraki District Councils (MPDC and HDC).

The Kaiaua to Pƻkorokoro / Miranda section includes the trail head development – toilets, carpark etc in Kaiaua. MBIE’s contribution is $819,106 and MPDC’s contribution is $768,916 leaving a shortfall of $50,190.

The shortfall of $50,190 has arisen as Council are required by MBIE to include a separate cycleway bridge across the Pƻkorokoro / Miranda Stream adjacent to the East Coast Road Bridge for road safety reasons. The cost estimate for this bridge is $196,000. MBIE will fund 50%, MPDC will fund $47,810 leaving a potential shortfall of $50,190. The shortfall is dependent on the final cost of the bridge. The bridge contingency amount is 15% or $25,000. This is included in the cost estimate figure.

The $50,190 and any other project cost overruns for the Kaiaua to Pƻkorokoro / Miranda section are currently unfunded. The Council can make provision for the underwriting from District rates.

RESOLVED

THAT Council agrees to underwrite any shortfall in the construction costs for the Kaiaua to Pókorokoro / Miranda section of the Hauraki Rail Trail, and

THAT Council makes provision for the funding of the underwriting from asset sales or District rates.

C18/82 Leonard/Harris CARRIED

The meeting closed at 10.25am.

CONFIRMED

J P Tregidga Mayor

28 March 2018

6 Extraordinary Meeting of Council Minutes - 14-03-18 Doc. Ref: 2356554 Council Agenda - 28-03-18 Page 18

HAURAKI DISTRICT

AUDIT AND RISK COMMITTEE

MINUTES OF A MEETING OF THE COMMUNITY SERVICES AND DEVELOPMENT COMMITTEE HELD IN THE HAURAKI ROOM, WILLIAM STREET, PAEROA ON WEDNESDAY, 21 FEBRUARY 2018 COMMENCING AT 9.00 AM

PRESENT Mr P Bennett (In the Chair), His Worship the Mayor Mr J P Tregidga, Crs D A Adams, G R Leonard, P A Milner and D Smeaton

IN ATTENDANCE Cr R Harris, Messrs L D Cavers (Chief Executive), D Peddie (Group Manager - Corporate Services), S Baker (Finance Manager), Mrs J Sweeney (HR/Health & Safety Advisor), Mrs J Nicholls (Health and Safety Advisor) and Ms C Black (Council Secretary)

APOLOGIES

There were no apologies.

LATE ITEMS

There were no late items.

DECLARATIONS OF INTERESTS

There were no declarations.

CONFIRMATION OF AUDIT AND RISK COMMITTEE MINUTES - 12-12-18 (2324390)

The Chairperson presented the minutes.

RESOLVED

THAT the minutes of the Audit and Risk Committee meeting held on Tuesday, 12 December 2017 be confirmed and are a true and correct record.

ARC18/01 Tregidga/Leonard CARRIED

TREASURY REPORT AS AT 31 JANUARY 2018 (2345420)

The Group Manager – Corporate Services presented the report which updated on the current position of the loan/debt status, against the parameters outlined in the Council’s Financial Strategy and Liability Management Policy.

RESOLVED

THAT the report be received.

ARC18/02 Tregidga/Adams CARRIED

1 Audit & Risk Committee Minutes 21-02-18 Doc Ref: 2352559 Council Agenda - 28-03-18 Page 19

The Chief Executive asked the Corporate Services staff to add another column which shows the balance to financial strategy debt caps.

AUDIT & RISK TERMS OF REFERENCE (2345458)

The Chief Executive updated the members on the proposal to have an Audit & Risk Committee to consider risk and advise the framework of financial reporting.

The Mayor believed financial reporting should go to full Council. He proposed that Cr Adams be appointed to the portfolio of ‘finance’ and requested the member’s feedback on this proposal. The members supported that Cr Adams become finance portfolio holder which will in turn would be approved by Council.

Financial Reporting to Council

A discussion was held as to whether the Audit & Risk Committee continue to meet 2 monthly and if the formation of a separate Finance Committee be formed.

Cr Leonard supported that the areas of risk and financial reporting, a committee be formed to consider risk and another committee for finance.

The Chief Executive suggested the members go through the financial framework report included in the agenda first to assist them in evaluating what is the best configuration to deal with financial reporting and managing risk.

RESOLVED

THAT the report be received.

ARC18/03 Leonard/Milner CARRIED

At this point, the members were referred to the financial framework report and discussion on the Audit and Risk Terms of Reference was adjourned.

Chair, Paul Bennett highlighted the need for an effective and efficient way of reporting on risk and finance and invited feedback from the members on how they saw the framework working and what delegations they considered would be required.

RESOLVED

THAT corporate services staff report back to the Audit and Risk Committee in April on Audit and Risk delegations.

ARC18/04 Tregidga/Smeaton CARRIED

AUDIT & RISK COMMITTEE - FINANCIAL REPORT FRAMEWORK DISCUSSIONS (2345640)

The Finance Manager presented the financial framework report continuing on from the previous discussion. He described the concept of how he believed the financial framework could work using a flow diagram within the report. He expressed the view that different audiences within Council will have different financial reporting requirements in terms of content format and frequency.

2 Audit & Risk Committee Minutes 21-02-18 Doc Ref: 2352559 Council Agenda - 28-03-18 Page 20

RESOLVED

THAT the report be received.

ARC18/05 Adams/Leonard CARRIED

The Committee were supportive of the ‘dashboard’ concept of key indicators presented and also supported the traffic light indicators as an effective methodology to evaluate financial risk. The key is ‘elevation’ of risk. It was proposed that the following process be adopted as a way of evaluating financial risk of high level projects.

Highest level - Council to consider high level projects which hold a high financial risk level and level of detail. Next level down – Executive Leadership Team Next level down – Portfolio Holder Next level down - Budget Managers

The Committee supported that more structured and detailed reports be produced by staff particularly for high level projects to allow for better evaluation.

In relation to delegations, the Committee members agreed that it’s the Audit & Risk role should be ‘risk’ and that Council should deal with financial reporting.

The meeting adjourned at 10.25am. The meeting reconvened at 10.40am.

Consideration and discussion of the Terms of Reference report resumed.

RESOLVED

Staff to bring back a proposed Terms of Reference for the Committee based on discussions held at this meeting.

ARC18/06 Bennett/Adams CARRIED

PROGRESS AGAINST AUDIT NZ RECOMMENDATIONS FEBRUARY 2018 (2345413) PROGRESS MATTERS RAISED AUDIT NZ IN THE 30 JUNE 2017 - APPENDIX A (2345463

The Finance Manager presented a report which showed the progress against matters raised by Audit NZ as a result of the 2016-17 audit process.

The members were advised that staff continue to work towards clearing the outstanding items. There are some items which are dependent on resourcing, specifically project management and contract management.

RESOLVED

THAT the report be received.

ARC18/07 Bennett/Milner CARRIED

3 Audit & Risk Committee Minutes 21-02-18 Doc Ref: 2352559 Council Agenda - 28-03-18 Page 21

RISK REPORT TO AUDIT AND RISK COMMITTEE (2345419) RISK REPORT TO AUDIT AND RISK COMMITTEE FEBRUARY 2018- APPENDIX A (2345416)

The Chief Executive presented the risk report to February 2018.

Staff were asked to report back on the cyber security and business continuity risks to Council.

RESOLVED

THAT the report be received.

ARC18/08 Bennett/Tregidga CARRIED

HEALTH SAFETY AUDIT AND RISK COMMITTEE REPORT FEB 2018 (231884)

The HR Advisor/Health and Safety and Health and Safety Officer were in attendance and updated the Committee on the implementation of the following key matters:

y Update on stress and fatigue experienced by staff due to Hauraki House renovations which was compounded by severe weather events. Health and safety team provided extra assistance to staff during this time to help alleviate stress levels. y Update on the implementation of the ‘Health and Safety at Work - Action Plan’. y Launch of staff Health and Safety Culture Survey. y Upgrade of Vault (Council’s health and safety incident reporting system).

Included in the report were some new statistics which health and safety staff will continue to present for comparative purposes in future report to the Audit and Risk Committee meetings. The table explained the statistics which are commonly used in health and safety forums.

RESOLVED

THAT the report be received.

ARC18/09 Bennett/Smeaton CARRIED

4 Audit & Risk Committee Minutes 21-02-18 Doc Ref: 2352559 Council Agenda - 28-03-18 Page 22

Matters to be taken with the Public Excluded

THAT the public be excluded from the following parts of the proceedings of this meeting.

The general subject of each matter to be considered while the public is excluded, the reason for passing this resolution in relation to each matter and the specific grounds under section 48(1) of the Local Government Official Information and Meetings Act 1987 for the passing of this resolution are as follows:

Item General subject of each Reason for passing this Ground(s) Under Section No. matter to be considered resolution in relation to each 48(1) for the Passing of this matter Resolution

1 KPMG Internal Audit Section 7(2)(f)(i) – Maintain the Section 48(1)(a) That the Reviews - Progress effective conduct of public public conduct of the relevant Report affairs through: part of the proceedings of the meeting would be likely to (i) The free and frank expression result in the disclosure of of opinions by or between or to information for which good members or officers or reason for withholding would employees of any local exist. authority, or any persons to whom section 2(5) of this Act applies, in the course of their duty.

2 Rates in Arrears - Section 7(2)(a) – Protect the Section 48(1)(a) That the January 2018 privacy of natural persons, public conduct of the relevant including that of deceased part of the proceedings of the natural persons. meeting would be likely to result in the disclosure of information for which good reason for withholding would exist.

3 Rates Arrears: Subject Section 7(2)(a) – Protect the Section 48(1)(a) That the Property - January 2018 privacy of natural persons, public conduct of the relevant including that of deceased part of the proceedings of the natural persons. meeting would be likely to result in the disclosure of information for which good reason for withholding would exist.

ARC18/10 Leonard/Milner CARRIED

5 Audit & Risk Committee Minutes 21-02-18 Doc Ref: 2352559 Council Agenda - 28-03-18 Page 25

RESOLVED

THAT the public be re-admitted to the meeting and that the business in committee discussed be confirmed.

C18/14 Adams/Tregidga CARRIED

AUDIT & RISK 2018 WORK PROGRAMME (2345457)

The Finance Manager took the Committee through the 2018 work programme.

RESOLVED

THAT the report be received.

ARC18/15 Bennett/Adams CARRIED

The Chair requested that cyber risk and business continuity be added to the programme as discussed earlier in the meeting.

The meeting closed at 11.40am.

CONFIRMED

P R Bennett Chairperson

10 April 2018

8 Audit & Risk Committee Minutes 21-02-18 Doc Ref: 2352559 Council Agenda - 28-03-18 Page 26

Decision Report

To: Mayor and Councillors

From: Group Manager Corporate Services

Date: Wednesday, 21 March 2018

File reference: Document: 2358295

Portfolio holder: Mayor

Meeting date: Wednesday, 28 March 2018

Subject: 2018-28 Draft Consultation Document Ratification

Recommendation:

THAT the report be received, and

THAT the Council ratifies the revisions made to page 8 of the Consultation Document ‘We need to talk – Me kōrero ngātahi tātou’, and

THAT the Council ratifies the revisions made to page 4c-4 of the Our Services: Land transport supporting document.

Purpose

The purpose of the report is to present to Council for ratification, some contextual changes made to the roading options page of the Consultation Document ‘We need to talk – Me kōrero ngātahi tātou’ and Our Services: Land Transport supporting document.

The matter or suggested decision does not involve a new activity, service, programme, project, expenditure or other deliverable.

Background

Council adopted its Consultation Document at its meeting on 14 March.

Subsequent to this meeting, staff discovered that the text on page 8 of the Consultation Document relating to two of the options for the roading key issue could benefit from some extra clarification.

The recommended process to action this is for Council to ratify the revisions.

The revisions to be ratified are:

Previous Presentation Revised Presentation Option 2

Page 1 of 3

Council Agenda - 28-03-18 Page 27

‘Cost’ column wording “This Wording was in the ‘Cost’ Wording moved to the “Our option would require $40.5 column Options” column million in capital spend over ten years” ‘Cost’ column wording “Our Our operating budget for Our operating budget for Operating Budget …” reseals and rebuilds would be reseals and rebuilds would $2 million every year. increase by $625,000 every year. ‘Impact on Rates’ column This would be an average rate This would be an average rate wording (non-water) increase of 9.4% (non-water) increase of 1.4% in 2018/19. in 2018/19. That’s an increase of $211 a That’s an increase of $33 a year for every rateable unit year for every rateable unit across the district from across the district from 2018/19. 2018/19. ‘Impact on Debt’ column We would need to borrow an We would need to borrow an wording extra $40.5 million. extra $6.25 million.

Option 2 ‘Cost’ column wording “This Wording was in the ‘Cost’ Wording moved to the “Our option would require $46 column Options” column million in capital spend over ten years” ‘Cost’ column wording “Our Our operating budget for Our operating budget for Operating Budget …” reseals and rebuilds would be reseals and rebuilds would $2.3 million every year. increase by $1,175,000 every year. ‘Impact on Rates’ column This would be an average rate This would be an average rate wording (non-water) increase of 10.6% (non-water) increase of 2.7% in 2018/19. in 2018/19. That’s an increase of $240 a That’s an increase of $61 a year for every rateable unit year for every rateable unit across the district from across the district from 2018/19. 2018/19. ‘Impact on Debt’ column We would need to borrow an We would need to borrow an wording extra $46 million. extra $11.75 million.

This same text is also included on page 4c-4 of the Our Services: Land transport supporting document, and the same revisions are proposed for this page.

Other than these changes to the roading options, no other changes are proposed. The overall forecast rates and debt, and other financial information in the Consultation Document and supporting documents are not affected. Nor are any other options affected. Overall, all the information disclosed in the Consultation Document and Our Services: Land Transport supporting document, as previously adopted, is correct.

An updated copy of the Consultation Document and Our Services: Land Transport supporting document will be circulated prior to the meeting.

Significance and Engagement Assessment

This decision does not trigger the Significance and Engagement Policy Assessment Tool and therefore is not considered significant under the Significance and Engagement Policy 2014.

Page 2 of 3

Council Agenda - 28-03-18 Page 28

Recommendation

The Council should make its decision on which option to choose based on that option being the most cost effective, and good quality option for the Hauraki District (section 10 of the Local Government Act 2002).

Staff are seeking the Council’s ratification of the revisions to the Consultation Document and Our Services: Land Transport supporting document.

Duncan Peddie GROUP MANAGER CORPORATE SERVICES

Page 3 of 3

Council Agenda - 28-03-18 Page 29

Decision Report

To: Mayor and Councillors

From: Group Manager - Community Services & Development

Date: Tuesday, 20 March 2018 Document: 2357687 File reference: Appendix A:

Portfolio holder: All Councillors

Meeting date: Wednesday, 28 March 2018 Review of Delegations: Community Services & Development Subject: Committee

Recommendation:

THAT the report be received, and

THAT the changes to the delegations of the Community Services and Development Committee be adopted to include Council property, and

THAT the Committee can receive and make decisions on any other item of business that requires a decision outside of the monthly Council meeting schedule, unless retained by Council or delegated elsewhere by Council.

Purpose

To update the elected members on the proposed changes to the delegations of the Community Services and Development Committee and adoption of these changes.

The matter or suggested decision does not involve a new activity, service, programme, project, expenditure or other deliverable.

Background

Following the Local Government elections in 2016, Council adopted its Committee structure. Each of the committees of Council formed was given delegation to undertake consideration of specific areas of Council business. See attached as Appendix A current delegation of Community Services and Development Committee and proposed changes highlighted in red.

In conjunction with the Mayor, a review has now been undertaken to evaluate where items of Council business should be considered. It has been proposed that all matters concerning Council owned property now be considered by the Community Services and Development Committee.

Page 1 of 4

Council Agenda - 28-03-18 Page 30

It is also proposed that, unless retained by Council or delegated elsewhere by Council, the Committee can receive and make decisions on any other item of business that requires a decision outside of the monthly Council meeting schedule.

Budget Implications

There are no budget implications relating to this matter.

Recommendation

That the changes proposed to the delegations of the Community Services and Development Committee and Council be adopted.

Steve Fabish Group Manager - Community Services and Development

Page 2 of 4

Council Agenda - 28-03-18 Page 31

Appendix A

Community Services and Development Committee

Membership Deputy Mayor (Chair) and all Hauraki District Council Councillors

Meeting frequency The third to last Wednesday of each month commencing at 9.00am

Delegations: The Council delegates to the Community Services and Development Committee the following powers, duties and responsibilities:

„ Unless retained by Council or delegated elsewhere by Council, the power to consider and decide on all operational, project and policy matters relating to the following activities of Council:

Community Services Activities;

Community Recreation ƒ Libraries ƒ Swimming Pools ƒ Waihi Events Centre ƒ Sports Fields and Recreation Reserves ƒ District Sports Coordinator

Community Facilities ƒ Halls ƒ Pensioner Housing ƒ Public Toilets ƒ Cemeteries ƒ Non-Recreation Reserves

Community Growth ƒ Economic Development ƒ Visitor Information Centres ƒ Town Promotion ƒ Hauraki Rail Trail ƒ Destination Coromandel ƒ Development Assistance/Grants

Community Development ƒ Community Initiatives ƒ Social Initiatives ƒ Sister Cities ƒ Grants, Donations and Awards ƒ Other Initiatives

Council Property ƒ Corporate Buildings ƒ Service Centres ƒ Depots ƒ Miscellaneous Buildings ƒ Council Land, other than formed road reserve ƒ Forestry ƒ Land for development ƒ Leases and Licences Page 3 of 4

Council Agenda - 28-03-18 Page 32

ƒ Unless retained by Council or delegated elsewhere by Council, the Committee can receive and make decisions on any other item of business that requires a decision outside of the monthly Council meeting schedule.

„ In considering decisions on matters as delegated above the Committee shall have the power to depart from Council’s procurement and purchasing policies and the procedures where it is satisfied such a departure will result in works or services that meet the purpose of Local Government in clause 10 1 (b) of the LGA:

To meet the current and future needs of communities for good-quality local infrastructure, local public services, and performance of regulatory functions in a way that is most cost-effective for households and businesses.

Page 4 of 4

Council Agenda - 28-03-18 Page 33

Decision Report

To: Mayor and Councillors

From: Transportation Manager

Date: Tuesday, 20 March 2018

File reference: Document: 2358384

Portfolio holder: Councillor Adams

Meeting date: Wednesday, 28 March 2018 Request to provide approval to the Waikato Regional Subject: Council to construct an access bridge at Maukoro Landing Road.

Recommendation:

THAT the report be received, and

THAT approval be given to the Waikato Regional Council to construct a new bridge, in accordance with district planning rules, across Pouruiri Stream from Maukoro Landing Road to Regional Council owned land adjacent the Piako River; and,

THAT the Council notes that the construction and ongoing maintenance of the bridge will be borne by the Waikato Regional Council.

Purpose

The purpose of this report is to obtain approval to allow the Waikato Regional Council to construct a small bridge from the paper road section of Maukoro Landing Road to Regional Council owned land adjacent the Piako River. The Regional Council wishes to improve access to the existing flood defence assets which become inaccessible during flood events.

The matter or suggested decision does not involve a new activity, service, programme, project, expenditure or other deliverable.

Background

Maukoro Landing Road is under Hauraki District Council control as the local roading authority. The Hauraki District Council maintains the initial 800 metres of formed road that provides access to rural property at 2067 State Highway 27 and 0 Maukoro Landing Road. The remaining kilometre of paper road that terminates at the Piako River, is maintained by the Waikato Regional Council.

Significant storm events in April 2017 identified the need to improve access to the Piako River flood defences including the Drent’s pump station. Two ex-tropical cyclones and a low pressure system, (Ex-Tropical Cyclone Debbie, Tasman low, and Ex-Tropical Cyclone Cook) made landfall in New Zealand on 4 April, 11 April, and 13 April respectively.

Page 1 of 3

Council Agenda - 28-03-18 Page 34

The three weather events caused disruption and damage to property and infrastructure across the Waikato Region. The Hauraki Plains and Lower Waikato were the worst affected with several dwellings flooded as well as widespread flooding and road closures.

Emergency ponding areas in the Piako scheme operated as the events were over the 5-10% AEP design standards for spilling into these ponding zones. In general, the flood protection schemes performed to the levels expected. Some issues did arise as a result of the cumulative effects of the successive events.

The Drent’s pump station was inaccessible by vehicles during these flood events and required Regional Council operations staff to visit site on numerous occasions via boat to operate and inspect the pump station. Access via boat during significant storms places operations staff at greater risk and may have resulted in less than optimal operation of the pump station. Improved access to Dent’s pump station is required to address current operations and maintenance access issues, and facilitate future stopbank upgrade works.

Discussion

The Waikato Regional Council propose to build a small access bridge across Pouruiri Stream to Regional Council owned land for the purpose of flood defence. A portion of the proposed bridge is required to be built within the paper road section of Maukoro Landing Road. Approval must be obtained from the Hauraki District Council to allow the Regional Council to build the proposed access bridge.

The proposed bridge meets the requirements of both the district and regional plan permitted activity rules, principally the bridge:

x Is for drainage and river control work purposes x Will be constructed in rural zoned land x Span will be less than 10 metres x Soffit will be 0.5m above the 50 year ARI flood event x A Class B entrance is required

The Waikato Regional Council will fund the construction and ongoing maintenance of the bridge with no financial impact on the Hauraki District Council.

Options discussion

Option 1 Decline approval – this option will maintain the current situation of restricted access to flood defences during flood events. This may result in flood defences being operated at sub optimal performance resulting in increased flood impacts to neighbouring properties during flood events. Remedying damage to flood defences will be restricted to post flood events. The Regional Council may also be required to appeal the decision to ensure operational staff are afforded adequate health and safety standards.

Option 2 Approve bridge proposal – this option will improve access to existing flood defence assets. The proposed bridge will be constructed within a section of paper road maintained by the Regional Council and will have minimal impact on the community or district roading assets.

Conclusion We recommend Option 2 to provide approval for the Waikato Regional Council to construct the new access bridge across Pouruiri Stream.

Page 2 of 3

Council Agenda - 28-03-18 Page 35

Significance and Engagement Assessment

This decision does not trigger the Significance and Engagement Policy Assessment Tool and therefore is not considered significant under the Significance and Engagement Policy 2014.

Budget Implications

There is no budget impact on the Hauraki District Council.

Recommendation

Council should make its decision on which option to choose based on that option being the most cost effective, and good quality option for the Hauraki District (s10 of the Local Government Act 2002).

The following recommendations are made:

1. THAT approval be given to the Waikato Regional Council to construct the proposed new access bridge across Pouruiri Stream that meets the requirements of the district and regional plans. 2. THAT the Council notes that the construction and ongoing maintenance of the bridge will be borne by the Waikato Regional Council.

Gene Thomsen Transportation Manager

Page 3 of 3

Council Agenda - 28-03-18 Page 36

Decision Report

To: Mayor and Councillors

From: Transport Manager

Date: Wednesday, 14 March 2018 Report: M2356399 File reference: Appendix A: M2356633 Portfolio holder: Councillor Adams

Meeting date: Wednesday, 28 March 2018

Subject: 65 Kent Crescent Waihi Legal Boundary Encroachment

Recommendation:

THAT the report be received, and

THAT the Council approve the proposal to close 270m2 of Kent Road under s116 of the Public Works Act 1981; and

THAT the Council approve the sale of the closed road area (270m2 shown in Appendix A) to the owner of 65 Kent Crescent under s117 of the Public Works Act 1981 in order to regularise the existing road encroachments.

Purpose

This report seeks Council approval to close 270m2 of the road frontage at 65 Kent Crescent (Ref Appendix 1). The estimated land value is $9,000, other estimated costs for Survey and Legal fees for this work are in the order $10,000 The closed road area will regularise the various encroachments in the legal road corridor at this location. The public road area identified will be stopped under section 116 the Public Works Act 1981 (PWA).

Background

Kent Crescent is a local road with an estimated traffic volume of 30 vpd, is sealed with mountable kerb and channel on both sides and a road width varying between 5.5m and 6m. Kent Crescent environment is rural residential and the property owner advised that there is regular use of this road by pedestrians and cyclists. The speed environment is estimated to be low (estimated 35 -45 km/hr) due to the narrow road width, slightly curved alignment and proximity to side road intersections.

The property has two formed entranceways, one is a double entranceway serving both the separate double garage and the dwelling’s old garage (proposed new mudroom) and the second entranceway provides access to the house basement.

The house is located approximately 8m from the pavement edge with the house eaves, existing low concrete retaining walls and established gardens partly within the road reserve.

Page 1 of 3

Council Agenda - 28-03-18 Page 37

In summary the issues that exist at this property were identified and notified to the property owner in September 2014 and remain unchanged. These are listed below:

x Existing structures within the legal road x Use of the legal road berm for parking and vehicle movement x Allowing private structures to remain in the legal road.

The solution proposed at that time was for the landowner to purchase an appropriate portion of the legal road and regularise the infringement. This solution requires approximately 270m2 of road reserve to be closed and the ownership procured by the owner of 65 Kent Road.

Options

There are 2 options to resolve the situation. These are:

1. That the property owner removes and makes good all encroachments that are within the legal Road Corridor at their cost within a timeframe acceptable to Hauraki District Council.

2. That the area (270m2) of legal road that is occupied or affected by the actions or fixtures owned used by the owner of 65 Kent Crescent be stopped under section 116 PWA and then sold to the owner under s117 PWA to regularise the encroachment.

Option 1 is not considered an appropriate response. Following discussions with the property owner an agreement has been reached to proceed with Option 2 as set out above. The estimated costs will be refined in the immediate future.

Option 2 will remedy the situation appropriately, and will not have a negative effect on the road network.

Budget Implications.

There are not any budget implications for this proposal as the actions and costs are the responsibility of the owner of 65 Kent Crescent Waihi.

Conclusion Recommendation.

Council should make its decision on which option to choose based on that option being the most cost effective, and good quality option for the Hauraki District (s10 of the Local Government Act 2002).

The following recommendations are made:

1. THAT the Council approve the proposal to close 270m2 of Kent Road under s116 of the Public Works Act 1981; and

2. THAT the Council approve the sale of the closed road area (270m2 shown in Appendix A) to the owner of 65 Kent Crescent under s117 of the Public Works Act 1981 in order to regularise the existing road encroachments.

Gene Thomsen Transport Manager

Page 2 of 3

Council Agenda - 28-03-18 Page 38

Appendix A

Layout drawing (M2356633)

Page 3 of 3

Council Agenda - 28-03-18 Page 39 Council Agenda - 28-03-18 Page 40



 'HFLVLRQ5HSRUW  7R 0D\RUDQG&RXQFLOORUV

)URP 7UDQVSRUW0DQDJHU

'DWH )ULGD\0DUFK 'RFXPHQW  )LOHUHIHUHQFH $SSHQGL[$ &RXQFLO5HVROXWLRQ& & 3RUWIROLRKROGHU &RXQFLOORU$GDPV

0HHWLQJGDWH :HGQHVGD\0DUFK

6XEMHFW /('6WUHHWOLJKW5HQHZDOV&RQWUDFW$ZDUG    5HFRPPHQGDWLRQ  7+$7WKHUHSRUWEHUHFHLYHGDQG  7+$7 WKH &RXQFLO DSSURYHV WKH DSSRLQWPHQW RI 0F.D\ (OHFWULFDO /WG IRU &21 /(' 5HQHZDODWDFRVWRIH[FOXGLQJ*67DQG  7+$7WKH&RXQFLODSSURYHVDFRQWLQJHQF\DPRXQWIRUWKLVFRQVWUXFWLRQSURMHFWRI H[FOXGLQJ*67    3XUSRVH  7KH&RXQFLOKDVSUHYLRXVO\UHVROYHG VHH$SSHQGL[$ WRDFFHOHUDWHWKLVSURMHFWWRDFKLHYHJUHDWHU ILQDQFLDODVVLVWDQFHIURP1=7$IRUWKHFXUUHQWILQDQFLDO\HDU  7KLVUHSRUWLVWRVHHNDSSURYDOWRDZDUGWKHFRQWUDFWDVXLWDEOHFRQWLQJHQF\DPRXQWDQGWKHFRVWRI SURMHFWPDQDJHPHQWDVSHU&RXQFLOSXUFKDVLQJSROLF\  7KH PDWWHU RU VXJJHVWHG GHFLVLRQ GRHV QRW LQYROYH D QHZ DFWLYLW\ VHUYLFH SURJUDPPH SURMHFW H[SHQGLWXUHRURWKHUGHOLYHUDEOH   %DFNJURXQG  7KH/('VWUHHWOLJKWUHQHZDOSURJUDPPHKDVEHHQSURJUHVVLYHO\UROOHGRXW7KLVSURJUDPPHLVWKH VXSSO\DQGLQVWDOODWLRQRI/('HTXLYDOHQWVLQH[LVWLQJVWUHHWOLJKWORFDWLRQV  7KHWHQGHUHGZRUNVDUHIRUWKHFRPSOHWLRQRIWKHPDMRULW\RIWKHSFDWHJRU\URDGVZLWKLQWKHUHJLRQ ZKLFKLVOXPLQDULHV7KLVGRHVQRWDFFRXQWIRUDUFKLWHFWXUDOILWWLQJVRUKLJKHUXVHYFDWHJRU\ URDGVDVWKH\UHTXLUHVSHFLILFOLJKWW\SHVDQGGHVLJQ 

3DJHRI  Council Agenda - 28-03-18 Page 41



$GGLWLRQDOILQDQFLDODVVLVWDQFHLVFXUUHQWO\RQRIIHUIURP1=7$ZKLFKZLOOVHHDJUHDWHUVDYLQJIRU &RXQFLOLIWKH/('UHQHZDOVDUHFRPSOHWHGWKLVILQDQFLDO\HDU$EXVLQHVVFDVHZDVFRPSOHWHGIRU 1=7$WRVHFXUHWKHDGGLWLRQDOIXQGLQJDQGDSSURYHGE\WKHPLQ-DQXDU\   ,VVXHVDQGRSWLRQV  7HQGHU(YDOXDWLRQ 7KH WHQGHU SURFHVV ZDV IRUPDOO\ QRWLILHG XVLQJ7HQGHUOLQN DQG &RXQFLOUHFHLYHGWZR FRQIRUPLQJ WHQGHUV WKUHHSRVVLEOHRSWLRQVDVRQHWHQGHUHUVXEPLWWHGWZR/('OXPLQDU\RSWLRQV 7KHWHQGHUV ZHUHHYDOXDWHGE\DQHYDOXDWLRQWHDPWKDWZDVOHGE\3LQQDFOHV&LYLODQGLQFOXGHGWHFKQLFDOLQSXW IURP36/ 3RZHU6ROXWLRQV/WG 7KHWHQGHUZDVHYDOXDWHGXVLQJWKHORZHVWSULFHFRQIRUPLQJWHQGHU 7KHWHQGHUHYDOXDWLRQSURFHVVIROORZHGWKHJXLGHOLQHVDVUHTXLUHGE\1=7$  7HQGHUVZHUHUHFHLYHGIURP DQGLQQRSDUWLFXODURUGHU   0F.D\±2SWLRQ 0F.D\±2SWLRQ 'RZQHU,76  7KH\ZHUHHYDOXDWHGIRUSULFHILUVWDQGWKHQDWWULEXWHV7KHWHQGHUHGSULFHVIRUWKHFRQVWUXFWLRQFRVW RIWKLVSURMHFWZHUHLQWKHUDQJHWRH[FOXGLQJ*67  (VWLPDWH&RVWV 7KHRULJLQDOHQJLQHHU¶VHVWLPDWHIRUWKHVHIXWXUHXSJUDGHVZDVHVWLPDWHGDW*67 0DJL4 WKLVKDVEHHQSUHYLRXVO\VXEPLWWHGWR&RXQFLOLQDQGLQIRUPHGUHVROXWLRQV & &  )XUWKHUWRWKLVWKH1=7$EXVLQHVVFDVHIRUWKLVSKDVHRIWKH/('UHQHZDOVLQFOXGHGDQHVWLPDWHRI WKHFRVWRIWKHVXSSO\DQGLQVWDOODWLRQRIWKHOXPLQDULHV±WKLVZDV*67  7KH WHQGHUHG UDWHV FRPSDUH IDYRXUDEO\ ZLWK WKHVH HVWLPDWHV ZKHQ FRQWLQJHQFLHV DQG SURMHFW PDQDJHPHQW FRQWUDFWDGPLQLVWUDWLRQHQJLQHHUWRFRQWUDFWDQGVLWHVXSHUYLVLRQ DUHLQFOXGHG±ZLWK DWRWDOFRVWRI*67  /('$OWHUQDWLYH $Q/('W\SHZDVSURYLGHGLQWKHWHQGHUDVDQLQGLFDWLRQRIWKHH[SHFWHGVXEVWLWXWHIRUWKHH[LVWLQJ VWUHHWOLJKWV7KHWHQGHUGRFXPHQWDOVRDOORZHGIRUDOWHUQDWLYHVWRWKLV/('W\SH  :HUHFHLYHGRQHWHQGHUZKLFKSURYLGHGDQDOWHUQDWLYH/('W\SHWKDQWKDWLQGLFDWHG7KLV/('PHHWV WKHWHQGHUUHTXLUHPHQWVIRUFRQVLGHUDWLRQZKLFKLV³WKDWLWPXVWEHDSSURYHGE\$XFNODQG7UDQVSRUW RURQWKH1=7$0OLVW´ W\SLFDOPHDVXUHVRI/('VXLWDELOLW\   7KLV/('W\SHLVDSURGXFWZKLFKZHDUHQRWIDPLOLDUZLWK7KHFRQVXOWLQJHQJLQHHUHQJLQHHUWR FRQWUDFW 36/ IRUWKHFRQVWUXFWLRQSKDVHRIWKLVSURMHFWKDVDOVRKDVQRGLUHFWH[SHULHQFHZLWKWKLV /('IURPDQLQVWDOODWLRQRUPDLQWHQDQFHSHUVSHFWLYH  7KH FRQWUDFWRU ZKR SURSRVHG WKLV /(' W\SH KDV VRPH H[SHULHQFH ZLWK LW DQG WKH\ VWDWH WKDW LW FRPSDUHVWHFKQLFDOO\ZLWKWKH/('W\SHLQGLFDWHGLQWKHWHQGHU7KH\GRFRQFHGHWKDWWKHUHLVOLWWOH GLIIHUHQFH EHWZHHQ WKHPIURP D WHFKQLFDO SHUVSHFWLYH DQG WKDWWKH /(' LQGLFDWHG LQ WKH RULJLQDO WHQGHUKDVDYHU\JRRGWUDFNUHFRUGDQGWKH\KDYHKDGQRLVVXHVDQGQRWHFKQLFDOIDLOXUHV  7KHULVNRIVHOHFWLQJWKHDOWHUQDWLYH/('LVJUHDWHUWKDQWKHUHODWLYHO\VPDOOGLIIHUHQFHLQFRVWEHWZHHQ WKHWZRRSWLRQVRIDSSUR[LPDWHO\7KLVLVZK\WKHUHFRPPHQGDWLRQLVIRUWKHDZDUGRI WKHORZHVWSULFHWHQGHUSOXVDQDOORZDQFHWRFKDQJHWRWKH/('W\SHRULJLQDOO\LQGLFDWHGLQWKHWHQGHU GRFXPHQW 

3DJHRI  Council Agenda - 28-03-18 Page 42



&RQVWUXFWLRQ7LPHOLQH $WSUHVHQWWKHDGGLWLRQDOIXQGLQJIURP1=7$IRUWKLVSURMHFWHTXDWHVWRDIXUWKHURQWRSRIWKH XVXDOVXEVLG\  $OOWHQGHUHUVZHUHUHTXHVWHGWRVXSSO\WLPHOLQHVWKDWPD[LPLVHGWKHTXDQWLW\RI/('OLJKWVLQVWDOOHG EHIRUHWKH1=7$HQGRIILQDQFLDO\HDUFXWRII,WLVH[SHFWHG DOWKRXJKQRWFRQILUPHG WKDW1=7$ZLOO UROOIXQGLQJIRUFRPPLWWHGFRQWUDFWVLQWRWKHILQDQFLDO\HDU  ,WLVLPSRUWDQWWRQRWHWKDWLIWKH\GRQRWUROOIXQGLQJWKHQWKHSXUFKDVHRIWKH/('OLJKWVZLOOFRQWLQXH KRZHYHUWKHUHPDLQGHURIWKHLQVWDOODWLRQPD\QHHGWREHVWDJHG  2WKHU,VVXHV 7KHSUHIHUUHGWHQGHUHUKDGVRPHLWHPVZLWKLQWKHLUWHQGHU LGHQWLILHGDVFODULILFDWLRQSRLQWVWKHVH ZHUHODUJHO\DGPLQLVWUDWLYH8SRQUHTXHVWWKHWHQGHUHUKDVUHPRYHGWKHP RUFODULILHGWKHP VRWKDW WKHLUVXEPLVVLRQDOLJQVZLWKWKHFRQWUDFWGRFXPHQWFRQGLWLRQV   6LJQLILFDQFHDQG(QJDJHPHQW$VVHVVPHQW  7KLV GHFLVLRQ GRHV QRW WULJJHU WKH 6LJQLILFDQFH DQG (QJDJHPHQW 3ROLF\ $VVHVVPHQW 7RRO DQG WKHUHIRUHLVQRWFRQVLGHUHGVLJQLILFDQWXQGHUWKH6LJQLILFDQFHDQG(QJDJHPHQW3ROLF\  7KHOHYHORIHQJDJHPHQWFRQVLGHUHGDSSURSULDWHIRUWKLVPDWWHUDWWKLVSRLQWLQWLPHLVWRLQIRUP LH RQHZD\FRPPXQLFDWLRQGLVVHPLQDWLQJLQIRUPDWLRQ WKHSXEOLFRIZRUNVXSFRPLQJ  %XGJHW,PSOLFDWLRQV  3UHYLRXV UHSRUWV WR WKH &RXQFLO KDYH SURYLGHG JXLGDQFH RQ WKH EXGJHW FRVW IRU WKLV ZRUNV 7KH H[SHFWHGFRVWVWRFRPSOHWHWKHGHOLYHU\RIWKHVH/('OXPLQDULHVLVVXPPDULVHGKHUH   WŚLJƐŝĐĂůtŽƌŬƐŽƐƚ  Ψϱϯϳ͕Ϯϯϵ͘ϲϰ ŽŶƚŝŶŐĞŶĐLJ  ΨϱϬ͕ϬϬϬ͘ϬϬ     WƌŽũĞĐƚDĂŶĂŐĞŵĞŶƚ;ĞƐƚͿ Ψϯϱ͕ϬϬϬ͘ϬϬ dŽƚĂůŽƐƚ  ΨϲϮϮ͕Ϯϯϵ͘ϲϰ     ůĞƐƐ&ZϴϱйͲEd  ;ΨϱϮϴ͕ϵϬϯ͘ϲϵͿ     dŽƚĂůĞdžƉĞĐƚĞĚĐŽƐƚƚŽŽƵŶĐŝů Ψϵϯ͕ϯϯϱ͘ϵϱ  7KLVLVZLWKLQSUHYLRXVO\FRPPXQLFDWHGEXGJHWV   

3DJHRI  Council Agenda - 28-03-18 Page 43



5HFRPPHQGDWLRQ  7KH&RXQFLOVKRXOGPDNHLWVGHFLVLRQRQZKLFKRSWLRQWRFKRRVHEDVHGRQWKDWRSWLRQEHLQJWKHPRVW FRVWHIIHFWLYHDQGJRRGTXDOLW\RSWLRQIRUWKH+DXUDNL'LVWULFW VRIWKH/RFDO*RYHUQPHQW$FW    7KHIROORZLQJUHFRPPHQGDWLRQVDUHPDGH  7+$7WKH&RXQFLODSSURYHVWKHDSSRLQWPHQWRI0F.D\(OHFWULFDO/WGIRU&21/(' 5HQHZDODWDFRVWRIH[FOXGLQJ*67DQG  7+$7 WKH &RXQFLO DSSURYHV D FRQWLQJHQF\ IRU WKLV FRQVWUXFWLRQ SURMHFW RI   H[FOXGLQJ*67       *HQH7KRPVHQ 7UDQVSRUW0DQDJHU

3DJHRI  Council Agenda - 28-03-18 Page 44



$SSHQGL[$±&RXQFLO5HVROXWLRQ  /('675((7/,*+7,1*)81',1*5(3257 )  7KH7UDQVSRUWDWLRQ0DQDJHUSUHVHQWHGDUHSRUWZKLFKSURYLGHGWKHEDFNJURXQGWRWKHRSSRUWXQLW\ IRUDFFHOHUDWLQJWKHLQVWDOODWLRQRIQHZKLJKHIILFLHQF\/('VWUHHWOLJKWLQJZLWKLQWKH+DXUDNLGLVWULFW QHWZRUN  5(62/9('  7+$7WKHUHSRUWEHUHFHLYHG  & 7KRUS6PHDWRQ &$55,('  1=7$KDYHUHFHQWO\DQQRXQFHGWKHDSSURYDORIDQLQFUHDVHG)LQDQFLDO$VVLVWDQFH5DWH )$5 RI IRUWKLVSXUSRVH7KLVRSSRUWXQLW\KDVDOLPLWHGWLPHIUDPHIRUDFFHSWDQFHDORQJZLWKHQVXULQJ WKHLQVWDOODWLRQLVFRPSOHWHGE\WKHHQGRI-XQH$SSURYDOZDVVRXJKWWKDWWKHRIIHUIURP1=7$ EHDFFHSWHGIRUWKHUHSODFHPHQWRIFRQYHQWLRQDOVWUHHWOLJKWVWR/(' 5(62/9('  7+$7WKH1=7$RIIHURIDQLQFUHDVHG)$5EHDFFHSWHGDQG  7+$7WKHUHSODFHPHQWRIFRQYHQWLRQDOVWUHHWOLJKWVZLWKKLJKHQHUJ\HIILFLHQW/('VWUHHWOLJKWVEH DSSURYHGDQGEHFRYHUHGE\H[LVWLQJEXGJHWVDQG  7+$7IRUH[SHGLHQF\YDULDWLRQVWRWKHVFRSHRIZRUNWKDWGRQRWYDU\WKHDSSURYHGEXGJHWVEH HYDOXDWHGDQGDSSURYHGE\WKH*URXS0DQDJHU(QJLQHHULQJ6HUYLFHV  & 0LOQHU5DWWUD\ &$55,('   

3DJHRI  Council Agenda - 28-03-18 Page 45

Decision Report

To: The Mayor and Councillors

From: Infrastructure Systems and Planning Manager

Date: Tuesday, 28 March 2017

File reference: Document: 2356834

Portfolio holder: Clr James Thorp

Meeting date: Wednesday, 26 April 2017

Subject: Revocation of Resolution C17/171

Recommendation:

THAT the report be received, and

THAT the Council rescinds Council Resolution No. C17/171: Extension to the Taramaire Drainage District, Kaiaua, 26 April 2017.

Purpose

This report requests Council to rescind Resolution No. C17/171 - Extension to the Taramaire Drainage District, Kaiau, 26 April 2017.

This resolution sought to include the owners of the property immediately to the north (McPherson Farms Ltd) into the Taramaire Drainage District (TDD).

Background

A paper (#M2193237) was taken to Council on 26 April 2017 with the following request:

Extension to the Taramaire Drainage District, Kaiaua

Background: The Taramaire Drainage District is located in the Kaiaua area, between East Coast Road and the hill country to the west. The southern boundary is at the Shorebird Trust Centre and the northern boundary about 2.7km north towards Kaiaua village. It comprises 720ha, of which approximately half is rated for drainage and a lesser area for flood protection.

The assets comprise 5.3km of stopbanks and 15 floodgates centred on the Taramaire Stream, and 6.3km of drains. There are 14 properties rated for services.

Page 1 of 4

Council Agenda - 28-03-18 Page 46

Proposal A petition has been received from the owners of the property immediately to the north (McPherson Farms Ltd) to apply to join the Taramaire Drainage District. This extension to a drainage district is provided for in the Land Drainage Act 1908.

There has been a history of concern from McPhersons regarding the inflow of water from the drainage district which discharges to the sea on the boundary of the two properties either side of the current northern extent of the drainage district, plus the claim that water from uphill which flows through both properties, but mostly in McPherson’s, should be dealt with within the drainage district.

The Chair of the Taramaire committee has indicated there would be no objection to extending the district to include McPherson Farms.

The additional area is 128ha, of which about 47 ha would be subject to the drainage rate. The property currently pays the Kaiaua stormwater rate, which would be stopped as the TDD ratepayers only pay the drainage rate, and flood protection rate if applicable. An extension to the northernmost drain to service the property will be required.

Recommendation It is recommended that Council accept the petition from McPherson Farms, and proceed to take the required steps to incorporate the property into the Taramaire Drainage District.

The minutes (#M2195620) of the meeting reflect that Council accepted it.

RESOLVED

THAT Council accepts the petition from McPherson Farms, and proceed to take the required steps to incorporate the property into the Taramaire Drainage District.

C17/171 Leonard/Buckthought CARRIED

Once the Chairman of the TDD became aware of this, he indicated that he would not have agreed to it. The report only said that he “indicated” that there would be no objection, however, there is no record of this. The TDD committee/members hadn’t been consulted.

On the 24th January 2018 the TDD had a meeting.

The meeting discussed the inclusion of McPherson Farms (the farm on the north boundary of the TDD) into the scheme. After much discussion a vote was taken and was unanimous in deciding against their inclusion. (For 0 Against 7 ) – Minutes of the meeting, Appendix

It is clear, from surveys etc., that the McPherson farm will not benefit in drainage in any way by being part of the drainage district. Their main reason for joining was so that the Council drain would be extended to their property boundary and it would be maintained regularly as their neighbour wasn’t cleaning it. As a result, during storm events, the stormwater runoff from the neighbour’s farm spills onto the McPherson farm causing flooding issues and angst there.

This approach to solving the problem, while imaginative, is the incorrect mechanism to enforce/ensure cleaning the drain. The Land Drainage Act No. 96 of 1908 provides for a situation such as this.

Page 2 of 4

Council Agenda - 28-03-18 Page 47

However, discussion with the farmer in the first instance is always better than brining the law, especially in this case, as the farmer with the offending drain (now partially cleared) is the Chairman of the TDD.

Once this was explained to the McPhersons they were satisfied with it and consequently the revocation of the previous resolution

Thanks very much for email explaining the situation. We are happy with the outcome as we did not want to join the TDD. The whole process sounds like it involved a lot of work and we are grateful to you for all your effort.

Thank you. Regards Peter & Sheryl

Recommendation

It is recommended that the Council rescind Resolution No. C17/171 - Extension to the Taramaire Drainage District, Kaiaua, 26 April 2017.

Steve de Laborde Infrastructure Systems and Planning Manager

Page 3 of 4

Council Agenda - 28-03-18 Page 48

APPENDIX

Taramaire Drainage District

Minutes taken (by Garth Levers) at a meeting held at Bruce Levers (545 East Coast Rd) at 10:00am, January 24th, 2018.

Present: Bruce Levers, Gareth Levers, Steve Barker, Denis Thompson, Cliff Chisholm, Andrew Davis, Matt Davis, Steve Crooymans, John Gasson, Steve de Laborde (Infrastucture Systems & Planning Manager, Hauraki District Council), Don Swales (Councillor, Hauraki District Council). Apologies: Clive Roberts, Hamish Hancock.

The meeting discussed the inclusion of McPherson Farms (the farm on the north boundary of the TDD) into the scheme. After much discussion a vote was taken and was unanimous in deciding against their inclusion. (For 0 Against 7)

A proposal that Stan Archer be paid by the TDD for the digger work he carried out during the recent salt water surge and flooding on Andrew’s place. Proposed: Steve Crooymans, Seconded Steve Barker. (For 7 Against 0)

The meeting discussed: - # The recent salt water flooding and the impact on farmland in the TDD. Cliff noted that a State of Emergency wasn’t declared. # The performance of the current scheme and its stop banks and culverts were discussed. Steve Crooymans and Andrew both noted that the water had taken too long to get off their property. # Discussion of Foreshore protection to try and prevent the occurrence of salt water damage again. # John Gasson suggested a survey of all the land in TDD. Proposed: Bruce Levers, Seconded Andrew Davis. (For 7 Against 0). # Is it possible to combine foreshore protection with the Cycle Trail? # Can the clay being removed from the slips from East Coast Rd between Waharau and Martingarahi be used for possible stopbanks, cycle trail.

Meeting closed at 11:30 am

Page 4 of 4

Council Agenda - 28-03-18 Page 49

Decision Report

To: Mayor and Councillors

From: Group Manager Engineering Services

Date: Wednesday, 21 March 2018

File reference: Document: 2357828 Councillor Daley Portfolio holder: Councillor Thorpe Meeting date: Wednesday, 28 March 2018

Subject: Muggeridge’s Pump

Recommendation:

THAT the report be received, and

THAT Council subdivide LOT 1 DPS 75847 and vest the lot created for the Muggeridge Pump scheme with Waikato Regional Council.

Purpose

The purpose of this report is to update the Council on progress with the Muggeridges Pumpstation and associated works and to seek approval to dispose of the land upon which the infrastructure will be constructed to Waikato Regional Council.

Background

The plan to provide additional pumping to the area to the south of Ngatea has been underway for several decades. The ongoing lowering of the land profile as a result of farming and drainage has meant that the existing system of drains, floodgates and pumps no longer adequately drains this area. To address this, Waikato Regional Council is leading a project to install a pumpstation and associated drainage canal and stopbanks that will be located on the Council farm on Kaihere Road. This farm was originally acquired for this purpose.

Historically it has been agreed that Hauraki District Council will contribute an amount of 5% towards the capital costs of the scheme and provide the land for the scheme to be located on.

Further background is provided in Appendix A.

Issues and options

The project has advanced almost to the construction stage and detailed design is being completed. WRC hope to begin construction of the scheme shortly.

In order to provide the land required by the scheme, HDC is in the process of subdividing LOT 1 DPS 75847 (246 Kaihere Road, Ngatea), purchased for this scheme. The subdivision will provide

Page 1 of 5

Council Agenda - 28-03-18 Page 50

for a lot that will contain the scheme and a balance lot. Appendix B shows a layout of the scheme. The Muggeridge scheme shown on Appendix B will be owned and maintained by the WRC. In order for WRC to have security of ownership etc of their assets and to ensure enduring access, they require ownership of the land. This has been generally agreed through various forums and reports.

The capital value of the land is $1,372,000. The area is 39.8309 hectares. The dimensions of land area required by the scheme is approximately 1,000m x 115 m (final dimensions still to be confirmed). This equates to an area of approximately 11.5 hectares.

Based on the capital value the value of this land is thus approximately $396,000. HDC would also be in a position to sell the balance lot of 28.33 hectares. A valuation of the land is currently underway and will be presented to the Council - if it is available – at the meeting.

The overall project budget is $3.2M and with the contingency $3.5M. 5% of the amounts are $160,000 and $175,000. This is included in current HDC budgets.

Budget Implications

There is no budget or rating implication for the vesting of the land with Waikato Regional Council.

Recommendation

Council should make its decision on which option to choose based on that option being the most cost effective, and good quality option for the Hauraki District (s10 of the Local Government Act 2002).

The following recommendation is made 1. THAT Council subdivide LOT 1 DPS 75847 and vest the lot created for the Muggeridge Pump scheme with Waikato Regional Council.

Adrian de Laborde Group Manager Engineering Services

Page 2 of 5

Council Agenda - 28-03-18 Page 51

Appendix A – Report to Council 26 April 2017 M McLeod

1 Land for WRC Muggeridge Pump outlet canal, 246 Kaihere Road, Ngatea

Background

Some 20 years ago Council bought the property at 246 Kaihere Road as a possible site for the proposed Muggeridge pump station and associated feeder drains and outlet to the Piako River. The property is located approximately 300m south of the existing Muggeridge Drain and floodgate under Kaihere Road. It has an area of 40ha.

At the time the pump was a component of the southern stage of the proposed Pouarua Maukoro drainage scheme, which was initially the responsibility of Council through the Western Plains Drainage Committee.

The northern stage of the scheme was completed by Council in 2001 following demand for pumping in the Hopai Road area. The southern stage was to be constructed later, as ground levels lowered due to peat settlement. In time the area will not be able to discharge runoff by gravity means, and drainage pumping will be required. This pumping requirement will be exacerbated by the predicted sea level rise due to climate change effects. As the pump will discharge through Piako Scheme flood protection assets directly to the Piako River, it was agreed between WPDD, Council and the Waikato Regional Council that the pump should be constructed as an extension to the Piako River Scheme.

The financial model developed for funding the project was agreed between Councils and landowners. The local share was reduced from the standard 75% to 37%, with contributions from the Piako Scheme and both Councils. Hauraki District Council’s 5% share was to be funded from asset sales.

Pump location and outlet configuration

Various options for the location of the pump between the road and the low ground to the west have been investigated. The current proposal is to site the pump towards the western edge of the clay terrace, and to discharge to the river via a stopbanked canal, and a bridge or culvert structure under Kaihere Road.

The minimum footprint of the outlet canal would be a straight channel along the northern boundary of the property, taking about 50m of the 250m width of the farm for the channel, berms and access. This would amount to about one fifth of the farm (8 of the 40ha), leaving 32 ha to be disposed of.

The current proposal for the outlet canal is for a meandering channel, designed to provide shade and habitat enhancement, and possibly to nullify possible submissions to the consent for the project. The result of this design change is to require more land for the outlet, with subsequent reduction in the area of the residual land to dispose of.

Issues

The farm was originally purchased by Council to site the pump and ancillary structures. It was expected that 80% of the land could be disposed of. The capital contribution of 5% is in addition to the value of any land to be made available for the project. Any increase in the footprint of the outlet channel will reduce the return to Council of the residual area.

Council has long supported the project and has agreed to a capital contribution to the extension to the Piako Scheme. The question is whether the increase in land required for the project is to be considered an increase in the capital contribution, or to be offset against the agreed 5%.

Page 3 of 5

Council Agenda - 28-03-18 Page 52

Recommendation

That Council consider whether to support the amended outlet meander configuration, and if so, whether to include the increased value of the land required as part of the capital contribution.

Proposed pump location

Council farm at 246 Kaihere Road, Ngatea

Page 4 of 5

Council Agenda - 28-03-18 Page 53

Appendix B – Muggeridge Site Plan

PagePage 5 of 5

Council Agenda - 28-03-18 Page 54

'HFLVLRQ5HSRUW  7R 0D\RUDQG&RXQFLOORUV

)URP *URXS0DQDJHU3ODQQLQJDQG(QYLURQPHQWDO6HUYLFHV

'DWH :HGQHVGD\0DUFK 'RFXPHQW  )LOHUHIHUHQFH $SSHQGL[$  3RUWIROLRKROGHU &RXQFLOORU3DXO0LOQHU

0HHWLQJGDWH :HGQHVGD\0DUFK

6XEMHFW 'RJ5HJLVWUDWLRQDQG,PSRXQGLQJ)HHV  

5HFRPPHQGDWLRQ  7+$7WKHUHSRUWEHUHFHLYHGDQG  7+$7SXUVXDQWWR6HFWLRQDQG6HFWLRQRIWKH'RJ&RQWURO$FWWKH)HHVDQG&KDUJHV DV GHWDLOHG LQ $SSHQGL[ $ 6FKHGXOH  RI WKLV UHSRUW LV DGRSWHG DV WKH VFDOH RI IHHV IRU 'RJ 5HJLVWUDWLRQDQG,PSRXQGLQJ)HHVIRUWKHGRJUHJLVWUDWLRQ\HDU 

  3XUSRVH  7KLVUHSRUW¶VSXUSRVHVHHNV&RXQFLODSSURYDOIRUWKH'RJ5HJLVWUDWLRQDQG,PSRXQGLQJ)HHVIRUWKH GRJUHJLVWUDWLRQ\HDU  7KH PDWWHU RU VXJJHVWHG GHFLVLRQ GRHV QRW LQYROYH D QHZ DFWLYLW\ VHUYLFH SURJUDPPH SURMHFW H[SHQGLWXUHRURWKHUGHOLYHUDEOH  %DFNJURXQG  7KHFXUUHQWGRJUHJLVWUDWLRQ\HDUH[SLUHVRQWKHWK-XQH7KH'RJ&RQWURO$FW WKH$FW  UHTXLUHVWKDWGRJFRQWUROIHHVEHDGRSWHGE\UHVROXWLRQRI&RXQFLO&RXQFLOLVDOVRUHTXLUHGDWOHDVW RQFHGXULQJWKHPRQWKSUHFHGLQJWKHVWDUWRIHYHU\UHJLVWUDWLRQ\HDUWRSXEOLFO\QRWLI\LQDQHZVSDSHU FLUFXODWLQJLQLWVGLVWULFWWKHGRJFRQWUROIHHVIL[HGIRUWKHIRUWKFRPLQJUHJLVWUDWLRQ\HDU  7KHGRJFRQWUROIHHVSD\DEOHWRDWHUULWRULDODXWKRULW\VKDOOEHWKRVHUHDVRQDEOHIHHVSUHVFULEHGE\ UHVROXWLRQRIWKDWDXWKRULW\IRUWKHUHJLVWUDWLRQDQGFRQWURORIGRJVXQGHUWKLV$FW7KHUHJLVWUDWLRQDQG LPSRXQGLQJIHHVDUHLQDFFRUGDQFHZLWKVHFWLRQVDQGRIWKH$FW 

3DJHRI  Council Agenda - 28-03-18 Page 55

$UHYLHZRIWKHIHHVLVXQGHUWDNHQSULRUWRHDFKGRJUHJLVWUDWLRQ \HDU 7KH UHFRPPHQGHG GRJ UHJLVWUDWLRQIHHVDQGGRJLPSRXQGLQJFKDUJHVDUHQHFHVVDU\WRPHHWWKHSURSRVHGUHYHQXHILJXUH VHWLQWKHSURSRVHG+DXUDNL/RQJ7HUP3ODQIRU\HDU   ,VVXHVDQGRSWLRQV  $QLPDO&RQWURO7RWDO$FWLYLW\,QFRPH  $QLPDO&RQWURO,QFRPHLVGHULYHGIURP'RJ5HJLVWUDWLRQDQG$QLPDO&RQWUROIHHVDQGFKDUJHV  'RJ5HJLVWUDWLRQ,QFRPHLVSURYLGHGE\'RJ5HJLVWUDWLRQ)HHVDQG'RJ5HJLVWUDWLRQ,QIULQJHPHQW )LQHV$QLPDO&RQWURO,QFRPHLVSURYLGHGE\,PSRXQGLQJ)HHVDQG'RJ&RQWURO,QIULQJHPHQW)LQHV  ,QDFFRUGDQFHZLWK&RXQFLO¶V5HYHQXHDQG)LQDQFLQJ3ROLF\'RJ5HJLVWUDWLRQLVIXQGHGE\ IHHVDQGFKDUJHVDQG$QLPDO&RQWUROKDVIXQGHGE\UDWHVDQGE\IHHVDQGFKDUJHV   'RJ5HJLVWUDWLRQ  7KHSURSRVHG'RJ5HJLVWUDWLRQ,QFRPHIRUWKHGUDIW/RQJ7HUP3ODQEXGJHWIRULV   1XPEHURI'RJV5HJLVWHUHGWRGDWH   *HQHUDOGRJV±HQWLUH    *HQHUDOGRJV±GHVH[HG    52/GRJV±HQWLUH    52/GRJV±GHVH[HG    'RJVLQH[FHVVRIWKUHH    7RWDO5HJLVWHUHG'RJV    %DVHG RQ WKH QXPEHU RI UHJLVWHUHG GRJV DV DW , 0DUFK  ZKLFK ZDV EXGJHWHG WR EH  *67H[FO LQUHJLVWUDWLRQIHHVDQGLQILQHVDWRWDORI7KHIHHVZLWKWKH ILQHVDUHUHTXLUHGWRPHHW&RXQFLOIXQGLQJSROLF\IRUWKLVDFWLYLW\ZKLFKLVIXQGHGE\WKHIHHV DQGFKDUJHV 7R GDWH WKH 5HJLVWUDWLRQ IHHV DQG ILQHV LQFRPH KDYH JHQHUDWHG WKH EXGJHWHG DPRXQW IRU WKLV ILQDQFLDO\HDUDQGWKLVILJXUHLQFOXGHVUHJLVWUDWLRQSHQDOW\IHHVZKLFKFDQYDU\IURP\HDUWR\HDU  )LQHV  ,QIULQJHPHQW)LQHVDUHVHWE\WKH*RYHUQPHQWLQVWDWXWHVRWKH\DUHQRWDEOHWREHFKDQJHG7KHUH DUHDQXPEHURIYDULDEOHVLQYROYHGDVWRZKHQ&RXQFLOUHFHLYHVWKHLQFRPHIURP,QIULQJHPHQWILQHV SDUWLFXODUO\WKURXJKWKH&RXUWV$SSUR[LPDWHO\WZRWKLUGVRIWKHVHILQHVUHODWHWR'RJ5HJLVWUDWLRQ DQGRQHWKLUGRIWKHILQHVUHODWHWR$QLPDO&RQWURO  7KHUHLVQRFHUWDLQW\LQWKHDPRXQWRIILQHUHYHQXH&RXQFLOZLOOUHFHLYHDVLWYDULHVIURP\HDUWR\HDU GHSHQGLQJ RQWKH QXPEHU RIGRJFRQWURO LQIULQJHPHQWILQHV LVVXHG KRZHYHU ZH KDYH EXGJHWHG IRU\HDUIRUGRJUHJLVWUDWLRQILQHVZKLFKPD\YDU\   

3DJHRI  Council Agenda - 28-03-18 Page 56

'RJ5HJLVWUDWLRQ)HH,QFRPH  7KH'RJ5HJLVWUDWLRQLQWKHGUDIW/RQJ7HUP3ODQ([SHQGLWXUHIRULVDQGWKH IXQGLQJSROLF\IRUWKLVDFWLYLW\ZKLFKLVIXQGHGE\WKHIHHVDQGFKDUJHVZLOOPHDQWKHLQFRPH UHTXLUHPHQWZLOODOVRKDYHWRLQFUHDVHWRIURP  'XHWRWKHVKRUWIDOOLQIHHVLWLVUHFRPPHQGHGDQLQFUHDVHWRWKHFODVVHVRIIHHVDVSHUWKH 1RYHPEHU/73&RXQFLOZRUNVKRS7KHQHZIHHVZLOOJHQHUDWHLQ'RJ5HJLVWUDWLRQ IHHVDQGUHOLHVRQJHQHUDWHGLQILQHV 

'RJ5HJLVWUDWLRQDQG,PSRXQGLQJ)HHVIRU\HDU

,QRUGHUWRDFKLHYHWKHGUDIW/73EXGJHWWKHUHFRPPHQGHGGRJUHJLVWUDWLRQIHHVDQG LPSRXQGLQJIHHVIRUDUHLQWKHIROORZLQJWDEOHDQGEHORZ

 'RJ2ZQHU )HH 'H6H[ 0LQLPX 3HQDOW\ 0D[LPXP 0D[LPXP &ODVVLILFDWLRQ  5HEDWH P)HH IHHLISDLG )HH )HH  &HUWLILFDWH  DIWHU 1HXWHUHG (QWLUH  5HTXLUHG   -XO\                General Dogs    'HVH[HG                (QWLUH    Dogs in       excess of        three (3)  ROL Dog    /RVVRI        /LFHQFH   Dangerous    'HVH[HG   Dog                  (QWLUH     Replacement       Tag  

3DJHRI  Council Agenda - 28-03-18 Page 57

3URSRVHG 0LVFHOODQHRXV   ,PSRXQGLQJ)HHV    )LUVW,PSRXQGLQJ     6HFRQG2IIHQFH     7KLUG2IIHQFH    3OXV6XVWHQDQFH)HHSHUGD\  0LFURFKLSSLQJ)HHIRUGRJVUHOHDVHGIURPWKH3RXQG  &RQVHQWWRNHHSPRUHWKDQWZRGRJVLQ8UEDQDUHD  52/$SSOLFDWLRQ)HH  7UDQVIHUUHG52/3URSHUW\,QVSHFWLRQ)HH  1RWH)DLOXUHWRUHJLVWHU52/GRJVE\-XO\RIHDFK  5HJLVWUDWLRQ\HDUGLVTXDOLILHV5HVSRQVLEOH2ZQHUVWDWXV    &RPSDULVRQV  GLUHFWFRPSDULVRQVZLWKFKDUJHVPDGHE\QHLJKERXULQJ&RXQFLOVLVQRWDOZD\VSRVVLEOHDVWKH V\VWHPVIRUFKDUJLQJGRJUHJLVWUDWLRQIHHVDOOYDU\+RZHYHUWKHWDEOHEHORZLOOXVWUDWHVFRPSDULVRQV ZKHUHWKH\FDQEHIDLUO\PDGHZLWK+'&RQH\HDUDKHDG   +DXUDNL'& 03'& :DLNDWR'& 7&'& 6:'&                

*HQHUDO'RJ     

UXUDO *HQHUDO'RJ    GHVH[HG  XUEDQ

52/        VW ,PSRXQGLQJ       QG        UG        

6XVWHQDQFHGD\     

  

3DJHRI  Council Agenda - 28-03-18 Page 58

 6LJQLILFDQFHDQG(QJDJHPHQW$VVHVVPHQW  7KLV GHFLVLRQ GRHV QRW WULJJHU WKH 6LJQLILFDQFH DQG (QJDJHPHQW 3ROLF\ $VVHVVPHQW 7RRO DQG WKHUHIRUHLVQRWFRQVLGHUHGVLJQLILFDQWXQGHUWKH6LJQLILFDQFHDQG(QJDJHPHQW3ROLF\  7KLVSROLF\LVQRWWULJJHUHGDVWKLVLVDQDGPLQLVWUDWLYHPDWWHUWKDWLVJXLGHGE\DVSHFLILFOHJLVODWLYH SURFHVVDVRXWOLQHGLQWKH'RJ&RQWURO$FW   %XGJHW,PSOLFDWLRQV  7KHDGRSWLRQRIWKHVHGRJUHJLVWUDWLRQIHHVZLOOEHLQOLQHZLWKWKHGUDIW/RQJ7HUP3ODQIRU WKLVDFWLYLW\   5HFRPPHQGDWLRQ  &RXQFLOVKRXOGPDNHLWVGHFLVLRQRQZKLFKRSWLRQWRFKRRVHEDVHGRQWKDWRSWLRQEHLQJWKHPRVW FRVWHIIHFWLYHDQGJRRGTXDOLW\RSWLRQIRUWKH+DXUDNL'LVWULFW VRIWKH/RFDO*RYHUQPHQW$FW    ,QRUGHUWRDFKLHYHWKH$QLPDO&RQWURO6HUYLFHVLQFRPHZLWKWKHGUDIWDQQXDOSODQEXGJHWLW LVUHFRPPHQGHGWKDWWKHSURSRVHGIHHVDQGFKDUJHVIRU'RJ5HJLVWUDWLRQDQG,PSRXQGLQJIHHVDV RXWOLQHGLQ6FKHGXOHEHORZEHDGRSWHGIRUWKH'RJ5HJLVWUDWLRQ\HDU      3HWHU7KRP *URXS0DQDJHU3ODQQLQJDQG(QYLURQPHQWDO6HUYLFHV  

3DJHRI  Council Agenda - 28-03-18 Page 59

$SSHQGL[$  6&+('8/(  5(&200(1'(')((6  $OO)HHVLQFOXGH*67

'2*5(*,675$7,21$1',03281',1*)((6

'RJ2ZQHU )HH 'H6H[ 0LQLP 3HQDOW\IHH 0D[LPXP 0D[LPXP)HH &ODVVLILFDWLRQ  5HEDWH XP LISDLGDIWHU )HH (QWLUH  &HUWLILFDWH )HH -XO\ 1HXWHUHG   5HTXLUHG                   *HQHUDO'RJV    'HVH[HG          (QWLUH   'RJVLQ       H[FHVVRI      WKUHH   52/'RJ    /RVVRI      /LFHQFH 'DQJHURXV    'HVH[HG   'RJ       (QWLUH   5HSODFHPHQW       7DJ  )HH 0LVFHOODQHRXV   ,PSRXQGLQJ)HHV    )LUVW,PSRXQGLQJ   6HFRQG2IIHQFH   7KLUG2IIHQFH  3OXV6XVWHQDQFH)HHSHUGD\  0LFURFKLSSLQJ)HHIRUGRJVUHOHDVHGIURPWKH3RXQG  &RQVHQWWRNHHSPRUHWKDQWZRGRJVLQ8UEDQDUHD  52/$SSOLFDWLRQ)HH  7UDQVIHUUHG52/3URSHUW\,QVSHFWLRQ)HH  1RWH)DLOXUHWRUHJLVWHU52/GRJVE\-XO\RIHDFK  5HJLVWUDWLRQ\HDUGLVTXDOLILHV5HVSRQVLEOH2ZQHUVWDWXV    

3DJHRI  Council Agenda - 28-03-18 Page 60

Decision Report

To: Mayor and Councillors

From: Policy Analyst

Date: Monday, 19 March 2018 Document: 2357412 File reference: Appendix A: 2355521 Portfolio holder: Mayor, Councillor Paul Milner

Meeting date: Wednesday, 28 March 2018

Subject: Draft Hauraki District Growth Strategy 2050

Recommendation:

THAT the report be received, and

THAT the draft Hauraki District Growth Strategy 2050 be adopted as a resource to guide Council’s decision-making on land use planning and infrastructure provision; and

THAT early consultation with Iwi on the draft Hauraki District Growth Strategy 2050 be undertaken as a priority and consultation with key stakeholders also be undertaken; and

THAT broader community consultation on the proposals contained in the draft Hauraki District Growth Strategy 2050 be undertaken as they are considered in future changes to the Council’s district plan, long term plan and other relevant documents.

THAT the results of consultation be considered by the District Plan Committee and recommendations made to incorporate the feedback into a final strategy document to be considered for adoption by Council.

Purpose

This report provides the draft Hauraki District Growth Strategy 2050 for consideration by Council and recommends that the draft Growth Strategy be adopted and released for targeted consultation.

Background

The draft Growth Strategy (Attachment A) has been prepared in response to unanticipated growth in the Hauraki District, Council direction to undertake plan changes to release more land for development and the resulting infrastructure requirements.

The draft strategy provides a framework for guiding future growth decisions and it defines future areas for built development within the District. It intends to provide a guide for making consistent decisions under the range of the Council’s statutory responsibilities and powers, particularly the Local Government Act 2002 (LGA) and Resource Management Act 1991 (RMA).

Page 1 of 5

Council Agenda - 28-03-18 Page 61

In particular, the draft strategy aims to inform district plan changes that will provide certainty to the community and the market about the development of the District and allow Council to ensure efficient infrastructure and service provision.

The strategy is not intended to fulfil the Council’s statutory decision-making obligations regarding specific land use proposals nor commit the Council to their implementation, but rather provide information to be considered when making decisions in future.

Council’s District Plan Committee considered the draft strategy at its meeting on 14 March 2018. The Committee recommended changes be made to the draft strategy to reflect its preferred option for growth and that further growth areas be added to Waihi and Paeroa. These changes have been made to the draft strategy. The Committee also recommended that the draft strategy should be presented to full Council to be considered for adoption and release for consultation with Iwi and key stakeholders.

Issues and options

The draft strategy has three sections. The first is a District profile; setting the scene regarding current development, special features for protection, and development constraints such as natural hazards. The following chart shows the main development constraints and opportunities for the District over the next 30 years.

Chart 1: Summary of development constraints and opportunities

The second section of the strategy sets out key principles for growth and outlines Council’s strategic direction for future growth in the District; which is to provide for three main towns (Waihi, Paeroa and Ngatea), two secondary townships (Turua and Kerepehi) and many rural and coastal settlements, see map 1 on the following page.

Section two of the strategy also includes a detailed analysis of the three main towns and two secondary townships of the District. The proposed growth areas are analysed, including a capacity calculation to ensure sufficient land is provided to allow for the expected growth in population and business over the next 30 years.

The third section sets out implementation actions to achieve the sustainable growth of the District, such as rezoning land in growth areas. The actions have timeframes (short, medium, long term) and are assigned to relevant Council departments.

Page 2 of 5

Council Agenda - 28-03-18 Page 62

Map 1: Current and future strategic direction for growth in the Hauraki District

New deliverable

The adoption of the draft strategy in itself will not commit Council to future land use decisions. Rather, it is anticipated that such decisions will be made in future in the form of district plan changes, long term plan changes and other decision-making under the relevant statutory provisions.

Significance and Engagement Assessment

This decision does not trigger the Significance and Engagement Policy Assessment Tool and therefore is not considered significant under the Significance and Engagement Policy 2014.

The level of engagement considered appropriate for this matter, at this point in time, is to consult (i.e. two-way communication to obtain public feedback) with Iwi and key stakeholders. This is in accordance with provisions in the LGA and RMA that require consultation with Iwi on matters affecting land, water, sites, waahi tapu and other taonga. Other agencies such as NZTA, WRC and DoC have statutory responsibilities for land use in the District. It is important to consult early in the development of the growth strategy to allow meaningful input and time for responses, and to meet statutory requirements.

Staff recommend that it would be more relevant to seek community views at that time when all information and options are considered in a comprehensive manner, such as during district plan changes, long term and annual plan processes.

Page 3 of 5

Council Agenda - 28-03-18 Page 63

Recommendation

It is recommended that Council adopt the draft Hauraki District Growth Strategy 2050 to provide for the sustainable development of the District over the next 30 years, and that consultation on the draft strategy be undertaken with Iwi and key stakeholders.

Nina Murphy Policy Analyst

Page 4 of 5

Council Agenda - 28-03-18 Page 64

Attachment A

Draft Hauraki District Growth Strategy 2050

Council Agenda - 28-03-18 Page 65

Table of Contents

1. Forward by the Mayor ...... 3 2. Overview ...... 4 SECTION 1 – DISTRICT PROFILE ...... 5 3. Demographic Trends ...... 5 4. Existing Development ...... 8 5. Capacity for Growth ...... 9 6. Summary of Development Constraints and Opportunities ...... 10 7. Infrastructure ...... 11 8. Natural Features ...... 14 9. Heritage and Cultural Features ...... 15 10. Natural Hazards ...... 16 11. Natural Hazard Risk Assessment ...... 17 SECTION 2 – GROWTH STRATEGY ...... 22 12. Key Principles for Growth ...... 22 13. Strategic Direction for Growth ...... 23 Waihi...... 24 Paeroa ...... 27 Ngatea ...... 30 Kerepehi...... 32 Turua ...... 32 14. Future Capacity Analysis ...... 33 SECTION 3 - IMPLEMENTATION ...... 35 15. Implementation Actions and Timeframes ...... 35 ATTACHMENTS...... 38 A. Bibliography...... 38 B. Extract from WRC Risk Assessment ...... 39

WORKING DRAFT - #2355521 2 Council Agenda - 28-03-18 Page 66

1. Forward by the Mayor

WORKING DRAFT - #2355521 3 Council Agenda - 28-03-18 Page 67

2. Overview

The Hauraki District contains a diversity of land, communities and economies. Situated in the Waikato Region it is afforded a prime location between the major cities of Auckland, Tauranga and Hamilton. There are three towns in the District; Waihi, Paeroa and Ngatea, two smaller townships; Turua and Kerepehi and a number of smaller settlements in the surrounding areas. The District is geographically diverse with highly productive dairy farming and horticultural land, the rugged beauty of the Karangahake Gorge, wetlands of international significance and beautiful coastlines and beaches. After a period of low growth, the number of people living in the District is now growing faster than was anticipated. This growth has primarily been driven by more people moving into the district, which has added demand for more houses. This may be partly due to the flow on effects of the growth pressures facing nearby cities (Auckland, Tauranga and Hamilton). There is an expectation that the local economy will continue to perform well and the local population will keep growing. The Hauraki Growth Strategy 2050 has been prepared to address the challenges of managing growth in a sustainable manner. It provides a framework for guiding future growth decisions and it defines future areas for development within the District. The Growth Strategy also aims to provide certainty to the community and the market about the development of the District and it allows Council to ensure efficient infrastructure provision. While the Hauraki District is not subject to the National Policy Statement on Urban Development Capacity 2016, as its urban settlements do not exceed 10,000 people, the national significance of providing sufficient development capacity to meet the needs of people and communities and future generations is recognised in the preparation of this Strategy. The proposed overall strategic direction for growth in the Hauraki District is to provide for the managed expansion of Waihi, Paeroa and Ngatea, to ensure these are the District’s three main towns, providing commerce, industry, residential, community, cultural and civic activities. The strategy also provides for Turua and Kerepehi as key secondary service townships in the District, with Kerepehi also being an industrial hub. The remaining rural and coastal settlements are to accommodate growth within their existing areas, reflecting constraints to development such as lack of servicing, natural hazards, special natural features worthy of protection, and historically low growth rates. Implementation of the overall strategic direction for growth will be both through statutory means such as the District Plan and Long Term Plan, and non-statutory methods such as promoting the economic development of the District. The timing of implementation will be continually reviewed to ensure sufficient supply of appropriately zoned land for development. The Growth Strategy will be reviewed at a minimum of 5 yearly, and reviews will be undertaken more frequently if demand exceeds current expectations.

WORKING DRAFT - #2355521 4 Council Agenda - 28-03-18 Page 68

SECTION 1 – DISTRICT PROFILE 3. Demographic Trends

Summary

Population ↗ Older people ↗ Younger people ↘ Ethnic diversity ↗ Dwellings ↗ Household size ↘ Business Units (Commercial and Industrial) ↗ Add graphic for summary stats

Population The population of the District at the last census in 2013 was 17,808 people. Based on a “high” growth scenario, the District’s population is projected to increase by 8% over the ten- year period between 2018 and 2028, from 20,650 to 22,300 people. After 2028, the population is projected to continue increasing but at a lesser rate, reaching 23,695 people by 2048. Of the three towns in the District, Paeroa is forecast to have the most population growth over the next 30 years. However, Waihi is forecast to remain the largest town, with a projected population of 5,840 by 2048. Table 1: District and Town Population Projections

2018 2028 2038 2048 Hauraki District 20,650 22,300 23,145 23,695 Paeroa 4,530 5,010 5,320 5,600 Ngatea 1,435 1,550 1,635 1,685 Waihi 5,320 5,660 5,780 5,840 Source: Rationale Ltd 2017, high growth scenario

Ageing Population Following national trends, the District has an aging population; that means the proportion of people aged over 65 is growing. By 2018 it is estimated that 24% of the population of the Hauraki District will be aged 65+ years; this is projected to increase to 30% by 2028 and 38% by 2048. A combination of factors is driving this; including better health care, longer life expectancies, and declining birth rates. Add image showing increasing/decreasing proportion ages

Household size Also following national trends, the average household size (number of people living in a house) in the District is expected to decrease from 2.50 persons in 2006 to 2.29 persons in 2018. It is considered that this trend will continue and further decrease to 2.24 persons by 2028, and 2.05 persons per household in 2048. The decrease in household size is related to the ageing population, with more one person households, as well as a smaller average family size.

WORKING DRAFT - #2355521 5 Council Agenda - 28-03-18 Page 69

Dwellings Population growth and a decrease in household size translates into a projected increase in the number of dwellings in the District, over the next 30 years. Based on a “high” growth scenario, over the ten-year period from 2018-28 it is projected that the number of dwellings in the District will increase by an average of 114 dwellings per annum, reaching 11,457 dwellings by 2028. After 2028, it is projected that the number of dwellings will continue to increase but at a slower rate. This is consistent with the projected population increases. Table 2: District Dwellings Projections

2018 2028 2038 2048 Hauraki District 10,320 11,457 12,182 13,024 Source: Rationale Ltd 2017, high growth scenario

Rating Units Rating unit growth is driven by the economy, population growth and other changes in demographics and lifestyle patterns. The majority of the projected increase in rating units is in the residential and residential lifestyle rating unit categories. This is because the District’s growth in rating units closely follows the growth trend in the number of dwellings in the District. However, the flow-on effect from the high population and dwellings growth scenario also results in an increase in commercial and industrial rating units from 626 units in 2018 to 962 units in 2048. This is an increase on average of around 11 units per year, or an average growth rate of 1.8% per year. Table 3: District Rating Units Projections

2018 2028 2038 2048 Total Rating Units 11,452 12,687 13,518 14,492 Residential 6,559 7,371 7,906 8,541 Residential Lifestyle 2,348 2,673 2,863 3,070 Rural Industry 1,196 1,196 1,196 1,196 Commercial and Industrial 626 724 830 962 Mineral Related 32 32 32 32 Other 691 691 691 691 Source: Rationale Ltd 2017, high growth scenario

Employment and Industry The industries which created the most jobs in the District between 2007 and 2017 were the health care and social assistance (436 jobs) and public administration and safety industries (79 jobs). The biggest contributors to economic growth in the District over the same 10-year period, were the mining ($103 million) and health care and social assistance industries ($28 million).

WORKING DRAFT - #2355521 6 Council Agenda - 28-03-18 Page 70

Table 4

Table 5

Source: Infometrics Hauraki District Economic Profile, 2017

Mining makes up almost 23% of the Gross Domestic Product for the District in 2017, followed by agriculture, forestry and fishing at almost 20% of GDP. The industry which employs the largest number of people living in the District in 2017 is dairy cattle farming (936 jobs), followed by health services (447 jobs) and then primary education (236 jobs). The gold ore mining industry is the 5th largest employer in the District with 226 jobs.

Source: Infometrics Hauraki District Economic Profile, 2017

WORKING DRAFT - #2355521 7 Council Agenda - 28-03-18 Page 71

4. Existing Development

Currently Waihi, Paeroa and Ngatea are the three main towns in the District, each providing a centre for commerce, industry, residential, cultural and civic activities. Refer to Map 1 below. Kerepehi and Turua are secondary centres or townships. Turua has a residential area with a small township that primarily services the surrounding rural population. Kerepehi while also comprising a residential area, is a developing industrial hub. There are six rural and coastal settlements (Waitakaruru, Waikino/ Mackaytown/ Karangahake, Whiritoa, Kaiaua, Whakatiwai, Waharau North and South), which are primarily residential areas with limited commercial or community services. There are also other smaller settlements scattered throughout the District. These settlements are often a legacy of the past and have either declined in population or grown very slowly over time and as such have not been considered for accommodating future growth.

Map 1: Current development pattern

WORKING DRAFT - #2355521 8 Council Agenda - 28-03-18 Page 72

5. Capacity for Growth

An analysis of the capacity of currently zoned land to accommodate growth was undertaken for the three main towns in the District at the end of 2017. The following table (Table 6) shows the potential residential, low density residential, commercial and industrial development opportunities for Waihi, Paeroa and Ngatea.

Table 6: Potential development of existing zones

Ngatea Waihi Paeroa Totals Zone Greenfield Infill Greenfield Infill Greenfield Infill (lots) (lots) (lots) (lots) (lots) (lots) (lots) Residential 150 546 302 349 414 43 1,804 Low Density Residential 50 117 183 45 - - 395 Industrial 70 - 250 - 10 - 330 Commercial 67 - 50 - 6 - 123

Residential Assuming one dwelling per lot, this analysis shows that currently there is capacity for approximately 1,800 new residential dwellings, and 395 new low density residential dwellings in the District. However, much of this capacity is from infill development, particularly in Waihi. The uptake of infill development is uncertain as many people do not take up this opportunity for a number of reasons, such as unfamiliarity with subdivision rules, lack of financial resources, satisfied with the size of their property. So for planning purposes infill development is often not included in capacity calculations. In this case, using greenfield development only would reduce the capacity of residential development by around half to 866 new residential dwellings and 233 low density residential dwellings, a total of 1,099 dwellings. This represents a shortfall of 38 dwellings from the estimated 1,137 new dwellings required by 2028 (refer section 3 Demographics above). However, this shortfall could be accommodated by development in Turua and Kerepehi which have around 300 potential greenfield residential lots available. If we look further out to 2038, it is estimated that over 1,800 new dwellings will be required. With a potential development capacity of 1,099 dwellings, there is a shortfall of 763 dwellings, most of which is not able to be accommodated by appropriately zoned land elsewhere in the District. So, further land is required to be rezoned in the District, within the next 20 years, to meet this shortfall and then more land will be needed over the longer 30 year timeframe as well. More residential land may be required to be rezoned earlier in Waihi, where there are only potentially 150 greenfield lots available for residential development.

WORKING DRAFT - #2355521 9 Council Agenda - 28-03-18 Page 73

Commercial/Industrial Based on current District Plan standards there is capacity for 330 new industrial lots and 123 new commercial lots in the District. Assuming one rating unit per lot, this meets and exceeds the projected 336 new commercial and industrial rating units required by 2048 (refer section 3 Demographics above). This suggests that further land is not required to be zoned in the next 30 years for commercial or industrial development. However, most of the currently available industrial land is in Paeroa (250 lots), with only 70 lots available in Waihi. So more industrial land may be required to be rezoned in Waihi in the near future. There is also only capacity for 6 more commercial lots and 10 more industrial lots in Ngatea, suggesting more land may be required to be rezoned to accommodate growth particularly for commercial development requiring larger lots.

6. Summary of Development Constraints and Opportunities

The following table (Table 7) shows a summary of the main development constraints and opportunities for the District over the next 30 years. Refer to the following sections for more detail - infrastructure capacity, including increasing environmental compliance standards (section 7), natural features (section 8), historic and cultural features (section 9), natural hazards, including effects from climate change (section 10), natural hazard risk assessment, including climate change factors (section 11).

Table 7: Summary of development constraints and opportunities

• Natural hazards ✗ • Close proximity to three

• Climate change ✗ cities ✔

• Increasing environmental • Productive land ✔ compliance ✗ • Mineral resources ✔ • Lack of infrastructure capacity ✗ • Growing population ✔ • Stable local economy ✔ • Infrastructure capacity ✔

• Natural features e.g. coastal, landscapes, wetlands ✔ ✗ • Cultural sites e.g. waahi tapu, taonga ✔ ✗

WORKING DRAFT - #2355521 10 Council Agenda - 28-03-18 Page 74

7. Infrastructure

In 2018 Council owns and manages $504 million of infrastructure assets, of these roading assets make up over half of the total value. These assets include:

x 633kms of roads (518km sealed, 115km unsealed), 145 bridges and major culverts and 114kms of footpaths. x four water treatment plants supplying nine urban and 3 rural reticulated schemes with approximately 550km of pipes servicing 7,080 urban and rural properties. x seven wastewater treatment plants servicing approximately 6,050 properties via 166km of pipes. x 90km of urban stormwater pipes and 40km of open drains. x 650km of rural land drains and 91 km of stopbanks. Council’s community recreation assets include swimming pools at Paeroa and Ngatea, the Waihi Events Centre, 67 parks and reserves, and associated facilities such as park furniture, playgrounds, and buildings. Council’s community facility assets include: district and rural community halls, pensioner housing, public toilets, cemeteries and non-recreation reserves. Water supply, wastewater, stormwater, roading, land drainage, community recreation facilities and other community facilities are outlined in further detail below including the main issues and capacity considerations.

Water Supply The following key issues for water have been identified:

x Drinking water quality standards. x All our resource consents will need renewing but we are uncertain about what the future conditions will require. x Capacity for growth in the water supply network. x Water network losses. x Effect of climate change on water supply. x The risk to water supply infrastructure from natural hazards. x Asset condition and performance.

There is currently sufficient extra capacity in the water treatment plants to accommodate the growth projections, but any significant increase in demand from for example dairy or industry may require significant expenditure for upgrades.

WORKING DRAFT - #2355521 11 Council Agenda - 28-03-18 Page 75

Wastewater The following key issues for wastewater have been identified:

x Increased environmental compliance standards will need to be met. x Projected population growth will exceed the capacity of existing wastewater treatment plants, particularly in Kerepehi, Waihi and Paeroa. x Need to reassess the capacity of wastewater infrastructure to cope with climate change impacts – more intense and frequent rainfall. x The impact of sea level rise, rising water tables and coastal erosion on public and private wastewater infrastructure. x Understanding the District’s leaky network catchments. x Asset condition and performance.

Over the next 5 years, beginning in 2018, Council will be required to renew all of its discharge consents for the wastewater treatment plants. New environmental standards for discharges will require upgrades to all 7 of the wastewater treatment plants. Expected growth (residential and commercial / industrial) in the District may also drive the need to upgrade wastewater treatment plants. This is particularly relevant in Paeroa and Kerepehi where development is likely to drive the need to upgrade before the discharge consents require Council to do so.

Stormwater The following key issues for stormwater have been identified:

x Increased environmental compliance standards will likely require the treatment of stormwater. x The impact of more frequent and intense rainfall events as a result of climate change. x The Council needs to better understand the condition and performance of its older stormwater assets.

As with wastewater, new environmental standards are likely to mean that Council will have to improve the quality of the stormwater discharges to the rivers. Council has proactively responded to climate change by using the recommended increase in rainfall intensities for determining pipe sizes for stormwater systems.

WORKING DRAFT - #2355521 12 Council Agenda - 28-03-18 Page 76

Roading The following key issues for land transport have been identified:

x Future level of funding subsidies is uncertain. x Impacts of aging population and accessibility on levels of service and costs of providing that service. x Impact of sea level rise and coastal erosion on roading and bridge infrastructure. x Impacts on roading infrastructure from climate change. x Our bridges are aging but we don’t know enough about their condition.

Council is trying to determine the potential impacts of climate change on our roads – particularly the peat underlying areas of the Hauraki Plains. Climate change scientists have indicated that we can expect more droughts and bigger rain events more frequently as the climate changes. The droughts can be particularly damaging to roads built on peat soils. Large rain events cause flooding and slips which may lead to increased maintenance costs for the Council.

Land Drainage Schemes The following key issues for land drainage have been identified:

x Impacts on land and property from sea level rise and coastal erosion. x Impact of climate change on the land drainage network. x Impact of natural hazards on the land drainage network. x Asset condition and performance. x Peat oxidation causing ground level to lower.

The land drainage network is comprised of pump stations, stopbanks, flood gates and land drains. As a result of the consolidation of the soft underlying soils, routine work is required to raise stopbanks back to design levels. The raising of the stopbanks to accommodate sea level rise predictions will also be undertaken as part of this routine work. The anticipated increase in the population of the Hauraki District is not expected to impact demand on the land drainage infrastructure. The primary function of the land drainage activity is to provide and protect arable land. This function is not affected by changes in the urban environment. Moreover, changes in imperviousness on farming and rural properties which would typically affect runoff are considered negligible compared to the capacity of the land drainage infrastructure.

WORKING DRAFT - #2355521 13 Council Agenda - 28-03-18 Page 77

Community Recreation and Facilities Forecast population growth will impact on demand for community assets. Council is proposing more specific measures for levels of service which can then be used as a basis for improving the delivery of existing services and providing new capacity/services as required.

Summary As well as maintenance and renewals of Council infrastructure, a common issue is how climate change will impact on Council’s infrastructure in the future. The effects of climate change include sea level rise, leading to increased coastal erosion, coastal flooding and rising water tables, and increased frequency and intensity of rainfall from storm events. The natural hazards of the District are examined in more detail in section 9 below, and it is important to remember the risk they pose to council infrastructural assets as well as to private development such as people’s houses. Council’s Infrastructure Strategy identifies that the risk from the effects of climate change impacting on Council’s stormwater, water supply and wastewater assets is low, as there is time to identify and respond to the risk. The Infrastructure Strategy notes that there is medium risk to Council’s roading and bridge infrastructure from sea level rise and coastal erosion, though some parts of the network, such as Kaiaua have a higher risk. The Infrastructure Strategy also notes with regard to land drainage, that stopbank failure would be catastrophic on low lying and coastal settlements. The risk is assessed as high but unlikely to occur. Further work is identified to model stopbank failure and understand what mitigation measures may be required.

8. Natural Features

The District contains many unique and special natural features, refer Map 2. These are summarised below: The District contains two of six internationally significant wetlands in NZ. The first, is the Kopuatai and Torehape Peat Domes, which together comprise an expansive area of wetland. The Kopuatai Peat Dome has been accorded International status as a Conservation Area by the International Union for Conservation of Nature and Natural Resources (IUCN) based on the Ramsar Convention. The wetlands perform an essential catchment management function. In addition, the wetlands have high cultural value to Ngati Hako. It is essential that these wetlands be retained in their natural or regenerating state. The second wetland, is the Firth of Thames coastline, from Miranda to the Waihou River mouth, which consists of soft mudflats, mangrove forest and some intermingled salt marsh. This coastal wetland is one of New Zealand's most important coastal stretches for wading birds and has also been recognised as of international significance by Ramsar. The eastern coastline of the district contains outstanding natural features and landscapes, such as the Whiritoa blow hole. The coastline is dominated by a series of bays and several sandy beaches. For some stretches of the coastline the land drops straight into the sea in the form of distinctive white and pink cliffs.

WORKING DRAFT - #2355521 14 Council Agenda - 28-03-18 Page 78

Features of this coastline include important coastal habitats, natural stream tributaries and estuaries, and vegetated pohutukawa cliffs, rarely found on the Coromandel Peninsula. The rural land resource is one of the most valued of the natural and physical resources in the District. It includes the fertile Hauraki Plains and Waihi basin areas, the western foothills of the Hapuakohe Range, the eastern hills of the Waihi Basin and the foothills of the Coromandel and Kaimai-Mamaku Ranges. Dairy farming is concentrated on the plains area. Horticulture is predominantly located in the Waihi Basin. Extensive grazing and production forestry occurs in the hill country. Important mineral resources are also located within the District. The Karangahake Gorge contains outstanding natural features and landscapes such as Ohinemuri River, White Rocks, Owharoa Falls and Mt Karangahake. In addition, the Karangahake Gorge includes steep rock cliffs, vegetation, historic examples of the gold mining era and recreation activities. Although the landscape has been significantly modified over the years, the combination of the dramatic physical geography, regenerating indigenous vegetation, cultural heritage of significance to tāngata whenua and historic heritage makes the area outstanding within Hauraki District. The Coromandel and Kaimai Ranges are another outstanding landscape. The range forms the distinctive backbone to the Coromandel Peninsula and continues south into Hauraki District. The landform varies from rolling hills to steep and deeply incised hill country. With the exception of some of the lower slopes which are used for sheep and cattle grazing, the majority of the land is in native forest with some areas of pine plantation. The ranges have significant deposits of epithermal gold and silver that have been mined since the 1870s. New Zealand’s richest gold and silver mining area is located in Waihi but historically mining has also occurred in the Coromandel ranges from Waihi north and in the Karangahake Gorge. The District also contains large areas of indigenous vegetation in public ownership mainly to the east of the district (Coromandel Forest Park, Kaimai-Mamaku Forest Park), with smaller areas in the north west (Hunua Ranges, Waharau Regional Park) and west (Kaihere Patetonga Hills, and Hapuakohe Range).

9. Heritage and Cultural Features

The concept of heritage encompasses natural, built and cultural features including historic buildings, archaeological sites, trees, landforms and ancestral lands. Heritage is what is passed from one generation to another, or what provides links with the past as well as providing current and future generations with spiritual and cultural wellbeing and identity. Council’s District Plan protects identified heritage features, items and areas; and areas of significance to Maori within the District. The relationship of Maori, including their culture and traditions, with their ancestral lands, water, waahi tapu and other taonga has the potential to be destroyed or compromised through inappropriate land use and development. Only a fraction of the original Maori land holdings within the Hauraki District now remain in Maori ownership. Land in current Maori ownership is only part of what are termed ‘ancestral lands’ or ‘ancestral landscapes’. Some lands that are no longer in Maori ownership hold importance to particular iwi, hapu or whanau as part of their ancestral heritage.

WORKING DRAFT - #2355521 15 Council Agenda - 28-03-18 Page 79

Heritage sites of cultural and historical significance to Maori can also be damaged or altered in ways that demean their mana and wairua. This may occur during subdivision and land development, the removal of natural resources through mining or quarrying, or the discharge of waste into water or onto land of high spiritual significance. Council recognises that ongoing consultation with tangata whenua is necessary to ensure that waahi tapu and other sites are recognised in a culturally appropriate manner and that acceptable mechanisms are put in place for their protection. Council accepts that in some circumstances there is an inherent conflict between the identification of waahi tapu and their protection, and in some instances, the Maori Community may not wish to have particular sites identified. Council will endeavour to identify, in consultation with the iwi who have mana whenua, significant Maori traditional sites and provide for protection and preservation of them. Council, in consultation with tangata whenua, will also work to devise acceptable methods to provide the necessary protection and preservation for unidentified Maori traditional sites.

10. Natural Hazards

The Hauraki District is subject to a number of natural hazards, such as river and stream flooding, coastal erosion, coastal flooding, earthquake and tsunami. River and stream flooding is the most common natural threat to the Hauraki District, with most rivers and streams posing a potential hazard to existing development which is situated close to the banks of rivers. The Waihou, Piako and Ohinemuri River systems have been identified as being the highest risk of creating a flood hazard. The majority of the Hauraki Plains is very low lying and subject to high groundwater tables. Flood protection schemes are in place, however flooding can result from flows that exceed the design standards of the schemes (overtopping) and breakages of the stopbank. The areas that are most at risk from coastal erosion and coastal flooding hazards are:

x Whiritoa on the east coast of the Coromandel Peninsula. x The Kaiaua-Pukorokoro/Miranda lowlands, located on the western side of the Firth of Thames. x The northern part of the Hauraki Plain which is bounded by the Firth of Thames. The Kaiaua-Pukorokoro/Miranda lowlands are particularly vulnerable to serious coastal flooding during extreme storms. Coastal erosion affects the entire length of the coast. There are also other communities that have not been impacted by coastal flooding in recent history but which could be particularly vulnerable in the event of over-topping or failure of existing stopbanks, especially low lying settlements of the Hauraki Plains (e.g. Waitakaruru, Turua, and Ngatea). As a result of climate change, the Hauraki District is at risk from increasing sea levels, rising water tables and greater climate variability, including changing temperature and rainfall patterns and increasing storm intensities. Climate change presents an immediate threat from higher storm intensities and potential for weather-related natural hazards such as floods, slips and drought.

WORKING DRAFT - #2355521 16 Council Agenda - 28-03-18 Page 80

Over the longer term, climate change and sea level rise are likely to increase risks to coastal properties due to increased coastal flooding and erosion. There may also be implications for primary production industries resulting from changes to the region’s suitability for different types of farming, and water storage. Furthermore, there will be implications for Council’s infrastructure in servicing existing and future communities. The Kerepehi Fault is an active fault running through the Hauraki Plains between the Firth of Thames and Okoroire. A large magnitude movement of this fault is a significant earthquake hazard to surrounding communities. Liquefaction as a result of an earthquake generated by the Kerepehi Fault is also a potential hazard for areas of the District with silty soils and a high water table, including the Hauraki Plains, Paeroa and Waihi. The north and east of the Coromandel Peninsula and the Firth of Thames are both at risk from tsunami. The hazard is dependent on whether the tsunami has been generated by a local or distant event, both in terms of warning times and size of tsunami event. Mayor Island, which is situated 25km offshore from Whiritoa, represents the most significant volcanic hazard to the District. Mayor Island has produced many explosive and effusive eruptions during its history. Ash fall from other sources such as the Taupo and Okataina volcanic zones is also possible.

11. Natural Hazard Risk Assessment

As well as identifying the natural hazards present in the District, it is important to establish the relative risk of the natural hazard occurring. Analysis by Waikato Regional Council (WRC) on hazards in the Hauraki District reveals that river flooding hazards, particularly at Ngatea and Paeroa, pose the greatest risk in terms of potential loss of human life, social disruption, economic cost and infrastructure damage. Coastal flooding has the second highest risk, and earthquakes have the third highest risk.1 Note that this analysis does not include the Kaiaua Coast as this area was not in the Hauraki District at the time, being added as a result of Auckland Council amalgamation in 2010. The following scenarios have been assessed by WRC:

x River flood: 1% Annual Exceedance Probability (or 1/100 year) flood event x Coastal flood and erosion: 1% Annual Exceedance Probability (or 1/100 year) storm event x Severe storm: 1% Annual Exceedance Probability (or 1/100 year) storm event x Earthquake: magnitude 6.9 event along the Northern Kerepehi fault extension (3% chance of occurring in the next 100 years) x Tsunami: 1% Annual Exceedance Probability (or 1/100 year) event with wave run up of 2.5m x Volcanic activity: 1/1000 year event from Mayor Island x Debris flow: 1/500 year event. The following table (Table 8) shows the risk level determined by WRC based on likelihood and consequence, note this is a summary of the full table which is reproduced in Attachment 2.

1 An Overview of Natural Hazards in the Hauraki District Including a qualitative risk assessment. WRC, 2007, pg. v, 29

WORKING DRAFT - #2355521 17 Council Agenda - 28-03-18 Page 81

Table 8: Natural Hazard Risk Assessment

Natural Hazard WRC Risk Area Affected Evaluation2 River flooding Extreme Areas bordering Waihou, Piako Ohinemuri Rivers Coastal flooding High Coastal areas Earthquake from Kerepehi Fault High District wide Severe storm High Western side of Kaimai Coromandel ranges Tsunami High Coastal areas Volcanic High District wide, dependant on wind directions Debris Flow Moderate Unknown, usually on alluvial fans Coastal erosion Low Coastal areas

The risk assessment concludes that river flooding, coastal flooding and earthquakes are the highest priority natural hazards currently facing the Hauraki District3. The communities most affected by these hazards are Hauraki Plains (Ngatea, Waitakaruru, Turua), Paeroa and coastal communities, these areas will be examined further in section below. The Kaiaua Coast, though not part of WRC’s risk assessment, is also considered at risk of river flooding, coastal flooding and coastal erosion. Recent river and coastal flooding events (March 2017, January 2018) have resulted in inundation of homes, businesses and Council infrastructure, highlighting these hazards. Liquefaction is another risk that has not been adequately assessed to date. Council has undertaken a preliminary desk top assessment4 which concludes that for Ngatea, Turua and Kerepehi liquefaction damage is possible because these areas contain unconsolidated alluvial sediments, high ground water levels and are in close proximity to the Kerepehi Fault. This means more detailed assessment of the liquefaction risk is required for rezoning and new development in these areas. Paeroa township also has mainly unconsolidated alluvial sediments which are prone to liquefaction, though some areas have volcanic soils which are less susceptible. So further assessment of liquefaction risk is also required for rezoning and new development. Waihi has mainly volcanic soils which are less susceptible to liquefaction, plus it is further from the Kerepehi Fault and expected to have lower earthquake shaking intensities.

2An Overview of Natural Hazards in the Hauraki District Including a qualitative risk assessment. WRC, 2007, pg. 28 3 Ibid, pg. 26 4 Liquefaction Risk Assessment Recommendation Report. HDC, 2018

WORKING DRAFT - #2355521 18 Council Agenda - 28-03-18 Page 82

Areas Most at Risk from Natural Hazards Hauraki Plains The Hauraki Plains is at extreme risk of river flooding, it is also subject to a number of high risk hazards; including coastal flooding, severe storms, tsunami and earthquake. Some of the identified hazards, notably river and coastal flooding are considered to have reduced risk because of flood protection schemes. However, it is important to note that protected areas are not “risk free”. The current flood protection schemes are at risk from

x Earthquakes. x Tectonic processes slowly lifting or depressing the plains. x Large tsunami events. x Sea level rise. x Climate change increasing the frequency and magnitude of high intensity rainfall events.5

The Plains is an extremely low-lying area, with townships such as Ngatea and Turua. The WRC has concluded that: As such, there appears to be potential for catastrophic losses with severe stop-bank over-topping or failure. The risk of over-topping of the present stop-banks is presently unknown due to inadequate information on extreme coastal flooding events in the Firth of Thames. Once adequate design information is available to assess residual hazard and vulnerability, appropriate hazard management measures will need to be developed to ensure that the adverse effects of any future flooding are minimised.6 These hazards have implications for the future development of the Hauraki Plains and will be explored more in the following section on addressing river and coastal flooding hazard risk.

Paeroa Paeroa is at extreme risk of river flooding and also experiences flooding from runoff from the Kaimai and Coromandel ranges, though it is not expected to experience coastal flooding. As with the Hauraki Plains, the river flooding risk is considered to be mitigated by flood protection schemes, though these schemes are at risk from the factors identified above. Flooding hazards have implications for the future development of Paeroa, the flooding from runoff is currently managed by land-use planning restrictions e.g. zoning of ponding areas in the Paeroa Main Drain. How the flooding hazard will be affected by climate change and how it can be managed into the future will be explored more in the following section on addressing river and coastal flooding hazard risk.

5 An Overview of Natural Hazards in the Hauraki District Including a qualitative risk assessment. WRC, 2007, pg. 15 6 Coastal Flooding Risk Mitigation Plan 1999. WRC, pg. 10

WORKING DRAFT - #2355521 19 Council Agenda - 28-03-18 Page 83

Coastal Areas Coastal areas in the Hauraki District include the Firth of Thames (Kaiaua Coast, Miranda, Waitakaruru, northern Hauraki Plains) and the east coast (Whiritoa). The extent of coastal areas is subject to some uncertainty with mapping by the WRC (Coastal Environment) in the Regional Policy Statement differing to that in the Hauraki District Plan maps (Coastal Zone). For the purpose of assessing coastal hazards, “coastal areas” are considered to be those areas presently and potentially affected by coastal hazards, including coastal hazards arising from climate change. This includes estuaries, tidally affected groundwater, wetlands, creeks, lowland rivers/streams and adjacent land margins. In the Hauraki District the following areas are therefore considered to be coastal:

x The full length of Council’s Firth of Thames and Pacific Coast lines, x In relation to the Firth, for the Kaiaua Coast this includes the whole of the low land area (Coastal Zone, of the Franklin Section of the District Plan), x In relation to the Hauraki Plains this includes the area seaward of the coastal stopbanks, and the tidal parts of the Waihou and Piako Rivers and Maukoro Canal, x In relation to the Pacific (east) Coast this includes the immediate coastal cliffs, and the environs of Whiritoa – streams and estuaries, and dunes, as well as the low land at Mataora Bay, and x the Hauraki Plains (ground water). The coastal areas on the Firth of Thames are considered to be at high risk of coastal flooding. This risk is mitigated in some areas such as Waitakaruru and the northern Hauraki Plains, due to coastal stop banks. Other coastal areas such as the Kaiaua Coast have no such protection. Coastal flooding is not seen as being a significant issue for Whiritoa7. Coastal erosion risk is considered to be low for most of the coastal areas of the District. However, the Kaiaua Coast is experiencing coastal erosion which is threatening Council infrastructure such as roads.

Addressing River and Coastal Flooding Hazard Risks Further work is required to better understand the risk posed by climate change, sea level and water table rise and the effects on river flooding, coastal flooding and coastal erosion in the District, and the implications for property owners. It is also acknowledged that there will always be uncertainty around climate change and its effects but that this should not delay making decisions. Furthermore, in regard to coastal hazards, the New Zealand Coastal Policy Statement (NZCPS) already directs that a precautionary approach should be adopted and reliance on coastal protection works avoided. Rather, emphasis is placed on the protection of natural protective features of the coast, such as beaches, dunes and wetlands. The NZCPS also requires that areas that may be subject to inundation due to sea level rise, storm surge and wave height, over at least 100 years, be identified. Thus influencing the location and design of new subdivision to avoid the need for hazard protection works.

7 An Overview of Natural Hazards in the Hauraki District Including a qualitative risk assessment. WRC, 2007, pg. 18

WORKING DRAFT - #2355521 20 Council Agenda - 28-03-18 Page 84

A key requirement in the management of natural hazards is engagement with communities, to convey information about climate change scenarios, their impacts on natural hazards and any associated risks to the community. New Government guidance on coastal hazards and climate change was released at the end of 2017, setting out how an adaptive planning process can be used to manage uncertainty and risk and identify a way forward. Adaptation options for the coast can be described as follows:

x Accommodate: adjusting existing assets by using measures that anticipate hazard risk, such as raising floor levels, providing alternative inundation pathways, requiring relocatable houses. x Protect: use natural buffers like dunes or hard structures like seawalls. x Retreat: move people and assets away from the coast in a managed way over time, or as a consequence of erosion and inundation damage after climate-related events. x Avoid: use land-use planning measures that stop putting people and assets in hazard areas.8 In practice, a combination or sequence of these types of measures will be needed as coastal communities are increasingly affected by sea level rise. The same adaptive planning process can be used for communities facing river flooding hazards in the District.

8 Coastal Hazards and Climate Change: Guidance for Local Government. MfE, Dec 2017, pg. 25

WORKING DRAFT - #2355521 21 Council Agenda - 28-03-18 Page 85

SECTION 2 – GROWTH STRATEGY 12. Key Principles for Growth

The following six principles will guide the sustainable development of the Hauraki District into the future. They are based on community outcomes identified through the Long Term Plan process, as well as earlier community consultation undertaken as part of the District Plan review. The principles also embrace best practice regionally (having particular regard to the Waikato Regional Policy Statement9 and the Waikato Plan), nationally and internationally.

1. Promote the development of towns and townships that enable people, communities and future generations to provide for their social, economic, cultural and environmental wellbeing.

2. Ensure sufficient land is available for the development of housing and business activities to provide people with access to a range of lifestyle choices and job opportunities.

3. Contain development within defined urban areas to avoid rural residential sprawl onto productive farmland, and ribbon development along coast and transport corridors.

4. Plan for and integrate infrastructure provision with land zoning and development to ensure infrastructural services and facilities meet future demand.

5. Avoid new development, and mitigate risks to existing communities, in hazard prone areas.

6. Protect special natural and cultural features such as: x Indigenous wetlands; x Indigenous vegetation and biodiversity; x Outstanding landscapes; x Heritage sites and areas; x Productive soils; x Sites of significance to Maori; x Coastal environments.

9 RPS Objective 3.1 - 3.3, 3.6 - 10, 3.12, Policy 4.1-4.4, 6.1 - 6.6, 6.8 – 6.9, 6A

WORKING DRAFT - #2355521 22 Council Agenda - 28-03-18 Page 86

13. Strategic Direction for Growth

The following strategic direction for growth has been determined as the best option for the sustainable development of the district, refer Map 3. This determination has taken into account existing settlement patterns, population projections and infrastructure capacity, considered the physical features and constraints of the District and applied the key principles for growth.

Provide for future growth in Waihi, Paeroa and Ngatea to ensure these are the District’s three main towns, providing centres of commerce, industry, residential, community, cultural and civic activities. Provide for Kerepehi and Turua, as the District’s two secondary townships servicing widespread rural populations and providing an industrial hub. Ensure growth in coastal and rural settlements is accommodated within the limits of the existing settlements, to recognise constraints to development; such as lack of servicing, natural hazard risk, and protection of special natural features. Provide for infill residential development within the main urban areas to ensure a range of lifestyle options to accommodate changing demographics and market demand.

The purpose of consolidating growth around existing towns and townships, is to take advantage of existing assets, including council infrastructure, schools, medical facilities, and other services that may make future development more affordable and more sustainable over the longer term. The purpose of limiting growth to existing areas in the coastal and rural settlements, reflects a preference for avoiding development in areas that have high levels of constraints associated with them, such as hazard risks and future risks from climate change. There is also a priority to avoid scattered rural residential development on productive farm land and ribbon development along the coast and transport corridors. The purpose of providing infill development within existing main urban areas is to take advantage of existing services and to limit urban sprawl. Infill development is already possible through obtaining subdivision and land use consents under the current District Plan. Further infill opportunities can be investigated such as lowering minimum lot sizes in areas in close proximity to urban services and open space, this could allow larger sections to accommodate two houses. Provision could also be made for allowing minor household units or “granny flats” as well as a main house on each site, where neighbourhood amenity can be retained. Furthermore, opportunities for changing consenting requirements for retirement villages, aged care facilities and other comprehensive development to be more reflective of the positive benefits of these developments, could be considered. In the next section we look at Waihi, Paeroa, Ngatea, Turua and Kerepehi in more detail, including issues relating to their growth and how the Growth Strategy addresses these issues.

WORKING DRAFT - #2355521 23 Council Agenda - 28-03-18 Page 87

Waihi

Waihi is located on the eastern side of the Hauraki District and is at the base of the Coromandel Peninsula. As well as a thriving present-day community, Waihi has a rich mining history and was once one of the most prominent gold and silver mines in the world. Today mining remains a key industry for Waihi, with other industries including agriculture and horticulture, including many dairy and livestock farms along with a number of kiwifruit orchards. The key issues for the future development of Waihi have been identified as follows:

x Defining and managing urban boundaries in the developing north-east and south- west edges of the town and ensuring adequate connections between existing development and new urban areas. x Providing for future industrial development and providing additional residential capacity while maintaining residential amenity. x Providing for tourism, and the gateway aspect of Waihi to the Bay of Plenty and vice versa. x Managing the significant socio-economic effects of the eventual closure of the mine at Waihi. These issues are addressed in the Growth Strategy by: promoting the existing Structure Plan Area of 17.3 hectares in Waihi East for residential development, proposing infill residential development in suitable existing residential areas of Waihi and identifying future growth areas for residential (Waitete Road, Bradford Street, Wharry Road, A&P Showgrounds) and industrial development (Baxter Road, Ford Road), refer map below. As mentioned earlier in the Growth Strategy, the purpose of providing infill development within existing main urban areas is to take advantage of existing services and to limit urban sprawl, while retaining residential amenity. The location of future growth areas defines the urban boundaries of Waihi by utilising the natural features of the Ohinemuri River, the Waitete Stream and the hills to the north and west. The future residential growth areas are located to the north east, north west and south west of Waihi. The areas provide a logical extension to the urban streetscape of Waihi. They adjoin existing residential areas and are relatively hazard free. Further hazard assessment will be undertaken during the District Plan change process and will determine any development constraints and propose methods to manage these. Council’s District Plan places controls on new development that aims to enhance the historic mining character of Waihi and encourage visual and physical linkages to local features such as the Pumphouse, Waitete Stream, Ohinemuri River and hills of the Coromandel range. District Plan changes to provide future areas for growth will also address concerns relating to providing connections, such as vehicular, pedestrian and open space, between existing and new urban areas, through the use of structure plans with associated requirements. The future industrial growth area is located to the south of Waihi and is separated from residential development to avoid effects on amenity. The growth area builds on existing industrial development and provides a choice of locations on both sides of the State Highway. It is also a logical infrastructure extension. It is likely one location would be developed at a time as required by demand for industrial land.

WORKING DRAFT - #2355521 24 Council Agenda - 28-03-18 Page 88

The eventual closure of the mine in Waihi will have significant effects on people, the community and businesses in Waihi and the wider area. It is difficult to plan for this event as the timing of closure is uncertain, as are the development of other mining opportunities in the area. Council initiatives such as the Economic Development Strategy address issues such as the development of tourism business opportunities which may go some way toward mitigating the effects of mining cessation. Overall these measures aim to provide for the future growth of Waihi ensuring it continues to be one of the District’s main community and business centres; specialising in mining and tourism and servicing the surrounding rural area.

WORKING DRAFT - #2355521 25 Council Agenda - 28-03-18 Page 89

WORKING DRAFT - #2355521 26 Council Agenda - 28-03-18 Page 90

Paeroa

Paeroa is located in the centre of the Hauraki District. The town was established in the 1870s and was originally a thriving port. Paeroa is now an attractive rural service centre, which is extremely busy given its central location at the junction of two State Highways. The key issues for the future development of Paeroa have been identified as follows:

x Potential conflict between an attractive and busy town centre and the safe and efficient management of state highway traffic. x Ensuring that residential amenity and character is maintained with further development. x The location of industrial uses and the interface between industrial and commercial activities along the main street (northern end), and the manner in which connections can be made between the two activities across the redundant rail line. x Managing existing flooding hazard and the potential of climate change to increase this hazard. These issues are addressed in the Growth Strategy by: promoting the residential and industrial Structure Plan Areas (residential 27.9 hectares, industrial 14.1 hectares), proposing infill residential development in suitable existing residential areas of Paeroa and identifying future growth areas for residential (SH26 west, race course), low density residential (SH26 east) and industrial development (SH2 east). Refer to map below. As mentioned earlier in the Growth Strategy, the purpose of providing infill development within existing main urban areas is to take advantage of existing services and to limit urban sprawl, while retaining residential amenity. The location of future growth areas defines the urban boundaries of Paeroa by utilising the natural features of the Ohinemuri River, the hills to the east and lower lying land to the north- west and south. The good quality soils to the north also act as a limiting factor to urban expansion in this direction. The future residential growth area has been located away from flooding hazard areas, on predominantly flat land adjacent to existing residentially zoned land, forming a logical expansion of Paeroa to the north east. Further assessment of the area will be undertaken during the District Plan change process and will determine any development constraints and propose methods to manage these. The future low density residential area is located on the edge of Paeroa and provides an alternative living choice. An indicative 500 metre buffer area has been provided to prevent new dwellings from locating too close to the existing gun club in Morrison Road. The future industrial growth area adjoins existing industrial land to the north of Paeroa and is separated from residential areas to prevent adverse effects on amenity for residents. Council’s District Plan also addresses amenity and character concerns through controls on new development. It restricts development of flood ponding areas thus avoiding the risk of damage to property. District Plan changes to provide new areas of growth will also address concerns relating to providing connections between existing and new areas of development, through the use of structure plans with associated requirements.

WORKING DRAFT - #2355521 27 Council Agenda - 28-03-18 Page 91

Council has been working with the community to upgrade Paeroa’s main street. The area in front of the Paeroa Post Office won the Civic Heart Revitalisation Award in 2010, from the NZ Institute of Landscape Architects. More recent work has included the new library and shared space completed in 2017. A roundabout at the southern end of town is being trialled over the 2016/2017 summer and discussions with NZTA regarding the State Highway are ongoing. Overall these measures provide future growth for Paeroa, to ensure it remains one of the District’s main centres. Maximising Paeroa’s central location within the District by providing administration and civic activities, substantial industrial, recreational and residential activities and recognising its importance to tangata whenua.

WORKING DRAFT - #2355521 28 Council Agenda - 28-03-18 Page 92

WORKING DRAFT - #2355521 29 Council Agenda - 28-03-18 Page 93

Ngatea

Located in the northwest of the District, Ngatea is the largest settlement on the Hauraki Plains and is a service centre for the surrounding farming area. Located on State Highway 2, it is also a busy town providing services for passing motorists. Ngatea was established in the 1900s as a result of a unique series of canals and stop banks which drained the land and produced rich farmlands for dairy production. Today Ngatea has a strong community with many groups and facilities catering for sporting, cultural and service based activities. The following key issues for the future development of Ngatea have been identified:

x Defining and managing urban boundaries in the developing southern and north western edges of town. x Providing for future light industrial/commercial expansion and development, and the implications for nearby residential neighbourhoods. x Improving the amenity and quality of the township along State Highway 2 without compromising the safety and efficiency of the state highway. x Managing river and coastal flooding hazards and the potential of climate change to increase these and other hazards. These issues are addressed in the Growth Strategy by: promoting the development of the residential Structure Plan Areas (North and South – total 41.3 hectares), and identifying a future growth area for light industrial/commercial development to the west adjoining existing industrial development, refer to map below. The future light industrial/commercial growth area has been located away from the main residential areas, and will be restricted to light industrial uses which have less impact on residential amenity. The growth area will also provide opportunities for large commercial retailers, such as a supermarket, to locate within Ngatea. Council’s District Plan addresses amenity and connection concerns through controls on new development. The residential Structure Plan areas and the light industrial future growth area provide a long term urban boundary for Ngatea and will contain urban sprawl. The Piako River forms a natural eastern boundary for the town. Further residential growth areas have not been provided, recognising the structure plan areas that are already zoned for residential use and are currently undeveloped, the constraints that natural hazards provide to residential land use, and the need to protect productive land for farming. Council has provided a streetscape project in the Long Term Plan 2018-2028 as well as a new library/community facility for Ngatea. These projects in tandem with the measures identified above, will guide and enhance the future development of Ngatea, ensuring it remains a thriving local community and service town.

WORKING DRAFT - #2355521 30 Council Agenda - 28-03-18 Page 94

WORKING DRAFT - #2355521 31 Council Agenda - 28-03-18 Page 95

Kerepehi

Kerepehi is a small township located between the Piako River and State Highway 2, on the Hauraki Plains. It has some community facilities including a school, Marae, and domain, as well as commercial and light servicing activities. Dairy farming is historically the most important industry in the area. Recently, industrial development has taken place on Hauraki Park; an industrial subdivision and food technology hub developed by the Council. The key issues for the development of Kerepehi are as follows:

x Improving the amenity and quality of the town’s interface at State Highway 2 from its current industrial character without compromising the safety and efficiency of the state highway. x Addressing the implications for residential amenity as a result of the growth of industrial uses, and the identity of the town as an industrial precinct. x Managing the flood risk in low lying areas and the potential of climate change to increase this and other hazards. These issues are addressed in the Growth Strategy by: promoting the development of the residential (North, South – total 9.2 ha) and industrial (North, South – total 23 ha) Structure Plan Areas, and identifying future growth areas for industrial development to the south and residential development to the north. The industrial growth area has been located to the south of the existing settlement adjoining existing industrial zoned land, whereas the future residential growth area has been located to the north of Kerepehi. This is to ensure separation of incompatible land uses and to protect residential amenity. Future residential land has been provided to balance the provision of industrial land and to allow for live/work/play opportunities in Kerepehi. The future residential area has also been located away from the areas of lower lying higher flood risk land making use of higher land. These measures aim to ensure a liveable and attractive residential environment for the community of Kerepehi while supporting the needs of existing and emerging industrial activities, and recognising the role that the Kerepehi Marae plays for tangata whenua.

Turua

Turua is a small community located beside the Waihou River on the Hauraki Plains. It has community facilities, including a school, and a small commercial, service and industrial centre. Turua is located close to Thames and has potential to grow to accommodate spill- over residential development from Thames. The key issues for Turua have been identified as follows:

x Managing river and coastal flooding hazards and the potential of climate change to increase these and other hazards. x The speed of traffic and vehicle priority along the main street - Hauraki Road.

WORKING DRAFT - #2355521 32 Council Agenda - 28-03-18 Page 96

These issues are addressed in the Growth Strategy by promoting the development of the residential Structure Plan Areas (A, B, C – total 20.5 ha). These areas seek to consolidate residential land use on the western side of Hauraki Road, allowing for limited expansion due to the low lying nature of surrounding land and the quality of the soils for productive purposes. Commercial and industrial land use is provided for on the eastern side of Hauraki road. No areas for future growth are provided, though the District plan does show an outlying urban boundary within which further development is possible in the very long term. These measures aim to recognise and provide for the development of the township of Turua, while managing flood hazards and the mixture of commercial, service and industrial activities in parts of the township.

14. Future Capacity Analysis

An analysis of likely maximum development within the identified growth areas of the main centres has been undertaken. The following table (Table 9) is a summary of development capacity of existing zoned greenfield land and new growth areas. This analysis is important to ensure that enough capacity is being provided to meet the expected growth of the District, over the next 30 years.

Table 9: Development Capacity

Area Existing potential New growth TOTAL greenfield area (lots) (lots) (lots) Waihi Residential 150 1,307 1,457 Low density 50 - 50 Residential Industrial 70 410 480 Commercial 67 0 67 Paeroa Residential 302 1,144 1,446 Low density 183 304 487 residential Industrial 250 150 400 Commercial 50 0 50 Ngatea Residential 414 0 414 Industrial 10 0 10 Light Industrial/ 6 75 81 Commercial

WORKING DRAFT - #2355521 33 Council Agenda - 28-03-18 Page 97

Residential Assuming one dwelling per lot and including the development of existing zoned greenfield land and likely maximum development of proposed growth areas; Waihi will have capacity for 1,457 new residential dwellings and 50 new low density residential dwellings, Paeroa 1,446 new residential dwellings and 487 new low density residential dwellings, and Ngatea 414 new residential dwellings. In total, this provides capacity for over 3,000 new residential dwellings in the District, over the next 30 years. This capacity therefore meets and exceeds the projected number of new dwellings for the District of 2,700 over the next 30 years, using the high growth scenario. Further capacity is also available from infill development, though this has not been included in this analysis as uptake is uncertain.

Commercial/Industrial Assuming one rating unit per lot and including the development of existing zoned land and likely maximum development of proposed growth areas; Waihi will have capacity for 547 new commercial/industrial units, Paeroa for 450 new commercial/industrial units, and Ngatea for 91 new commercial/industrial units. In total, this provides capacity for over 1,000 new commercial/industrial units in the District, over the next 30 years. This capacity therefore meets and exceeds the projected number of new commercial /industrial business units for the District of 330 over the next 30 years, using the high scenario.

Timing An analysis of the growth areas has been undertaken to allocate priority and timing for scheduling changes to the District Plan. This analysis has shown development in Waihi to be the highest priority and plan changes to rezone more residential and industrial land within the growth areas should be undertaken in the short term (next 1 - 5 years). The following areas are considered to necessitate plan changes over the medium term (5 - 15 years):

x Paeroa - industrial, residential, low density residential. x Ngatea - light industrial/commercial. The industrial and residential areas at Kerepehi are considered more likely to be developed in the longer term (15 - 30 years). This timing is subject to change as demand for land for development may fluctuate due to population and economic factors.

WORKING DRAFT - #2355521 34 Council Agenda - 28-03-18 Page 98

SECTION 3 - IMPLEMENTATION 15. Implementation Actions and Timeframes

The following table (Table 10) sets out the actions to implement the Growth Strategy and the likely timeframes for implementation. It also shows the areas of Council that will be responsible for implementation.

Table 10: Implementation Actions and Timeframes (Short term = 1-5 years, Medium term = 5-15 years, Long term = 15-30 years) ACTION HOW WHEN WHO @ COUNCIL 1. Promote the development of identified x By providing information to developers, current and existing greenfield residential structure plan future residents. areas at Waihi, Paeroa, Ngatea, Turua, x Through the Economic Development Strategy – to Kerepehi, and Waikino. highlight available land for development. x Through economic instruments such as the strategic Community 2. Promote the development of identified use of central government infrastructure funds or x Ongoing Services and existing greenfield industrial structure plan infrastructure funding agreements between public and Development areas at Paeroa and Kerepehi. private sector. x Collaboration with the private development sector. x Integrate and co-ordinate consenting processes to facilitate development.

3. Provide for development in identified growth x By undertaking District Plan changes to rezone land as areas. follows: o Waihi - Residential and Industrial Growth Areas. x Short term o Paeroa - Residential, Low Density Residential, x Medium term Planning & and Industrial Growth Areas. Environmental o Ngatea – Light Industrial/Commercial Growth x Medium term Services Area. o Kerepehi – Residential and Industrial Growth x Long term Areas.

WORKING DRAFT - #2355521 35 Council Agenda - 28-03-18 Page 99

ACTION HOW WHEN WHO @ COUNCIL 4. Consider providing further infill residential x By undertaking District Plan Changes such as to reduce x Short term Planning & and retirement/comprehensive development minimum lot sizes where suitable, allow minor Environmental opportunities in Waihi, Paeroa and Ngatea. residential units where suitable, lessen restrictions on Services retirement villages and comprehensive development (Ngatea), and introduce design guidelines (District wide).

5. Provide for infrastructure upgrades to x By undertaking investigations and including projects in x Ongoing ensure sufficient service provision for future the 30-year Infrastructure Strategy. Engineering demand. x By including projects in the Long Term Plan. x As required Services

6. Ensure that infrastructure costs that are x By preparing a Development Contributions Policy x Short term Engineering attributable to growth are paid for by those Services, Planning generating the demand e.g. developers & Environmental Services 7. Investigate hazard risk, including the x Undertake a cross-Council climate change and natural x Short term All departments impacts of sea level rise, rising water tables hazards adaptation programme. and coastal erosion for coastal settlements. x Update Natural Hazards Policy. x Short term

8. Mitigate effects of natural hazards on x Continue to work with WRC to actively manage the x Short term existing at risk communities, in particular the Kaiaua/Miranda Catchment and address flooding Kaiaua Coast. issues. x Undertake any identified physical works in the x Short – Kaiaua/Miranda Catchment. Medium term x Prepare a community plan for Kaiaua Coast to guide x Short term Planning & future development of the area in light of the unique Environmental environment and risk of natural hazards. Services, x Prepare a comprehensive erosion management plan for x Short term Engineering the protection of the Kaiaua coastal roading corridor Services from the sea x Undertake District Plan changes to implement x Short term requirements for risk based assessments for development in identified hazard prone areas.

WORKING DRAFT - #2355521 36 Council Agenda - 28-03-18 Page 100

ACTION HOW WHEN WHO @ COUNCIL 9. Ensure new development does not x Prepare an Environmental Strategy. x Medium term Planning & adversely affect: x Implement Environmental Strategy, including x Ongoing Environmental x Indigenous wetlands; undertaking District Plan changes where necessary to Services x Indigenous vegetation and biodiversity; improve protection of special features. x Outstanding landscapes; x Heritage sites and areas; x Productive soils; x Sites of significance to Maori; x Coastal environments x Urban residential amenity.

10. Develop community plans to build on the x Prepare community plans for Paeroa, Waihi and Ngatea x Medium term Planning & comparative advantages of local areas, Environmental strengthen local economies, local place Services uniqueness and branding.

11. Plan for changing community needs x Implement Council’s Social Strategy Towards 2048 x Short - Long Community including the requirements of an ageing term Services and population Development

12. Ensure the Hauraki Growth Strategy is x Undertake a 5 yearly review of the Growth Strategy. x Medium term Planning & regularly reviewed and can be updated as x Undertake a review of the Growth Strategy if demand x As required Environmental required to respond to changes in demand. exceeds that planned for in the Strategy. Services

WORKING DRAFT - #2355521 37 Council Agenda - 28-03-18 Page 101

ATTACHMENTS A. Bibliography

2017 Demographic Projections – Rationale Ltd 2017 (2197292, 2197813, 2198555). Hauraki District Council (HDC) An Overview of Natural Hazards in the Hauraki District Including a qualitative risk assessment, WRC, 2007 Census 2013. Statistics NZ Coastal Hazards and Climate Change: Guidance for Local Government. Ministry for the Environment, Dec 2017 Economic Development Strategy – Toward 2025. HDC Franklin District Plan 2000. HDC Growth Projections Summary 2018-48 (2217961). HDC Hauraki District Plan 2014. HDC Ministry for Environment Research to support guidance on Future Development Strategies. BECA, June 2017 National Policy Statement on Urban Development Capacity 2016. Ministry for the Environment. National Policy Statement on Urban Development Capacity: Responsive Planning - Guide on producing a Future Development Strategy. Ministry for the Environment, 2017. New Zealand Coastal Policy Statement 2010, Ministry for the Environment Social Strategy - Toward 2028. HDC Waikato Plan. Waikato Plan Joint Committee, 2017 Waikato Regional Policy Statement 2016. WRC Websites - Go Waihi (www.wahi.org.nz), Positively Paeroa (www.paeroa.org.nz), Hauraki Plains (www.haurakiplains.co.nz), HDC www.hauraki-dc.govt.nz

WORKING DRAFT - #2355521 38 Council Agenda - 28-03-18 Page 102

B. Extract from WRC Risk Assessment

WORKING DRAFT - #2355521 39 Council Agenda - 28-03-18 Page 103

Source: An Overview of Natural Hazards in the Hauraki District, pg. 28, 44 Doc#1060692, WRC

WORKING DRAFT - #2355521 40 Council Agenda - 28-03-18 Page 104



 ,QIRUPDWLRQ5HSRUW 7R 0D\RUDQG&RXQFLOORUV

)URP &KLHI([HFXWLYH

'DWH :HGQHVGD\0DUFK 'RFXPHQW  )LOHUHIHUHQFH $SSHQGL[$  0HHWLQJGDWH 0DUFK

6XEMHFW &KLHI([HFXWLYHV0RQWKO\5HSRUW±0DUFK  5HFRPPHQGDWLRQ  7+$7WKHUHSRUWEHUHFHLYHG     6WDII  ,WKDVEHHQDTXLHWPRQWKIRUUHFUXLWPHQW-DQH%HDUGKDVEHHQRIIHUHGDSHUPDQHQWSDUW WLPHUROHDV(QYLURQPHQWDO+HDOWK2IILFHU-DQHKDGZRUNHGLQWKLVUROHIRUDIL[HGWHUPEXW ZLOOQRZEHSHUPDQHQW  :HKDYHUHFHLYHGDUHVLJQDWLRQIURP-DFNVRQ*UHHQZHOOZKRKDVEHHQD3ODQQHUZLWKXVIRU WKHSDVWPRQWKV-DFNVRQZLOOEHKHDGLQJRYHUVHDVIRUDZKLOH  :HKDYHDOVRUHFHLYHGDUHVLJQDWLRQIURP5XVVHOO%LHUUH5XVVHOOKDVEHHQHPSOR\HGZLWK &RXQFLOIRU\HDUVDQGLVFXUUHQWO\LQWKHUROHRI5HJXODWRU\6HUYLFHV0DQDJHU+HZLOOEH UHWLULQJLQ-XO\    /*1=$*05HPLW3URFHVV  $WWDFKHG $SSHQGL[$ IRU0HPEHUV,QIRUPDWLRQLVD0HPRIURP/*1=RXWOLQLQJWKHSURFHVV IRUDXWKRULWLHVVKRXOGWKH\ZLVKWRVXEPLWDUHPLWIRUFRQVLGHUDWLRQDWWKH/*1=$*0RQ -XO\7KH\QHHGWREHVXEPLWWHGE\0D\        /DQJOH\&DYHUV &KLHI([HFXWLYH 

3DJHRI Council Agenda - 28-03-18 Page 105

Date: 6 March 2018 To: Mayors, Chairs and Chief Executives From: Malcolm Alexander, Chief Executive, Local Government New Zealand Subject: 2018 Annual General Meeting Remit Process

We invite member authorities wishing to submit proposed remits for consideration at the Local Government New Zealand Annual General Meeting (AGM) to be held on Sunday 15 July 2018 in Christchurch, to do so no later than 5pm, Monday 21 May 2018. Notice is being provided now to allow members of zones and sectors to gain the required support necessary for their remit (see point 3 below). The supporting councils do not have to come from the proposing council's zone or sector.

Proposed remits should be sent with the attached form. The full remit policy can be downloaded from the LGNZ website.

Remit policy Proposed remits, other than those relating to the internal governance and constitution of Local Government New Zealand, should address only major strategic “issues of the moment”. They should have a national focus articulating a major interest or concern at the national political level.

The criteria for considering remits were reviewed in March 1999 and National Council adopted the following Remits Screening Policy: 1. Remits must be relevant to local government as a whole rather than exclusively relevant to a single zone or sector group or an individual council; 2. Remits should be of a major policy nature (constitutional and substantive policy) rather than matters that can be dealt with by administrative action; 3. Remits must have formal support from at least one zone or sector group meeting, or five councils, prior to their being submitted, in order for the proposer to assess support and clarity of the proposal; 4. Remits defeated at the AGM in two successive years will not be permitted to go forward; 5. Remits will be assessed to determine whether the matters raised can be actioned by alternative, and equally valid, means to achieve the desired outcome; 6. Remits that deal with issues or matters currently being actioned by Local Government New Zealand may also be declined on the grounds that the matters raised are “in-hand”. This does not include remits that deal with the same issue but from a different point of view; and 7. Remits must be accompanied by background information and research to show that the matter warrants consideration by delegates. Such background should demonstrate the: x nature of the issue; x background to it being raised;

3 Council Agenda - 28-03-18 Page 106

x issue’s relationship, if any, to the current Local Government New Zealand Business Plan and its objectives; x level of work, if any, already undertaken on the issue by the proposer, and outcomes to date; x resolution, outcome and comments of any zone or sector meetings which have discussed the issue; and x suggested actions that could be taken by Local Government New Zealand should the remit be adopted.

Remit process Local Government New Zealand will take the following steps to finalise remits for the 2017 AGM: x all proposed remits and accompanying information must be forwarded to Local Government New Zealand no later than 5pm, Monday 21 May 2018, to allow time for the remits committee to properly assess remits; x a remit screening committee (comprising the President, Vice President and Chief Executive) will review and assess proposed remits against the criteria described in the above policy; x prior to their assessment meeting, the remit screening committee will receive analysis from the Local Government New Zealand staff on each remit assessing each remit against the criteria outlined in the above policy; x proposed remits that fail to meet specified criteria will be informed as soon as practicable of the committee’s decision, alternative actions available, and the reasons behind the decision; x proposers whose remits meet the criteria will be contacted as soon as practicable to arrange the logistics of presenting the remit to the AGM; and x all accepted remits will be posted to the Local Government New Zealand website at least one month prior to the AGM.

To ensure quality preparation for members’ consideration at the AGM, the committee will not consider or take forward proposed remits that do not meet this policy, or are received after 5pm, Monday 21 May 2018.

General Remits discussed at the AGM will be presented in the AGM Business Papers that will be distributed to delegates not later than two weeks before the AGM, as required by the Rules.

Should you require further clarification of the requirements regarding the remit process please contact Leanne Brockelbank on 04 924 1212 or [email protected]. Council Agenda - 28-03-18 Page 107

Information Report

To: Council

From: Group Manager Corporate Services

Date: Thursday, 22 March 2018

File reference: Document: 2351484

Meeting date: Wednesday, 28 March 2018 Financial Report for the period to Subject: 28 February 2018

Recommendation:

THAT the report be received.

Summary

The attached report shows the financial results of Council’s activities for the eight months to 28 February 2018.

Council Agenda - 28-03-18 Page 108

Summary for the 8 months ending 28/02/2018

YTD YTD % of YTD YTD Annual Actual Budget Budget Variance Budget ($ 000's) ($ 000's) ($ 000's) ($ 000's)

Expenditure Leadership 1,838 1,869 98.3% 31 3,097 Networks 13,204 12,888 102.5% (316) 19,623 Community 4,219 3,884 108.6% (335) 5,892 Services Community 1,471 1,319 111.5% (152) 2,101 Development Regulatory 2,647 2,438 108.6% (209) 3,667 Total Cost of 23,379 22,398 104.4% (981) 34,380 Service

Less Revenue Leadership (2) 0 0.0% 2 0 Networks (2,717) (2,650) 102.5% 67 (3,885) Community (398) (402) 99.0% (4) (604) Services Community (37) 0 0.0% 37 0 Development Regulatory (1,081) (1,123) 96.3% (42) (1,543) Total Revenue (4,235) (4,175) 101.4% 60 (6,032)

Net Cost of 19,144 18,223 105.1% (921) 28,348 Service

Activity Expenditure v. Budget ($000’s) Seven months to February 2018 14,000

12,000

10,000

8,000 Actual 6,000 Budget YTD

4,000

2,000

0 Leadership Networks Community Community Regulatory Services Development

Council Agenda - 28-03-18 Page 109

Operating Overview:

For the eight months to February, the Net Cost of Service is $921,000 more than budget. Expenses exceed the budget by $981,000. The over-expenditure is across a range of activities. Income is $60,000 higher than expected as a result of higher Roading subsidy claims and Wastewater income.

Details of the various activities shown in Appendix A

Balance Sheet Overview

Following are some Key Financial Indicators as at 28 February 2018:

Cash on hand Jan Feb BNZ $0.0m $2.6m Westpac $0.7m $0.0m

Available Credit Facility BNZ $7.0m $7.0m

Fixed term investment Westpac $3.5m $5.5m BNZ $0.0m $0.0m

Total Available Funds $11.2m $15.1m

Borrowing LGFA (long term borrowing) $38.0m $38.0m LGFA (short term borrowing) $ 0.0m $ 0.0m BNZ (short term borrowing) $ 0.0m $ 0.0m Total $38.0m $38.0m

Council’s cash flows should be more consistent than previous years, due to now having four quarterly instalments, rather than the three unevenly spaced instalments of the past.

Excess money from the February rates instalment has been invested with Westpac in a fixed term deposit to maximise the interest benefit.

Debtors Water Rates Property Rates Jan Feb Jan Feb Current $0.6m $1.0m $0.6m $2.1m Arrears $0.2m $0.3m $1.0m $0.9m Total $0.8m $1.3m $1.6m $3.0m

Water balances are consistent with previous years.

Property rates arrears balances only reduced by around $100,000 in February. The current rates balance increased with the third instalment being posted to the ledger.

Duncan Peddie GROUP MANAGER CORPORATE SERVICES

Council Agenda - 28-03-18 Page 110

Appendix A

Summary of Leadership for the 8 months ending 28/02/2018 YTD YTD % of YTD YTD Annual Actual Budget Budget Variance Budget ($ 000's) ($ 000's) ($ 000's) ($ 000's) adership Expenditure Democracy 1,359 1,367 99.4% 8 2,101 Iwi Liaison 1 28 48 57.2% 21 72 Policy Development 452 454 99.5% 2 923 Total Cost of Service 1,838 1,869 98.3% 31 3,097

Less Revenue Democracy (1) 0 0% 10 Policy Development (1) 0 0% 10 Total Revenue (2) 0 0.0% 2 0

NET COST OF SERVICE 1,836 1,869 98.2% 33 3,097

Notes to Report: 1 Forum and partnership meetings have been deferred due to Iwi focus on their Treaty of Waitangi settlement processes.

Council Agenda - 28-03-18 Page 111

Summary of Networks for the 8 months ending 28/02/2018 YTD YTD % of YTD YTD Annual Actual Budget Budget Variance Budget ($ 000's) ($ 000's) ($ 000's) ($ 000's) etworks Expenditure Land Drainage 2 431 612 70.4% 181 1,025 Roading 3 6,119 5,550 110.2% (569) 8,152 Solid Waste 4 349 332 105.2% (17) 547 Stormwater 5 518 513 100.9% (5) 785 Wastewater 6 1,810 2,036 88.9% 226 3,187 Water 7 3,976 3,843 103.5% (133) 5,926 Total Cost of Service 13,204 12,888 102.5% (316) 19,623

Less Revenue Roading (2,379) (2,341) 101.6% 38 (3,511) Solid Waste (56) (55) 101.3% 1 (83) Storm water 0 0 0.0% 0 0 Wastewater (277) (254) 109.0% 23 (291) Water (5) 0 0.0% 5 0 Total Revenue (2,717) (2,650) 102.5% 67 (3,885)

NET COST OF SERVICE 10,486 10,237 102.4% (249) 15,738

Notes to Report: 2 Less spraying has been completed due to weather conditions not favouring spray application. Less reactive repairs/ inspections required. 3 Professional Services is overspent due to Increase in workload required to address works previously deferred, as well as building processes to improve the service. The extremely wet winter resulted in deteriorated road surface that needed more repairs than originally forecast. The costs from the August and September slips was estimated to exceed the budget for the Emergency Works part of 'Other Subsidised' by a large margin. 4 Removal of waste from the transfer station to landfill more than budget. 5 Due to wet season, there have been additional repairs required to the network. 6 Routine maintenance and Inspections are delayed due to the inclement weather. It is expected that the maintenance will still be carried out before year end. The Allied Faxi plant at Kerepehi produced less waste than anticipated and thus less treatment was required. 7 Weather events caused damage to the network that had to be repaired. Additional chemicals were used due to increased turbidity at the Kerepehi Intake as the rain caused raw water in catchment area to be of poor quality.

Council Agenda - 28-03-18 Page 112

Summary of Community Services for the 8 months ending 28/02/2018

YTD YTD % of YTD YTD Annual Actual Budget Budget Variance Budget ($ 000's) ($ 000's) ($ 000's) ($ 000's) ommunity Services Expenditure Community Facilities 8 1,242 1,127 110.2% (115) 1,771 Recreation 9 2,977 2,757 108.0% (220) 4,121 Total Cost of Service 4,219 3,884 108.6% (335) 5,892

Less Revenue Community Facilities (309) (313) 98.8% (4) (469) Recreation (89) (90) 99.3% (1) (134) Total Revenue (398) (402) 98.9% (4) (604)

NET COST OF SERVICE 3,821 3,482 109.7% (339) 5,288

Notes to Report: 8 A number of other unbudgeted repair projects have been carried out such as: the removal and replanting of trees at Waihi cemetery, repairs to tombstones / graves at Pukerimu Cemetery, and clearing out stockpiled green waste and concrete at the Paeroa and Waihi cemeteries. Planting of new ashes garden was not in budget. Council has engaged APR to complete a pensioner housing strategy per Council instruction. Painting of Paeroa pension units commited ($64k) against no budget. 9 Represents the cost of modifications needed to playgrounds around the district identified in a recent health and safety audit. Weather events required remedial work to be carried out in Kaiaua which was not included in the budget.

Summary of Community Development for the 8 months ending 28/02/2018

YTD YTD % of YTD YTD Annual Actual Budget Budget Variance Budget ($ 000's) ($ 000's) ($ 000's) ($ 000's) ommunity Development Expenditure Community Growth 10 595 628 94.7% 33 1,039 Community Initiatives 11 875 690 126.8% (185) 1,061 Total Cost of Service 1,471 1,319 111.5% (152) 2,101

Less Revenue Community Growth 0 0 0.0% 0 0 Community Initiatives (37) 0 0.0% 37 0 Total Revenue (37) 0 0.0% 37 0

NET COST OF SERVICE 1,433 1,319 108.7% (114) 2,101

Notes to Report: 10 No suitable Development Assistance projects have been put forward to support yet. This may potentially change end of March.

11 Additional grants have been paid to fund council's share of projects that MBIE are part funding.

Council's funding agreement with HRTCT also changed to allow for funding for increased operating costs of the trust.

Council Agenda - 28-03-18 Page 113

Summary of Regulatory for the 8 months ending 28/02/2018

YTD YTD % of YTD YTD Annual Actual Budget Budget Variance Budget ($ 000's) ($ 000's) ($ 000's) ($ 000's) egulatory Expenditure Animal Control 12 350 322 108.7% (28) 482 Building Services 13 923 824 112.0% (99) 1,243 Community Protection 14 688 607 113.3% (81) 912 RMA Implementation 687 686 100.1% (1) 1,029 Total Cost of Service 2,647 2,438 108.6% (209) 3,667

Less Revenue Animal Control (304) (285) 106.6% 19 (287) Building Services 15 (454) (417) 108.9% 37 (625) Community Protection (51) (71) 72.8% (19) (106) RMA Implementation 16 (272) (350) 77.8% (78) (525) Total Revenue (1,081) (1,123) 96.3% (41) (1,543)

NET COST OF SERVICE 1,566 1,316 119.0% (250) 2,124

Notes to Report: 12 Final 16/17 Animal Control invoice was not processed until July. 13 IANZ BCA audit and accreditation fees ($33k) and WLASS ($34k) were more than was budgeted for. External contractors used to cover consent and inspection work. 14 Emergency management is $129k more than budget due to recent events. This is offset against savings in Rural fires. 15 Building Consent activity continues to be high. 16 LIM and subdevision applications are lower than expected for the year.

Council Agenda - 28-03-18 Page 114

Information Report

To: Mayor and Councillors

From: Group Manager Planning and Environmental Services

Date: Thursday, 1 March 2018

File reference: Doc: M 2352108

Portfolio Holder: Paul Milner

Meeting date: Wednesday, 28 March 2018

Planning and Environmental Services Monthly Report – Subject: February 2018

Recommendation:

THAT the report be received;

Summary

This month has seen work continue on the drafting and auditing of the LTP documentation and systems. LTP community consultation timetable is available. Work has continued on the District Growth Strategy to support future District Plan Changes and other planning. The District Plan Committee have considered a number of potential Plan Change reports and there is an update on the Waihi Mine projects.

Customer Services Team

Customer Services had a quieter month this month with 3915 calls offered to the Contact Centre. This was 8% lower than forecast. Unplanned and planned leave impacted on our ability to deliver services to target.

Our Service Level was 78.38% (target 80%)and abandonment rate 6.33% (target <6%) Building continues to be the main driver of our inbound calls with some 29% or enquiries being Building related, followed by Rates and Planning at 7% each.

The Customer Service Manager recently ordered a “pre audit” report from CRM Consulting. This is a pre cursor report to the CRM Awards programme which runs later in the year. It is a mystery shopping exercise in which the researchers engage with us by both phone and email. The Customer Service Manager is eagerly awaiting our results in order to identify areas in which we can “raise the bar” with our service offering.

Development

28th February 2018

1 Council Agenda - 28-03-18 Page 115

Consents Issued 2016/17 2017/18 Year to date

Building Consents 268 263 98%

Subdivisions 45 39 87% Land Use 66 72 109% Designations - - -% Objections 2 4 200% Certificates of Compliance - - -% Variations 8 14 175% Outline Plans - - -% Right of Ways 2 - -% Extension of Time - 1 100% Permitted Boundary Activity Certificates - 3 300% 123 133 108%

LIMs 341 249 73%

Consent activity is being maintained with only a slight decrease from this time last year activity numbers; except for the reduction in LIMs.

Regulatory Services Team

Planning Implementation

Processing

For last two months 8 subdivision and 12 landuse resource consent applications were received and to date over that period all resource consents except one were processed within the statutory timeframe of 20 working days.

District Plan Review

The District Plan Committee workshop on the 14 March presented possible subdivision rule plan changes; a draft District Growth Strategy and possible zone changes. The Rule Plan changes will be refined further by the Committee before it can come before Council with a recommendation to start the formal Plan Change process. The draft Growth Strategy will be placed before Council for comment before it starts its public and key stakeholder consultation process. More work is required on the possible rezoning options to be placed before the Committee particularly in relation to Infrastructure impacts of the proposed new zones.

Ministry for Environment Update

MfE officials are working with ministers to get clarity on National Direction priorities, and hope to be able to release an updated forward agenda by mid-2018. In the interim they can advise the following:

x Work on the National Planning Standards is continuing, with consultation on the first set of standards planned for May this year (more below). x MfE is continuing to support councils with implementation of the National Policy Statement (NPS) for Urban Development Capacity. Council Agenda - 28-03-18 Page 116

x The Government is moving to strengthen standards for water quality through amendments to the NPS for Freshwater Management. x The Biodiversity Collaborative Group is continuing with its work on the NPS for Indigenous Biodiversity and complementary measures. The group is working towards making recommendations to Government in September 2018. In 2017, the group scanned issues and opportunities for biodiversity management, and over the next few months will be starting to form positions for their policy recommendations. The group is currently establishing a reference group of territorial authorities to test its policy thinking, and to ensure the NPS is practical. x Phase 1 of the Drinking Water National Environmental Standard (NES) Review (assessing implementation) is nearing completion. Phase 2 will focus on assessing the effectiveness of the regulations, taking into account the findings and recommendations of the Government Inquiry into Havelock North Drinking Water.

MfE staff are looking at the remainder of the National Direction programme, including the timing and sequencing of the proposed work.

Building Team

Processing

For the last two months Council granted 32 Building Consent applications with 7 new dwellings last month and all were processed within the statutory timeframe.

Of those 32 applications 4 consents did not require further information requests.

General

Dog Control

Dog Control officers undertook 300 rural property inspections across the District to find unregistered dogs.

Strategic Planning

2018-28 Long Term Plan

Staff’s focus has continued to be on the completion and audit of the LTP consultation document ‘we need to talk’ and supporting information. At the time of writing, the adopted documents are in the process of being printed and consultation promotion organised. A consultation information package is being distributed to elected members separately.

The timetable for Council for the remaining LTP process is:

Consultation period. Most feedback opportunities close Monday 30 23 March to end April April except for the opportunity to speak at a Council hearing in May. 16-17 May Informal hearing followed by deliberation and decision-making

June Final audit (Dates to be confirmed)

27 June LTP presented to the Council for adoption

26 July All decisions communicated and LTP available

Council Agenda - 28-03-18 Page 117

Communications

The Communications Officer has continued to work with the strategic planning team on the Long Term Plan community engagement. A dedicated LTP website using the new brand has now been developed https://weneedtotalk.hauraki-dc.govt.nz (go live date 23 March) and will be the go-to site for all things LTP during the consultation period. We have also worked with Emotive Ltd to create four videos to help deliver our key messages online and encourage people to join the LTP conversation. The refreshed brand design has now been launched and is in the process of being implemented. The brand was introduced to staff via a series of morning tea events at our various depots and offices and received a very positive reception. Comments included excitement that we will now look more professional like a `real’ Council. Another field staff member offered to model the new branded PPE for us if needed! A full implementation plan and budget is still being developed and will be included in the next Communications Working Party update to Council. Part of the implementation includes updating all electronic forms and letter templates which can be done concurrently the content/wording review of these items currently underway as part of `red carpet’ project in the communications strategy. Another part of the implementation involves staff training, which will also be done concurrently with the staff communication training project in the communications strategy.

Brand refresh key facts:

x The Council has refreshed its logo and brand design so it is more consistent and modern. x Keeping costs low is a high priority x This is a brand `refresh’ not a full rebrand. The existing logo and design has been modernised not redesigned. x The total investment for the finalised design was less than $2000 x In general, the refreshed logo and design will be rolled out in a staged process as things would have been replaced anyway, so there will be minimal extra cost. For example, business cards won’t be replaced with the new design until the old cards run out. x There will be a transition period from the old brand to the refreshed brand where both designs will be in use, but it’s expected the refreshed brand will be fully implemented within 12 – 18 months. Other projects include working with the Hauraki Rail Trail Trust and Economic Development team on a marketing plan to attract more business alongside the trail, working with the water services team to develop an emergency response communication plan, and working through communications policy and processes as per the communications strategy.

Mangrove Management Bill

The Hauraki District Council resolved to co-sponsor the Local Bill “The Thames-Coromandel and Hauraki District Council Mangrove Management Bill” and this Scott Simpson is, the Coromandel MP, is project sponsor for this.

The Bill was referred to the Governance and Administration select committee for consideration and it met in Thames on Friday 16 March to hear submissions from submitters in the upper North island. The Mayor spoke to the submission and was supported by the Group Manager: Planning and Environmental Services. A number of submissions were opposed to the Bill on the basis that it was overriding the RMA.

The Mayor responded to submissions from Select Committee members giving a balanced view of environmental protections and the ability remove mangroves using a consultative management plan.

Mining Matters

Extended Martha Mine Area (EMMA) consent

Council Agenda - 28-03-18 Page 118

Staff have been working with Oceana Gold on possible variations to the EMMA consent to achieve consistency between the consent conditions and the standards and the Operative District Plan. The EMMA consent expires in 2019 and, at that stage, its conditions will become permitted activities in the District Plan. It is therefore important that there are consistent provisions between the consent and the Plan. Staff have reviewed 3 drafts of the proposal and comments have been provided back to the Company.

The application is expected to be lodged in the near future.

Application for a crest raise on Tailings Storage Facility 2 (TSF 2)

An application for a 5 metre crest raise on TSF 2 has been received and is currently being reviewed by staff for completeness. The Company has advised that on currently consented projects there is enough ore to allow mining until towards the end of 2019. This small crest raise would allow mining to continue until that time and would allow additional storage for mining to continue past that point if further reserves are found.

The Council has appointed Alan Watson as independent Commissioner to consider and decide on the notification status of this application and on the application decision.

Correnso/Supa public meeting

Conditions 62 (Correnso) and 32 (SUPA) require that a public meeting be held every six months where the Company is to report on: x A description of the mining activities that have been undertaken since the last meeting x A summary of the relevant environmental monitoring results x Progress on the property purchase programme x Progress on any matters raised at the preceding meeting

The Company is also required to receive feedback from the meeting on progress and activities on the above matters.

The meeting was held on Thursday 15 March at the education centre and the attendance at the meeting was larger than in recent meetings. The Company met its reporting listed above requirements and received good feedback from attendees.

The Company advised at the meeting that it is in the process of compiling a property divestment strategy that will ensure that, when the time comes for divestment, it will be undertaken in a socially and economically responsible manner that will not see the property market flooded. At the time of the meeting the Company owned 122 residential properties.

Pit Peer Review report for 2016/17

The Pit Peer Review report for 2016/17 has been received and had an initial review by staff. This is the first annual report from the new Pit Peer Reviewer, Dr Phil Dight.

The report has been referred to Dr Peter Fuller for review. Once this review is received I will report further to Council.

Dewatering and Ground Settlement Report for 2017

All the current consents in Waihi are required to report on dewatering and ground settlement and these requirements are covered by an annual omnibus report that is submitted to the Councils. Staff have reviewed the 2017 report and it was also referred to Dr Fuller for his review and comment. He advises that it complies with the various Consents covering these matters. As such, from his perspective, there are no issues that need to be followed up with the Company.

Coeur Gold – Annual site visit

Council Agenda - 28-03-18 Page 119

On Tuesday 6 March staff from HDC and WRC met with representatives of Coeur Gold to discuss matters relating to the Coeur Gold site and what is proposed for the following year.

The frittering on the sides of the sinkhole, which appeared in 2013, has slowed and maybe has settled. The Company wishes to monitor the sinkhole for a further year prior to investigating options for remediation. The Councils emphasised that the sinkhole will be required to be remediated in due course.

The linear slumping above the sinkhole has not changed since the report provided to the Councils in May 2017.

The landslip at the site continues to be monitored and between 70-90 o the horizontal drains holes continue to dewater the slip. A number of these have been cleaned and the water flows have improved markedly. Monitoring of the slip indicates very little movement. The next report on the slip is due in December 2018.

While not HDC issues the Company advised that water quality monitoring was showing positive trends but the target levels will not be met for a number of years.

Peter Thom Group Manager: Planning and Environmental Services Council Agenda - 28-03-18 Page 120

MONITORING REPORT

Publication of the Annual Report The last Annual Report for 2016/17 was adopted on 25 That the Annual October 2017. Report is completed, audited and adopted by Council by 31st October, each year.

Special Consultative Procedure This has been undertaken as required with all Council Plans; That all issues subject Policies and Bylaws. At the time of writing, the joint sub-regional to a special review of the Waste Minimisation and Management Plan is consultative procedure currently being consulted on in the form of the special consultative meet the requirements procedure. of the Local Government Act, 2002.

Resource Consents & LIMs

Target Progress towards success

All notified resource consents 1 July 2017 to 28 February 2018 applications are decided and issued Notified Consents to the end of February 2018 within statutory timeframes. 99% of all notified In time 1 Out of time 0 (Limited Notified) resource consent applications are decided and issued within 70 working days.

All non-notified 1 July 2017 – 28 February 2018

resource consent applications are Total 133 In time 131 98% Out of time 2 2% decided and issued

within statutory Land Use 72 In Time 71 98% Out of time 1 2 % timeframes. Subdivision 39 In Time 38 97% Out of time 1 3 % All non-notified consent decisions, not Other requiring a hearing, are Misc/Desig 3 In Time 3 100% Out of time 0 - % issued within 20 Variations 14 In Time 14 100% Out of time 0 - % Objections 4 In Time 4 100% Out of time 0 - % working days. Ext. of time 1 In Time 1 100% Out of time 0 - %

Page 7 of 9

Council Agenda - 28-03-18 Page 121

Issue building YTD YTD consents within Feb-17 2016/17 Feb-18 2017/18 statutory No. of Consents 27 268 32 263 timeframes. % in time 100% 100%

100% of all New Houses building consents Paeroa 15 16 are issued within Waihi 70 43 statutory Plains 22 20 timeframes - 20 TOTAL 107 79 working days

Number of BC Processed

60 50 40 30 20 No. of BC's 10 0

Month 2016/17 '2017/18

2017/18 Average Processing Time of BC's

20.00 18.00 16.00 14.00 12.00 10.00 8.00 6.00 Numberof Days 4.00 2.00 0.00 123456789101112 2016/17 2017/18 Month

Page 8 of 9

Council Agenda - 28-03-18 Page 122

All LIMs are issued YTD YTD within Feb-17 2016/17 Feb-18 2017/18 statutory No. of timeframes LIMs 51 341 39 249 % in time 100% 100%

All LIMS are LIMs by Ward issued within Paeroa 95 74 10 working Waihi 166 101 days Plains 80 74

TOTAL 341 249

# LIMS %in time Avg # LIMS %in time % Avg 2016/17 2016/17 Processing 2017/18 2017/18 Overtime Processing July 42 100% 7 20 100% 0% 5.2 August 54 100% 7.7 33 100% 0% 5.7 September 39 100% 7.1 33 100% 0% 6.5 October 38 100% 6.1 34 100% 0% 6.7 November 39 100% 6.6 39 92% 8% 7.1 December 46 100% 6 23 100% 0% 5.4 January 32 100% 4.9 28 100% 0% 5 February 51 100% 7.2 39 100% 0% 5.6 March 46 98% 6.6 April 29 100% 6.5 May 52 100% 6.6 June 41 100% 5.9 TOTAL 509 99% 6.51 249 99% 1% 5.90

LIMS Processed

60

50

40

30 No. of LIMS 20

10

0

Month

2016/17 2017/18

Page 9 of 9

Council Agenda - 28-03-18 Page 123

Information Report

To: Mayor and Councillors

From: Transport Manager

Date: Tuesday, 13 March 2018

File reference: 2356472

Portfolio holder: Councillor Adams

Meeting date: Wednesday, 28 March 2018

Subject: Transport Report February 2018

Recommendation:

THAT the report be received

1. Introduction

This report provides the latest information on the Hauraki District Council’s Roading activities for the period ending 28 February 2018.

2. Discussion

2.1 Capital Projects 2.1.1 Key Capital Project Achievements

Table 1 shows the progress on the main capital projects scheduled for the 2017/18 financial year.

Table 1: Main Capital Projects – 2017/18

Progress Project and Description % Comments / explanations (if off track) complete Preseal repairs completed. Target for Reseal Contract 50% reseals in 2017/18 is 30km (5.7%). Construction commenced in February Area Wide Treatment – Waihi Beach Rd 75% 2018. Area Wide Treatment – Hauraki Rd, Turua 100% Completed and final claim submitted. Road Widening - Bradford St, Waihi 100% Complete. Two tenders received in early March LED Streetlight Renewals 45% 2018. Physical works completed. Final report from geotechnical consultant outstanding. Torehape Rd West Slip 95% Retrospective resource consent to be done.

Page 1 of 4

Council Agenda - 28-03-18 Page 124

Progress Project and Description % Comments / explanations (if off track) complete Resolution obtained to choose the Rahu Rd Embankment Failure 45% retaining wall remedial option and to progress with detail design. Draft Geotechnical Report indicates that work on the abutments are not Hopai West Bridge Repair 25% recommended but that bridge deck stabilisation measures should be investigated. Reduction to one lane implemented. Gerrand Rd Embankment Failure 100% Embankment failure to be monitored for a year. Project selection meetings with Wards Non-subsidized works 2017/18 15% completed. Final project selection packages being completed. Netherton school parking 100% Construction completed. Re-alignment option in principle agreed. Mahuta Rd North Underslip 15% Formal options report received and is currently being reviewed internally.

Progress Key: ..... = Off track / behind schedule / over budget ..... = Rescheduled ..... = Off track but will be back on track soon ..... = On track ... . = Completed

Minor projects updates are as follows: x Paeroa Kindy drop-off zone and speed bumps. Four contractors were asked to quote but only one quote, for $23k, was received to date. Another contractor has verbally indicated that they will submit a quote and a price of $9k was indicated. The formal quote is however still outstanding. x Waihi East Primary school project to commence in April 2018 during the school holidays. A Site Instruction for the installation of signage has been submitted to the Maintenance Contractor.

2.1.2 Key Capital Projects Planned for March 2018

The work scheduled for March 2018 is shown in Table 2 below and the Capital Works Programme is shown in Appendix A.

Table 2: Capital Work Programme for March 2018

Project Ward Comments

LED Streetlight District Tender Evaluation to be submitted to Council in March 2018. Renewals A geotechnical report from Tonkin &Taylor is expected in March Torehape Rd West Slip Plains 2018. Rahu Rd Embankment Paeroa Detail design of the retaining option to commence in March 2018. Failure Geotechnical report received with initial recommendations. Hopai West Bridge Plains Options report due towards end of March 2018. The programme Repair of works will be fixed once a design option is selected. New Footpaths and Kerb All Project selection packages to be finalised in March 2018. & Channel wards Area Wide Treatment – Waihi Construction to be completed in March 2018 Waihi Beach Rd

Page 2 of 4

Council Agenda - 28-03-18 Page 125

Area Wide Treatment – Plains Final claim to be done in March 2018. Hauraki Rd, Turua Continue with reseals in Paeroa ward (April 2018). Pre-seal All repairs for 2018/19 to continue in March. Not all the pre-seal Reseal Contract 17/18 wards repairs for 2018/19 will be completed in the current financial year due to budget constraints.

2.1.3 Key Issues and Risks

The following risks associated with the capital programme have been identified.

Table 3 – Capital Programme Risks Budget Issue or Risk Mitigation Measures implications Speed limits and load restrictions in place. Failure of the Hopai West Bridge Medium Monitoring the situation continues.

3. Conclusion

All major projects are progressing.

Gene Thomsen Transport Manager

Page 3 of 4

Council Agenda - 28-03-18 Page 126

Appendix A

Capital Works Programme

Aug Sep Oct Nov Dec Jan Feb March April May June Project 2017 2017 2017 2017 2017 2018 2018 2018 2018 2018 2018 Reseal Contract Area Wide Treatment – Waihi Beach Rd Area Wide Treatment – Hauraki Rd, Turua Road Widening - Bradford St, Waihi LED Streetlight Renewals Torehape Rd West Slip Rahu Rd Embankment Failure Hopai West Bridge Repair Unsubsidised Footpath and K+C

Page 4 of 4

Council Agenda - 28-03-18 Page 127

 'HFLVLRQ5HSRUW  7R 0D\RUDQG&RXQFLOORUV

)URP :DWHU6HUYLFHV0DQDJHU

'DWH :HGQHVGD\0DUFK 'RFXPHQW $SSHQGL[$ )LOHUHIHUHQFH $SSHQGL[%  $SSHQGL[&  3RUWIROLRKROGHU &RXQFLOORU+DUULV

0HHWLQJGDWH :HGQHVGD\0DUFK

6XEMHFW :DWHU6HUYLFHV0RQWKO\$FWLYLW\5HSRUW±)HEUXDU\  5HFRPPHQGDWLRQ  7+$7WKHUHSRUWEHUHFHLYHG  7KDWWKHUHSODFHPHQWRIWKHVWRUPZDWHUSLSHLQWKHYLFLQLW\RI:LOORXJKE\3DHURDEHVXSSRUWHG DQGWKDWEHPDGHDYDLODEOHIRUWKLVSURMHFWIURPWKH3DHURD6WRUPZDWHU)XQG     6XPPDU\  7KLVUHSRUWVXPPDULVHVSHUIRUPDQFHDQGLVVXHVLQWKH:DWHU6HUYLFHVZRUNDUHD7KHERG\RIWKH UHSRUWUHIHUVWRWKH)HEUXDU\ZRUNV

 WATER SUPPLY   2SHUDWLRQV1RWHERRN  y 7KH :DLWDNDUXUX :DWHU 6DIHW\ :63  3ODQ LPSOHPHQWDWLRQ DXGLW ZDV XQGHUWDNHQ E\ WKH 'LVWULFW +HDOWK %RDUG LQ HDUO\ )HEUXDU\ &RXQFLO KDG RQH QRQFRQIRUPDQFH 7KH QRQ FRQIRUPDQFHZDVUHODWHGWRWKHIDFWWKDWWKH:DWHU6DIHW\3ODQ :63 QHHGVWREHXSGDWHG DQGWKDWLWLVQRORQJHUILWIRUSXUSRVH7KH+DYHORFNLQYHVWLJDWLRQUDLVHGWKHLPSRUWDQFHRI :63¶VDQGZDVLWH[SHFWHGWRJHWVWULFWHUHQIRUFHPHQW7KHLWHPVWKDWQHHGVWREHXSGDWHG LV WKH UHPRYDO RI FRPSOHWHG SURMHFWV DQG WKH VLPSOLILFDWLRQ RI WKH SODQ 7ZR RWKHU UHFRPPHQGDWLRQVZHUHPDGHWKDWDZLGHU(PHUJHQF\5HVSRQVH3ODQQHHGVWREHGHYHORSHG DQGWKDWDFRPPXQLFDWLRQVSODQQHHGVWREHGHYHORSHG&RXQFLOKDVDOUHDG\JLYHQDSSURYDO

3DJHRI  Council Agenda - 28-03-18 Page 128

IRU WKHVH LPSURYHPHQWV LQ -DQXDU\ 7KH :DLKL DQG 3DHURD :63¶V DUH EHLQJ XSGDWHG FXUUHQWO\DQGZRUNKDVVWDUWHGRQDFRPPXQLFDWLRQVSODQ y +$=12 DQQXDO DXGLW UHJDUGLQJ FKHPLFDOV DQG &KORULQH JDV VWRUDJH ZHQW ZHOO ZLWK RQO\ PLQRUGLVFUHSDQFLHV&HUWLILFDWHVKDYHEHHQUHQHZHG y &\DQREDFWHULD EOXHJUHHQDOJDH VDPSOLQJUHVXOWVDWWKH:DLWDNDUXUX:73±4XDUU\6WRUDJH MXVW ZHQW RYHU  FHOOVPO ,W ZDV IRXQG WKDW ERWK WKH XOWUDVRQLF XQLWV KDG IDXOWHG 7KH 4XDUU\ZDWHULVQRZWHVWHGIRUWQLJKWO\DVSHU&\DQREDFWHULD0DQDJHPHQW3URWRFRO7KHILUVW DODUPOHYHOLVDWFHOOVPOWKHFXUUHQWOHYHOLVWKHUHIRUHQRWDQLVVXH y .HVVHOVKDYHVWDUWHGWKHDQQXDO(FRORJ\6XUYH\DW:DLWDNDUXUX  &DSLWDO:RUNV  3URMHFW 6WDWXV8SGDWH

:DLWDNDUXUX:DWHU7UHDWPHQW 'HVLJQVIRUDODUJHUVXPSSLSHZRUNDQGUHODWHGLQIUDVWUXFWXUH 3ODQW8SJUDGH DUH FXUUHQWO\ EHLQJ ILQDOLVHG DQG LV RQ SURJUDPPH WR EH DGYHUWLVHGLQ0DUFK  &RQQHFWLRQRIWKH.DLPDQDZD 'HVLJQV DUH FXUUHQWO\ EHLQJ ILQDOLVHG DQG QHJRWLDWLRQV ZLWK 1HWZRUN ODQGRZQHUVDUHWDNLQJSODFH $FRQVXOWDQWLVEHLQJDSSRLQWHGWRDSSO\IRUWKHH[WHQVLRQRIWKH FXUUHQWFRQVHQWWRPLWLJDWHWKLVULVN  3URDFWLYH:DWHU0DLQ +DXUDNL5G±&RPSOHWH 5HSODFHPHQW $OEHUWVWUHHW±&RPSOHWH :DLKL)LUHEULJDGH±&RPSOHWH  :KDQJDPDWD5G±&RPSOHWH 6LOYHUWRQ5RDG±6FKHGXOHGIRUFRQVWUXFWLRQLQ0DUFK 0DWDL6WUHHW6FKHGXOHGIRUFRQVWUXFWLRQLQ0DUFK 3DK5G±6FKHGXOHGIRUFRQVWUXFWLRQLQ-XQH :DLWHWH5DZZDWHUPDLQFRQQHFWLRQ±2XWVWDQGLQJ &ODUHPRQW$YH±2XWVWDQGLQJ -XQFWLRQ5G±2XWVWDQGLQJ 9DULRXV'UDLQ&URVVLQJV2XWVWDQGLQJ  3ODLQV6WRUDJH 7KHUHVHUYRLUGHVLJQVKDYHEHHQUHYLHZHGDQGWKHUHVHUYRLUV  KDYHEHHQRUGHUHG 7KH VHWWOHPHQW RI WKH SUHORDGLQJ GLG QRW WUDFN WKH GHVLJQHG VHWWOHPHQWDQGDQDGGLWLRQDOPPRIJUDYHOLVEHLQJDGGHG WRWKHSUHORDGLQJ 'HVLJQV RI WKH SLSHZRUN KDV EHHQ FRPSOHWHG DQG WKH & 0 WHDPLVSODQQLQJWRGRWKLVZRUNLQ-XO\  :DWHUPHWHUUHSODFHPHQW 6WDIIKDYHKDGPHHWLQJVZLWKVXSSOLHUVWREHWWHUXQGHUVWDQGWKH SURJUDPPH DYDLODEOHWHFKQRORJ\7KLVSURMHFWZLOOEHSURJUHVVHGODWHULQWKH \HDU  :DLWDZKHWD,QWDNH$LUEXUVW $ FRQVHQW DSSOLFDWLRQ KDV EHHQ VXEPLWWHG DIWHU D +HULWDJH V\VWHP DVVHVVPHQW DUERULVW UHSRUW DQG HQYLURQPHQWDO DVVHVVPHQW

3DJHRI  Council Agenda - 28-03-18 Page 129

KDV EHHQ GRQH ,ZL FRQVXOWDWLRQ QHHGV WR EH GRQH RQ WKLV SURMHFWDQGZLOOEHSURJUHVVHGLQ0DUFK  :DLKL:73 $VSDUWRIWKH2KLQHPXULFRQVHQWLWZDVDUHTXLUHPHQWWRGR ULSDULDQSODQWLQJ7KLVSODQWLQJZLOOEHGRQHLQ$SULO  :DLWDNDUXUX,QWDNH 2QHRIWKHFRQVHQWFRQGLWLRQVIRUWKLVWDNHZDVWRGRULSDULDQ SODQWLQJ7KLVSODQWLQJLVGRQHLQVWDJHVDFFRUGLQJWRDQDJUHHG SODQ6HFWLRQV&(DQG)KDVEHHQGRQH6HFWLRQV$ %ZLOO EHGRQHLQ$SULO  .HUHSHKL0DQJDQHVH &RXQFLODSSURYHGIXQGLQJIRUWKHDSSRLQWPHQWRIDFRQVXOWDQW WRGHVLJQDFDWDO\WLFILOWHUWRDGGUHVVWKHPDQJDQHVHSUREOHP 3URFXUHPHQWGRFXPHQWVDUHEHLQJSUHSDUHG    0DUFK$SULO3ODQQHG:RUNV

:DLWDNDUXUX:DWHU6DIHW\3ODQLPSOHPHQWDWLRQZLWK'+%

5HSODFH$&XQLW.HUHSHKL:73

:73+$=12LQVSHFWLRQV

Land negotiations for Kaimanawa reservoir

Finalise the WSP’s for Waihi and Paeroa

 WASTEWATER   2SHUDWLRQV1RWHERRN

$QHZPDLQVHZHUSXPSZDVSXUFKDVHGIRU-XQFWLRQ5RDG7KHLQVWDOODWLRQKDVEHHQGHOD\HGWRWK 0DUFK

$OO:DVWHZDWHU7UHDWPHQWSODQWVKDYHEHHQSHUIRUPLQJZHOOGXULQJWKHKRWZHDWKHU  :HKDYHKDGDIHZRFFXUUHQFHVRI$YLDQ%RWXOLVPDW:DLKLDQG7XUXD::73¶V)LVKDQG*DPHKDV EHHQQRWLILHGRIWKHRXWEUHDNV6WDIIKDYHVWDUWHGRQWKHFRPSLODWLRQRID%RWXOLVP0DQDJHPHQW3ODQ  :HKDYHFDUULHGRXWUHSDLUVRIDOHDN\VHZHUPDLQFURVVLQJWKH7D\ORU$YHGUDLQ:HZLOOEHUHSODFLQJ WKLVSDUWRIWKHV\VWHP  $+$=12DXGLWKDVDOVREHHQGRQHDWWKH:DLKL::7:7KHDXGLWLGHQWLILHGVHULRXVULVNVDQGWKH VLWH KDV EHHQ SXW RQ D +HDOWK DQG 6DIHW\ ORFNGRZQ 7KH FDXVWLF VXSSO\ OLQH KDV UHFHQWO\ GLVLQWHJUDWHG7KHWDQN LVPDGH RIWKH VDPH PDWHULDO DQG WKH FRQFHUQ LV WKDW WKHWDQN PLJKW EH VWUXFWXUDOO\XQVRXQG7KHDFLGDQGSRO\PHUWDQNFHUWLILFDWLRQKDVDOVRODSVHG$OOWKHWDQNVZLOOKDYH

3DJHRI  Council Agenda - 28-03-18 Page 130

WREHHPSWLHGDQGLQVSHFWHG7KHDQWLFLSDWHGFRVWIRUWKHLQVSHFWLRQZRUNZLOOEHLQWKHRUGHURI     &DSLWDO:RUNV

.DUDQJDKDNH *RUJH VHZHU 'HVLJQVDUHEHLQJILQDOLVHG OLQH  6LOYHUWRQ3XPSVWDWLRQ 'HVLJQRQWKHJHQHUDWRUKDVVWDUWHG 5HSODFHPHQWRIJHQHUDWRU  7XUXD&RQVHQW &RQVXOWDWLRQ ZLWK ,ZL JURXSV DUH EHLQJ XQGHUWDNHQ7R GDWH DOO JURXSVZHUHVXSSRUWLYHRIWKHSURSRVDO  'LVWULFW :LGH 3LSH 5HQHZDOV 'XH WR WKH FXUUHQW ZRUNORDG WKLV SURMHFW LV QRW SURJUHVVLQJ DV 3DHURD SODQQHG   5HDFWLYH5HQHZDOV

1RQHSODQQHG  0DUFK$SULO3ODQQHG:RUNV

5HSODFHPHQWRIEULGJHFURVVLQJDWWKH3XNHURDGGUDLQ  3URFXUHPHQWRIWKHOLIWLQJEHDPVWUXFWXUHV  )LQDOLVHWKH%RWXOLVP0DQDJHPHQW3ODQ 

3DJHRI  Council Agenda - 28-03-18 Page 131

STORMWATER   2SHUDWLRQV1RWHERRN

3DHURD±5HSDLUHGFHVVSLWVLQ:DVKLQJWRQVTXDUH  7XUXD±,QVWDOOHGFHVVSLWDW5DUDWXQD6WUHHW  .DLDXD±&OHDUHG6FKRRORXWOHW  .DLDXD±&DUULHGRXWLQVSHFWLRQVRI)ORRGJDWHV   &ROODSVHG6WRUPZDWHU3LSH:LOORXJKE\6WUHHW3DHURD  $SLSHOLQHURXWHKDVEHHQDJUHHGZLWKWKHQHZRZQHUDQGWKHGHVLJQVDUHFXUUHQWO\EHLQJILQDOLVHG $Q LQGHSHQGHQW VWUXFWXUDO HQJLQHHU KDV GRQH DQ LQVSHFWLRQ RI WKH IRXQGDWLRQ RI WKH KRXVH DQG FRQILUPHGWKDWWKHIDLOHGVWRUPZDWHUSLSHGLGQRWKDYHDQ\QHJDWLYHHIIHFWVRQWKHIRXQGDWLRQ )RUWKHGHWDLOHGGHVLJQUHSRUWDQGVWUXFWXUDODVVHVVPHQWVHH$SSHQGL[$  $QDPRXQWRIKDVEHHQPDGHDYDLODEOHLQWKH/73IRU6WRUPZDWHU5HQHZDOVLQ3DHURD7KH HVWLPDWHIRUWKLVSURMHFWLV7KLVHVWLPDWHPLJKWFKDQJHGHSHQGLQJRQWKHQHJRWLDWLRQVZLWK DOO WKH DIIHFWHG ODQGRZQHUV 6XIILFLHQW IXQGV DUH DYDLODEOH WR IXQG WKLV SURMHFW IURP WKH 3DHURD 6WRUPZDWHU)XQG  7KHSURSRVHGFRQVWUXFWLRQZLOOFDXVHVXEVWDQWLDOGDPDJHWRWKHSURSHUW\DQGKDVDQHZFDUSRUWDQG ZDOOEHHQLQFOXGHGLQWKHSURMHFWHVWLPDWH,WZDVDOVRDJUHHGZLWKWKHRZQHUWKDWWKHH[LVWLQJSLSH ZLOOEHFRQFUHWHJURXWHGWRHOLPLQDWHWKHULVNRIIXWXUHGDPDJHWRWKHKRXVHIRXQGDWLRQV  &DSLWDO:RUNV

&RPSOHWHGLQVWDOODWLRQRI3LSLQJDW.HQQHG\+LOO6WUHHWDQGSLSLQJDWWR&RURQDWLRQ6WUHHW  0DUFK$SULO3ODQQHG:RUNV

3LSLQJRIWKHGUDLQLQ&RQVRO6WUHHW:DLKL              

3DJHRI  Council Agenda - 28-03-18 Page 132

,QGXVWU\3ULFH$GMXVWPHQWV  &RXQFLOKDVEHHQDGYLVHGE\YDULRXVVXSSOLHUVWKDWFKDQJHVLQLQWHUQDWLRQDOFRPPRGLW\SULFHVKDV IRUFHGWKHPWRLQFUHDVHWKHLUUDWHV$WWKLVVWDJHFHUWDLQFKHPLFDOVDQGSLSHPDWHULDOZLOOEHDIIHFWHG  &KDQJHVLQSLSHVXSSO\UDWHVLVLQWKHRUGHURI  5DWHVIRUFDXVWLFVRGDKDVULVHQE\DERXW7KLVZLOOHTXDWHWRDSRVVLEOHLQFUHDVHRIRQ &RXQFLOVFKHPLFDOFRVWV    (-:HQW]HO :DWHU6HUYLFHV0DQDJHU     

3DJHRI  Council Agenda - 28-03-18 Page 133

,QIRUPDWLRQ5HSRUW

To: EJ Wentzel, Water Services Manager

From: Wayne Henderson, Consultant Engineer

Date: Thursday, 15 February 2018 File reference: Document: 2356426 Appendix A: 2357893 Appendix B: 2359272 Subject: 28 Willoughby St Paeroa – Storm Water Diversion Report

Summary

There is currently a large washout hole [tomo] under the house at 28 Willoughby St, caused by a defect in Council’s public storm water pipe that passes under this house. The tomo is next to the footing of the house, and is starting to undermine a small portion of the footing. The tomo has resulted from silt above the pipe being washed into the pipe via the open gap pipe joint that is at least 10mm wide and 140mm long.

CCTV inspection has found two further open pipe joints in the top of the pipeline near and under a shed, and a partial collapse of the pipe on the edge of the driveway at #23 Wood Street. This pipeline appears to be DN225mm butt jointed concrete pipe, so it is likely to continue to result in further tomo’s into the future. A second wash out tomo may be starting to occur in front of the shed at #28 Willoughby, as there appears to be a 40mm diameter hole from surface level to the known open joint pipe defect below it [at Chainage 33.0m, see attached plan 11517-GA01].

A structural engineer inspected the house foundations and adjacent tomo on 13 March 2018, and found that the tomo washout had not yet caused damage to the strip footing foundation of the house. His recommendation is to fill the storm water pipeline under the house as soon as practicable, after installing a new public storm water pipeline about the dwelling. Plans for the preferred route about the property are attached with this report.

The preferred pipeline route is the shortest route and has one less manhole requiring construction than the alternative longer potential route. This equates to a cost saving for drain laying and one less $3000 concrete manhole. The additional cost of the preferred route is for demolition and disposal of an existing brick carport, and for erection of a replacement carport roof structure, fence and concrete works that require removal for the installation of the proposed pipeline. The alternative route was found to be approximately $10,000 more to construct, and pipe lining the pipeline under the house would be a further $10,000 more expensive to undertake.

It is recommended that Council y Adopt and undertake the works as detailed in the preliminary construction plans shown in Appendix A of this report, shown on drawing in Appendix A – 11517-SW200A-Preferred [Sheet 2A] and 11517- LS300-Preferred [Sheet 3]. Drawing 11517-GA100 [Sheet 1] shows existing services about site. y Consult with the adjacent landowners at #26 Willoughby Street, and #21 and #23 Wood Street about the preferred solution and request permission to install new pipeline upon their properties. y Gain legal agreement under the Local Government Act 2002, Section 181 [Powers in Relation to Private Land] with the landowners at #26 and #28 Willoughby Street, and #21 and #23 Wood Street to undertake the proposed works. Page 1 of 4

Council Agenda - 28-03-18 Page 134

y Without Wood Street landowner approvals review the alternative works potential only upon #28 Willoughby street shown on drawing in Appendix A – 11517-SW200B-Alternative [Sheet 2B].

Tomo and House Foundation and Sub Floor Structural Inspection

The tomo and foundations under the dwelling were inspected by a structural engineer Mr Hugh Barraclough of Tiaki Engineering Consultants on 13 March 2018. He found that the foundation structure and building sub- floor has not yet been affected or damaged by the tomo that is forming against the foundation, The report is included in Appendix B

The current tomo is some 1.7m long, 0.7m wide and 0.6m deep. In time the tomo will continue to enlarge and increase the localised undermine about the house foundation that is starting to occur. Foundation damage would likely result if the pipeline and tomo area is not concrete filled soon to prevent further water egress and sediment loss under the houses foundation. To properly repair the tomo the soft material about the tomo edges must be removed, and that tomo hole must also be backfilled with concrete grout to remediate the hole.

Storm Water Pipeline Condition

CCTV of the storm water line between the cesspit in front of 28 Willoughby Street, to driveway of 23 Wood Street indicates three open pipe joints that will allow tomo, and a partial pipe collapse also forming a tomo under driveway of 23 Wood Street. The pipe appears to have been laid in 1960 [approx. 58 years old], and be a butt jointed concrete pipe, which is a jointing method that may allow further open joint failures in the future.

During recent inspection it was noted that a new 30 to 40mm diameter open hole [soil piping] at the edge of the northern boundary shed foundation [28 Willoughby] had appeared over the last 2 months. This is likely to be the start of another tomo above the pipe. There is a second open pipe joint defect noted on the CCTV under the shed, so the shed pipe joints would be difficult to access for repair with a pipe interior liner or epoxy patch repair to the open joint.

With the collapse and 3 open joint formations over 50m of pipe, further deterioration of this section of pipe is very likely. The pipe is assessed as being in poor condition, and it is located in a very poor location under a building and a shed. The pipeline condition upstream of the collapse has not been assessed, as there are no known or found manholes on the upstream pipe system. Further CCTV inspection and manhole/pipeline locating is required upstream of the collapse at #23 Wood St, after the collapse is fixed. The proposed pipeline upgrade manholes are situated to allow for future pipeline upgrades/renewals if required.

With the pipe passing under the 28 Willoughby Street house and shed resulting in tomo’s that are very likely to cause structural damage, the structural engineer is recommending filling the pipe with concrete to prevent further tomo’s damaging the dwelling foundations.

Storm Water Pipeline Capacity Analysis

A capacity analysis of the contributing storm water catchment above the property to Wood Street indicates that a DN300mm diameter storm water pipeline is required to service the upstream catchment. The current pipeline is DN225mm in diameter. This capacity assessment of the existing system operation was confirmed by the owner of #21 Wood Street, who advised that the cesspits in front of his property [double cesspits arrangement on DN225 lead] does not cope with intense rainfall periods during big storm events, and excess surface overland storm water overflows down via his property driveway towards 28 Willoughby Street.

It is recommended that the proposed pipeline be DN300mm in diameter to meet current 10% EP design standards as far as #23 Wood Street to the DN225mm catchpit lead connection point at proposed SWMH-C.

Page 2 of 4

Council Agenda - 28-03-18 Page 135

Route Analysis

There are two possible routes to install a new storm water pipeline. The preferred route [Option A] is shown on the drawings in Appendix A of this report. The two routes that are possible to construct are indicated on Figure A below.

Option A is approximately 53m in length. It passes between #28 and the garage of #26 Willoughby St, in a passage that is wide enough to construct the pipeline without interfering with the house or neighbours garage foundations. This route requires the removal of the existing brick sided open carport at #28, as it is upon the desired alignment. Council would have to replace the carport, concrete car pad and fence to take this route. It is found to be cost effective to do this compared to the length and complexity of the alternative option. Permissions from the owner of #21 Wood St is still required to build the pipeline on his property.

Option B is approximately 78m in length. It must re-join the pipeline on Willoughby street in order to have a downhill gradient, and cannot join the existing pipe on Thorp Street. It is likely to have to be constructed down the sealed carriageway of Thorp Street due to the 11kVA [aerial?] power line and poles, telecoms, water main and sewer main in the berm. Route B requires the additional permission of the owner of #3 Thorp Street to go through the lawn and vegetable garden areas

A structural liner of the existing pipeline is an expensive possibility for remediating the pipeline under the house, but it would require specialist equipment to retain this pipeline, along with very high costs in the order of $750/m to $1000/m. This would require at least 36m of lined pipe, with the rest renewed by traditional trenching.

It is not possible to go via the east side of #28 Willoughby St without re-installing the pipeline along Willoughby Street at a lower gradient. The existing pipe to the east rises at too steep a grade to make an eastern route viable. The pipe would also be too close and below the properties foundation, which is unsuitable in terms of safeguarding the houses foundation on the eastern side without underpinning works or major reinstatement works to the eastern neighbours hard landscaped property.

A preliminary budget estimate for anticipated costs of Options A and B are provided below.

FIGURE A – Feasible Pipeline Routes

Page 3 of 4

Council Agenda - 28-03-18 Page 136

Cost Estimates

Option A Cost Estimate – Public Drainage Works – DN300 Pipeline

Installation of new DN300 pipeline @ $300/m [52m] $ 15,600 + GST 1200 Diameter Manhole Willoughby Street $ 4,000 + GST 1050 Diameter Manholes on route $3000 each $ 6,000 + GST Demolish Carport and remove concrete $ 1,000 + GST Obtain kitset Carport and install $ 3,500 + GST Driveway/Carport Concrete replacement [allow 40m2 @ $85/m] $ 3,400 + GST On site drainage alterations – private drainage $ 2,000 + GST Grout fill pipeline and tomo $ 2,000 + GST

ESTIMATED CONSTRUCTION COST $ 37,500 + GST CONTINGENCY ALLOWANCE AT 30% $ 11,250 + GST BUDGET ESTIMATE OPTION A $ 48,750 + GST

Option B Cost Estimate – Public Drainage Works – DN300 Pipeline

Installation of new DN300 pipeline @ $300/m [77m] $ 23,100 + GST Reinstatement of roadway trench [25m x 0.6m wide x 1.6m depth@$85/m3] $ 2,040 + GST Seal preparation and 2 coat chip seal [30m x 1 @50/m2] $ 1,500 + GST Power pole securing for nearby trenching $ 1,000 + GST Traffic Management $ 1,500 + GST 1050 Diameter Manholes on route [4 @ $3000 each] $ 12,000 + GST On site drainage alterations – private drainage $ 2,000 + GST Grout fill pipeline and tomo $ 2,000 + GST

ESTIMATED CONSTRUCTION COST $ 45,140 + GST CONTINGENCY ALLOWANCE AT 30% $ 13,542 + GST BUDGET ESTIMATE OPTION A $ 58,682 + GST

Option C Cost Estimate – Reline existing pipe – DN225 Pipeline Retained under house

Structural liner to existing pipeline @ $850/m [36m] $ 30,600 + GST Prepare pipeline grinding off stubs protruding into pipe being lined $ 2,000 + GST Trim liner for penetrations $ 500 + GST Installation of new DN2250 pipeline @ $230/m [20m] $ 4,600 + GST 1200 Diameter Manhole Willoughby Street $ 4,000 + GST 1050 Diameter Manhole on route $ 3,000 + GST On site drainage alterations – private drainage $ 2,000 + GST Grout fill pipeline and tomo $ 2,000 + GST

ESTIMATED CONSTRUCTION COST $ 48,700 + GST CONTINGENCY ALLOWANCE AT 30% $ 14,610 + GST BUDGET ESTIMATE OPTION A $ 63,310 + GST

The above costs are estimated commercial costs to undertake the works. Being done in-house by HDC Construction and Maintenance Division can often remove a reasonable 10 to 20% profit margin off of the final costs to Council that commercial contractors would hope to make on civil works.

Page 4 of 4

Council Agenda - 28-03-18 Page 137 Council Agenda - 28-03-18 Page 138 Council Agenda - 28-03-18 Page 139 Council Agenda - 28-03-18 Page 140 Council Agenda - 28-03-18 Page 141 Council Agenda - 28-03-18 Page 142 Council Agenda - 28-03-18 Page 143 Council Agenda - 28-03-18 Page 144

Information Report

To: Mayor and Councillors

From: Infrastructure Systems & Planning Manager

Date: Friday, 16 March 2018

File reference: 2356484

Portfolio holder: Duncan Smeaton

Meeting date: Wednesday, 28 March 2018

Subject: Solid Waste - Monthly Activity Report – February 2018

Recommendation:

THAT the report be received.

Summary This report summarises performance and issues in the Solid Waste work area. The body of the report refers to February works. Impacts of National Sword by the Chinese Government In approximately mid 2017 the Chinese Government put the world on notice that it would no longer be the dumping place for the rest of the world. China has traditionally been the singular largest purchaser of recyclable products.

The Chinese programme called “National Sword” has come on the back of contaminated recycling and refuse being sent to China under the guise of recycling. Typically, New Zealand product has been of a higher standard.

National Sword has come into effect in January 2018, and we are already beginning to feel the effects and they are quite severe. The three primary impacts are; x A significant decrease in prices across all recyclable products x A significant reduction in demand x Some markets are disappearing completely

The Chinese National Sword policy has bitten and bitten hard. National Sword has not only restricted import licences for recycled product, but it has placed extremely low limits of contamination rates of

Page 1 of 6

Council Agenda - 28-03-18 Page 145

those recyclables to less than 0.5%. Contamination levels in NZ are running around the 8 – 15% before the product is processed at a MRF. A 0.5% contamination rate (after processing) is exceptionally low and most NZ MRF’s have been operating on a less than 5% contamination in export materials threshold for years. So National Sword requires a ten-fold reduction in contamination of finished products by MRFs.

The effect on NZ is that either the cost to recycle waste will increase substantially or recycleable waste will be sent to landfill. It is likely that we will receive a variation request to the existing contract to cover the increased costs. The 3 Council partners are actively working on this situation and we will keep the Council informed of developments.

General:

The Peak Period is now over and the collections in Hauraki did not go so well and some properties were missed several times in consecutive weeks. The contract manager is aware of our frustrations with the numbers has spoken to SEL about this, complaints appear to be made up of a mix of missed properties and late placements.

Refuse transfer stations have had problems this month. SEL problems are due to a combination of machine break downs causing significant delays with product resulting in no capacity in the bunkers. Issues with staff not understanding the responsibilities and unable to give the right information to customers has caused some customers to become frustrated and disappointed. This is an area that we have instructed the contractor to address and improve urgently.

There are issues of concerns of resourcing. It is obvious looking at the number of complaints through customer services and afterhours processes that we have received a number of written complaints via media content and council's general email system. Most of these complaints seem to referring to the lack of resources particularly in the refuse transfer sites where issues around waiting in a queue and full bunkers leaving no capacity have become a daily occurrence. The wall on the eastern side of the pad area at Paeroa RTS is yet to be repaired.

SEL have a lack of labouring staff at present, which has resulted in SEL Managers working in labouring roles that should normally be allocated to staff. Again, staff from the 3 Councils are addressing the concerns with the contractor and are working together to resolve the issue. The contract is mid-way through its contract period.

RTS Audit: The February audit was carried out by Kathryn Griffin using SEL's Vault programme. The audit results are as follows.

Audit Result:

Paeroa RTS - There are corrective actions issued for this site. x Refuse Area - Rubbish left on the pit overnight. The rubbish was leaching into the drain. x Commingle Storage - Fadge bags need removal. They have been stored here too long. x Paper /Cardboard Storage - Cardboard cages are full to overflowing and will have no capacity once the RTS open today. x Tyre Storage - The Pile is very large. Page 2 of 6

Council Agenda - 28-03-18 Page 146

Waihi RTS - There were two corrective actions issued for this site. x Kerb and Channel - A road sweeper is needed here to clean the kerb and sweep the forecourt. x Other - Weed spraying is needed in the site as it looks untidy.

A dramatic fall in HDC. Paeroa has experienced a major fall in the result with multiple corrective actions. However, the result is still better than that of Waihi. Requests for Service (RFS)

Kerbside Collections were good this month with minimal problems in the usual areas. Ngatea, Paeroa and Waihi seem to be recorded most times on the RFS report. Luckily the validation process indicated that only two of the twelve calls were validated and upheld while the rest were unjustified due to misinformation and exaggeration.

Collections through the main town centres continues to improve. We have had some people phone in to complain about the disruption that the collection truck was causing on the main street. The contract manager has phoned them back and advise the truck will cause disruption as it cannot be avoided. The disruption is only for a few minutes and their patience would be greatly appreciated.

RTS The Paeroa and Waihi Refuse Transfer Stations have taken a dramatic drop in standards. Both sites looked very poor and rubbish left on the pad overnight in Paeroa and leachate entering the storm water drain. Fadge bags are piled up in the corner of drop off area for comingle and the paper cardboard bins were full to overflowing. Tyres have increased and have not been removed for some time.

Page 3 of 6

Council Agenda - 28-03-18 Page 147

Waihi was very much the same. The kerb and channels have not been cleaned for a very long time that weeds are growing from the build-up of dirt and debris. Drainage here is not good and there is still no cage for gas bottles. The drop off area is not set up properly and recycling items are all over the place. The fence surrounding the scrap metal compound is damaged and needs repair. This has been like this for a couple of weeks. Fadge bags are also pilling up here and they don't seem to be moving out anytime soon. A big improvement is needed here. We have raised this issue with the contractor and the contract manager.

HDC Monthly RFS Totals – February 2018

The result is a lot better than last month but still an issue. The contract manager has discussed the improvements with the Supervisor and will raise with the Manager as well in the next monthly contract meeting.

Page 4 of 6

Council Agenda - 28-03-18 Page 148

Transport Tonnages

No significant changes here. This is to be expected, tonnages should remain steady in Feb and March.

Diversion

A significant change this month with recycling dropping very low. This is believed to be related to reductions at Whiritoa which has followed the same trend as TCDC for the same period.

Page 5 of 6

Council Agenda - 28-03-18 Page 149

Another really significant difference here compared with kerbside. The tonnages are vastly different which is what is being observed throughout the three districts. Better education and more interaction in the RTS sites are needed.

Steve de Laborde Infrastructure Systems & Planning Manager

Page 6 of 6

Council Agenda - 28-03-18 Page 150

Information Report

To: Mayor and Councillors

From: Infrastructure Systems and Planning Manager

Date: Friday, 16 March 2018

Portfolio Holder: Councillor James Thorp

Document M2354252

Meeting date: Wednesday, 28 March 2018 District Drainage Activity Report Subject: to 28 February 2018

Recommendation:

THAT the report be received

Summary

This report summarises the Land Drainage Activity for the period ending 28 February 2018.

February has brought some favourable weather which has allowed maintenance and works to get well underway. However, there was some heavy rainfall experienced across the District due to the remnants of ex-Tropical Cyclone Gita. The Ngatea rain gauge registered 109mm in the 3 days of rain (11-13 February) that affected the district. This led to some flooding in isolated areas which required the field staff to prioritise those areas for maintenance. Hot and humid conditions at the beginning of the month helped increase the weed growth in drains that hadn’t been cleaned or sprayed yet. This may result in having to re-spray drains that have regrowth closer to winter which will have an increase in costs.

Operations Notebook

x 235.1km of drains have been sprayed in the current year, and 34.1km have been machine cleaned. x Minor maintenance has been undertaken in all districts. x Routine floodgate and pump station inspections have been completed. x Floodgates and culverts have been cleared as required. x 172 man-hours were spent on pump screen cleaning during this reporting month.

Work is being done within the Asset Management System to be able to display the works listed above, in a map format.

Capital Works

Stopbanks

Council Agenda - 28-03-18 Page 151

There are three areas that have presented themselves in the assessments that require immediate attention and remediation methods are being investigated and designed.

The three areas are: x Waitakaruru (SH25) – Water is passing through the stop bank on a really high tide, there may be a number of different reasons for this. An experienced engineer has been contracted to investigate and is currently assessing his findings as to what remediation to use. This is a short and isolated section within the first 10m from the Bailey Bridge at the intersection with the Miranda/Kaiaua road and SH25. x Foreshore (near Indian floodgate) – This is a bit further on from the last issue and is a bit longer. It also appears to be a different mechanism of ingress and the investigation, once again, will determine the remediation method. x Karito Canal – This stopbank is to be raised. Preparations for this are underway.

Pumpstations x Central North (2 pumps) x Rawerawe (1 pump)

Both of these pumpstations’ pumps require major renewal work, the full extent will be known once they are lifted out and inspected/tested.

General

Campbell’s/Greens/Shelly Beach Road Drains Staff have been investigating the two options of re-directing the water coming down the Campbell Drain either down a widened Green’s drain or a re-instated Shelley Beach Rd drain to the Factory floodgate (See appendix).

This is to try and reduce the catchment size of the Campbell floodgate catchment to approximately 100ha as it can’t cope with the nearly 400ha catchment that currently inundates the farm near this floodgate. It is understood from the WRC that the Factory and O’Carroll’s floodgates will have sufficient capacity for the extra flow. This situation has arisen due to the incorrectly sized and installed Campbell’s Floodgate that has caused extensive ponding on the farmland adjacent to the floodgate.

However, surrounding land owners are not satisfied with either of the options.

Muggeridge Update:

The various tasks are currently being carried out by the two organisations. WRC is preparing to start earthworks in April and HDC is preparing for the property to be sub-divided and transferred to WRC as part of HDC’s contribution.

There is a water main running through the middle of the site. It is understood that this line is part of a circular network and will be shutdown to assess the effects it has on the surrounding users. A section of it will need to be replaced once the canal has been dug.

That concludes this report.

Steve de Laborde Infrastructure Systems and Planning Manager

Council Agenda - 28-03-18 Page 152

Appendix

Layout of Drains

Council Agenda - 28-03-18 Page 153

HAURAKI DISTRICT COUNCIL

WESTERN PLAINS DRAINAGE DISTRICT

MINUTES OF A MEETING OF THE WESTERN PLAINS DRAINAGE DISTRICT COMMITTEE HELD IN THE COUNCIL CHAMBERS, WILLIAM STREET, PAEROA ON THURSDAY 22 FEBRUARY 2018 COMMENCING AT 10.30 AM

PRESENT Messrs B A Carter (Chairman), B Keane, P A Leonard, P Paterson, H van Eyk, R D Young (from 10.35am )and Cr D H Swales

IN ATTENDANCE Cr J R H Thorp (alternative member) , Cr R Harris, Cr G R Leonard, Cr P Buckthought, Mr A De Laborde (Group Manager - Engineering Services), Mr S De Laborde (Infrastructure and Planning and Systems Manager), Mr B Stephens (Drainage Overseer) and Ms C Black (Council Secretary)

APOLOGIES

RESOLVED

THAT the apology of G Laurich and for the lateness of R Young be received and sustained.

WPDD18/01 Swales/Keane CARRIED

LATE ITEMS

There were no late items.

Ross Young attended the meeting at 10.35am.

Flooding Issues/Coastal Inundation - January Weather Event: Maukoro Canal - Investigations

Landowners - Dan Murdoch, Mike Karl and Glen Johnstone were in attendance to address the Committee and staff on their dissatisfaction regarding the ineffectiveness of stopbanks to prevent flooding and coastal inundation onto their properties.

y Issues of stopbanks being ineffective due to king tides. y Stopbanks are below design level. y Coastal inundation has caused salt water damage to grass and crops.

Mr Murdoch stated that he had lost 7ha of his maize crop due to flood water breaching the stopbanks.

The Drainage Overseer asked Mr Murdoch which area of his property had he noticed the most significant impact?

Mr Murdoch advised that it was generally the area below road level.

Mr Karl also expressed his dissatisfaction with the stopbank system generally. He commented that Waikato Regional Council knew about the issues with the stopbanks prior to the weather event. He stated that these stopbanks must be raised and drains need to be cleaned more than they currently are, d for, particularly on his side of the road. He also stated that in his opinion, the flooding issues affecting the lower lying properties are caused by properties above them resulting in receiving their flood water.

 :3''0LQXWHV'RF5HI  Council Agenda - 28-03-18 Page 154

Mike Karl stated the back half of his property was under water for six months. He stated that he has raised this issue with the regional council previously (approx. 6 years ago). He believed the Muggeridge Project is a waste of time. The Pouarua should be drained directly to the sea.

Chairman’s response:

Brian Carter suggested some options to consider in resolving these issues. He stated that he was aware that WRC are currently reviewing where the water is not getting away. He agreed that the Moukoro Canal needs cleaning and so also does the Pouarua Canal.

Mr Karl stated that there is too much water going into the Pouarua. He is receiving the water that is coming from there. He believed farmers further up need to pay more rates. Their drainage systems have been improved which has resulted in the lower properties receiving more water than before.

Brian Carter supported that these issues need to be documented by Waikato Regional Council staff. The Drainage Overseer agreed that silting builds up quickly when there is sea inundation. He added that everyone has their own opinion about when drains should be cleaned.

Adrian de Laborde responded to Mike Karl’s comments regarding rating. He advised Mr Karl that his property is classified in the ‘F2’ rating area and as such paid approximately 75% less than ratepayers in an ‘F1’ rated drainage area. He thus also received a lower level of protection. Investigations can be undertaken to look at more infrastructure to deal with the increasing water coming from upstream onto his property. Mr de Laborde stated that all landowners pay the same level of rates within a rating area, no one property pays more than another.

Steve de Laborde asked that all parties need to look at the ‘entire’ cause of issues. The community and the district drainage committee needs to decide what action is required to address these issues raised and that options to remedy need to be discussed with the Waikato Regional Council. Steve de Laborde advised regarding rating per property, that he will undertake a review of what rates landowners are paying.

Suggested options to remedy issues: y Raising stopbanks y Improvements to canals y Cleaning and ensuring there are no obstacles in the drains and canals.

There was a suggestion that the oysters growing in the mangroves could be causing blockages.

An assessment of all stopbanks needs to be undertaken but there is minimal funding in the budget to undertake significant improvements to remedy the issues raised.

It was requested that Steve de Laborde prepare a report to the March meeting on the Maukoro Canal and to show an assessment of issues raised by landowners in attendance.

The Chairman thanked the three landowners for attending the meeting and voicing their concerns and advised them that the Committee would be in contact in due course to follow up on the issues raised by them.

RESOLVED

THAT the Western Plains District Drainage Committee recommends to the Hauraki District Council that it initiates a review of the joint responsibilities of the Maukoro Canal and adjacent catchments and the possibility of charging the contributors who exacerbate the downstream effects.

WPDD18/02 Swales/Keane CARRIED

 :3''0LQXWHV'RF5HI  Council Agenda - 28-03-18 Page 155

It was agreed that the three landowners in attendance be responded to by letter thanking them for taking the time to attend the meeting and advising them that a review is in progress and that a report on the assessment on the issues raised will be presented to the Western Plains District Drainage meeting in March.

CONFIRMATION OF MINUTES

MEETING HELD ON (30-11-17) (2344307)

RESOLVED

THAT the minutes of the meeting of the Western Plains Drainage District Committee held on Thursday 30 November 2017 be taken as read and confirmed.

WPDD18/03 Swales/Thorp CARRIED

MATTERS ARISING FROM THE MINUTES

There were no matters arising.

DRAINAGE MANAGERS REPORT TO JANUARY 2018 AND FINANCIAL REPORT FOR THE PERIOD 7 MONTHS TO 31 JANUARY 2018 (2346497)

Steve de Laborde, Infrastructure and Planning and Systems Manager presented the drainage report on operational activities and financial report for the period 7 months to 31 January 2018.

Chemical spraying

73km of drains were sprayed in the WPDD during January.

Machine cleaning

11.3 km of drains were machine cleaned in the financial year to date.

Maintenance/Fencing/Culverts

Routine maintenance items undertaken. Repaired low areas by Smyth’s and Indian high level floodgate’s.

Pump operation

Regular inspection runs were undertaken in this period. Pump hours in January were 260 hours. No man- hours were spent on weed screen cleaning in the period.

Floodgates

Floodgate inspections were completed on WRC and HDC floodgates.

BYLAW APPROVALS

There were no bylaw approvals were granted in the period.

 :3''0LQXWHV'RF5HI  Council Agenda - 28-03-18 Page 156

SUBDIVISIONS COMMENTED ON

There were no subdivisions commented on during the period.

RAINFALL

The table and graphs of the Ngatea Monthly Rainfall depths since 1993 were attached. The rainfall total for January was 100 mm.

The year to date total from July 1 was 632mm.

GENERAL

Muggeridge Update

Project Status Report

y The project is still on amber due the timings and budget.

Earthworks design

y AECOM is doing more work on the design this week to confirm quantities of material available for stopbank construction. y Will try to undertake and complete the earthworks this season. y An update letter was sent to the landowners prior to Christmas. y A consent is being scoped for the Pitts Road drain weirs. y Project completion timeframe is still mid-2019.

The budget is very restricted and there is a risk of an increase in costs during the design and procurement phase.

Drainage Bylaw Review

Committee members were requested to consider the current bylaw and to provide feedback into the review process. Copies of the Drainage Bylaw were distributed.

GENERAL BUSINESS

Stopbank Canal West Road - Coastal Inundation

Harry van Eyk spoke on the flooding event in January and showed a video from a drive he had undertaken along Canal West Road which showed areas of extreme flooding.

MEMBERS’ COMMENTS

Brian Keane - Waitakaruru - Twin Bridges flooding issues caused by silt build up and asked that HDC pursue this matter with NZTA as soon as possible.

Cr Don Swales - advised that there is a need to clean silt out from under the bridge which will improve water flow to ensure water get away.

 :3''0LQXWHV'RF5HI  Council Agenda - 28-03-18 Page 157

RESOLVED

THAT the Western Plains District Drainage Committee recommends to the Hauraki District Council that they revisit with NZTA the issue at the twin bridges at Waitakaruru regarding the silting issues under the bridges restricting the flow of the stream.

WPDD18/04 Keane/Swales CARRIED

Inclusion of WRC staff to receive District Drainage Agendas

It was agreed that it would be beneficial for WRC staff to receive all future District Drainage Committee agendas and that they be invited to attend when required.

The Council Secretary will send all future agendas to key WRC staff (Kenny Growden, Adam Munro and Karen Botting) with an open invitation to attend if required.

The meeting closed at 12.45pm.

CONFIRMED

B A Carter Chairperson

29 March 2018

 :3''0LQXWHV'RF5HI  Council Agenda - 28-03-18 Page 158

HAURAKI DISTRICT COUNCIL

EASTERN PLAINS DRAINAGE DISTRICT

MINUTES OF A MEETING OF THE EASTERN PLAINS DRAINAGE DISTRICT COMMITTEE HELD IN THE COUNCIL CHAMBERS, WILLIAM STREET, PAEROA ON THURSDAY, 22 FEBRUARY 2018 COMMENCING AT 1.30PM

PRESENT Messrs R Hunter (Chairperson), K J Reid, K R Caddy, T Nicholson, A Green, P Schouten, R Webster and Cr P Buckthought

IN ATTENDANCE Cr R Harris, S de Laborde (Infrastructure Systems and Planning Manager), Mr B Stephens (Drainage Overseer) and Ms C Black (Council Secretary)

APOLOGIES

There were no apologies.

LATE ITEMS

There were no late items.

CONFIRMATION OF MINUTES

EASTERN PLAINS DISTRICT DRAINAGE COMMITTEE MEETING HELD (30-11-17) (2344306)

RESOLVED

THAT the minutes of the meeting of the Eastern Plains Drainage District Committee held on Thursday 30 November 2017 be taken as read and confirmed.

EPDD18/01 Webster/Schouten CARRIED

MATTERS ARISING FROM THE MINUTES

There were no matters arising.

Flooding Issues/Coastal Inundation - January Weather Event - (Green Drain /Campbell Catchment)

Landowners - Peter McGaffen and Russell McGaffen were in attendance to address the Committee and staff on their dissatisfaction regarding severe flooding issues they have experienced to their properties during the extreme weather event which affected the Hauraki Plains/Kaiaua area in January.

They believed that the flooding on their farms has been exacerbated by the Green and Campbell drains not clearing water away fast enough in times of high rainfall and king tides causing their properties to become water laden over a long period of time. Grass and crops have been lost due to the severe ponding.

  (3''0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 159

It was agreed that a steering committee be formed to look at the implications of the flooding with WRC staff, HDC’s Steve de Laborde, Adrian de Laborde and the Chief Executive to address the issues involving the Campbell catchment as soon as possible.

RESOLVED

THAT a steering committee be formed consisting of WRC staff, HDC’s Steve de Laborde, Adrian de Laborde and the Chief Executive to look at the implications of the flooding affecting the Campbell catchment.

EPDD18/02 Buckthought/Webster CARRIED

The Chairman thanked the landowners for attending the meeting and voicing their concerns and advised them that the Committee would be in contact in due course to follow up on the issues raised by them.

DRAINAGE ACTIVITY REPORT – OCTOBER 2017 AND FINANCIAL REPORT FOR THE PERIOD FOR THE 4 MONTHS TO 31 OCTOBER 2017 (2306708)

The Infrastructure Systems and Planning Manager and Drainage Overseer presented the Drainage Report for January 2018 and Financial Report for the 6 months to 31 January 2018.

RESOLVED

THAT the report be received.

EPDD18/ Caddy/Buckthought CARRIED

Chemical spraying

48km of drains were sprayed to in January.

Machine cleaning

5.5 km of drains were machine cleaned in the year to date.

Maintenance/Fencing/Culverts

Routine maintenance items were undertaken.

Pump operation

Regular inspection runs were undertaken in this period. Pump hours for September were 244 hours.

0 man-hours were spent on screen cleaning in the period.

Floodgates

Floodgate inspections were completed. Cleared Mill Creek and Fishers Road.

  (3''0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 160

BY-LAW APPROVALS

There were no bylaw approvals granted.

SUBDIVISIONS COMMENTED UPON

There were no subdivisions.

RAINFALL

The table and graphs of the Ngatea Monthly Rainfall depths since 1993 were attached. The rainfall total for January was 100 mm. The year to date total from July 1 is 632mm.

CAPITAL WORKS

Stop bank survey

The Prices stopbank has been surveyed. The others will be done over the next few months. The results are quite favourable, see annexure.

Green’s Drain

Direction has been given from WRC to Hauraki DC to widen the Green's Drain as proposed. WRC believe that the current system can cope with this change in the drainage network which will connect to the Factory/O'Carroll's system. The drain will be designed to a 1.2 cumec max flow capacity.

As a result of this, the Campbell drain blocked would force the water along the Green's drain. The design still needs to be worked through to calculate the extra width required.

Steve de Laborde and Roger Hunter explained this is a remedial measure using the GIS advising that this should assist in alleviating the issues of flooding on Mr McGaffen's property.

Drainage Bylaw Review

Committee members were requested to consider the current bylaw and to provide feedback into the review process. Copies of the Drainage Bylaw were distributed.

GENERAL BUSINESS

South Catchments and Awaiti Canal - Lack of Tidal Movement

The Drainage Overseer presented some options that could be considered to address this issue of improve water flow out of the canal.

Roger Hunter asked if WRC could clean the Awaiti drain due to high silting and weed growth restricting the water from being released.

RESOLVED

THAT WRC staff de-silt the Awaiti Canal from the Northern end to the T-Head.

EPDD18/03 Webster/Schouten CARRIED

  (3''0LQXWHV'RF5HI Council Agenda - 28-03-18 Page 161

Roger Hunter left the meeting at 3.30pm. Deputy Chair, Kim Reid took the Chair.

Ross Harris left the meeting at 3.40pm.

MEMBERS’ COMMENTS

There were no significant comments made regarding the member’s drainage areas.

The meeting closed at 3.45pm.

CONFIRMED

R Hunter K M Reid Chairperson Deputy Chairperson

29 March 2018

  (3''0LQXWHV'RF5HI