DOCSLIB.ORG

Supplement Data Supplemental Table 1. Stem-Loop Structure

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supplement Data Supplemental Table 1. Stem-Loop Structure Supplement Data Supplemental Table 1. Stem-loop structure oligonucleotide sequences. tgctgttgacagtgagcgaccagatacctgcaccaccttatagtgaagccacagatgtataaggt MMP2 ggtgcaggtatctgggtgcctactgcctcgga tgctgttgacagtgagcgccgatgctgccatttctaataatagtgaagccacagatgtattatta MMP3 gaaatggcagcatcgatgcctactgcctcgga tgctgttgacagtgagcgcgcaaggttatcccaaggatattagtgaagccacagatgtaatatcc MMP8 ttgggataaccttgcatgcctactgcctcgga tgctgttgacagtgagcgccgacatagacggcatccagtatagtgaagccacagatgtatactgg MMP9 atgccgtctatgtcgttgcctactgcctcgga tgctgttgacagtgagcgacgagcctgaatttcatttgattagtgaagccacagatgtaatcaaa MMP10 tgaaattcaggctcggtgcctactgcctcgga tgctgttgacagtgagcgagcaatatttcagctaccaatatagtgaagccacagatgtatattgg MMP11 tagctgaaatattgcctgcctactgcctcgga tgctgttgacagtgagcgccgcgggaatcctgaaggagaatagtgaagccacagatgtattctcc MMP13 ttcaggattcccgcgatgcctactgcctcgga tgctgttgacagtgagcgcggctgacatcatgatcttatttagtgaagccacagatgtaaataag MMP14 atcatgatgtcagccttgcctactgcctcgga tgctgttgacagtgagcgcggccacaccttcttcttccaatagtgaagccacagatgtattggaa MMP15 gaagaaggtgtggccttgcctactgcctcgga tgctgttgacagtgagcgaggcaaacgtgatgtggatatatagtgaagccacagatgtatatatc MMP16 cacatcacgtttgccgtgcctactgcctcgga tgctgttgacagtgagcgcaggaaggatattacacctatttagtgaagccacagatgtaaatagg MMP24 tgtaatatccttcctttgcctactgcctcgga tgctgttgacagtgagcgaccgactcctgctatacctttatagtgaagccacagatgtataaagg ADAM8 tatagcaggagtcggctgcctactgcctcgg tgctgttgacagtgagcgcgccatttcactctgtcatttatagtgaagccacagatgtataaatg ADAM10 acagagtgaaatggcatgcctactgcctcgga tgctgttgacagtgagcgccgacatcctctccttagctaatagtgaagccacagatgtattagct ADAM17 aaggagaggatgtcgttgcctactgcctcgga MOCK tgctgttgacagtgagcgcggcttcagactcattattatatagtgaagccacagatgtatataat *(clock) aatgagtctgaagccatgcctactgcctcgga * The shRNA targeting the clock gene (circadian locomoter output cycles kaput) was used as the mock shRNA in all experiments to test the target specificity. Supplemental Table 2. Primers used for RT-PCR for mouse MMPs (mMMPs) and human MMPs (hMMPs). Forward Reverse Size (bp) mMMP-2 caccaccacaactgaaccac ctcagaagagcccgcagtag 199 mMMP-3 cactccctgggactctacca tggtgatgtctcaggttcca 201 mMMP-7 gatgatgaggacgcaggagt cagcgtgttcctctttccat 195 mMMP-8 agctgtcaagggctgaagtg taccttggcctggttgaaag 201 mMMP-9 caccaccacaactgaaccac ctcagaagagcccgcagtag 199 mMMP-10 cactccctgggtctctttca tttgtctggggtctcaggtc 201 mMMP-11 tgagccttagcccagatgac aagagctctcctcggatggt 199 mMMP-12 cccagaggtcaagatggatg aagtctccgtgagctccaaa 202 mMMP-13 tttattgttgctgcccatga ctctggtgttttgggatgct 198 mMMP-20 cgacaatgctgagaagtgga gggtccgtataatgcttgga 202 mMMP-23 cgtcccagtgacctcaagat gccaaacacctttcttccaa 199 mMMP-14 (MT1- ccctaggcctggaacattct tttgggcttatctgggacag 200 MMP) mMMP-15(MT2- cctcccacgacaagaactgt ggaaagaagctgcagaatgc 200 MMP) mMMP-16 (MT3- ggagacagttccccatttga cgttggaatgttccagtcct 196 MMP) mMMP-17 (MT4- caggaggaactgtccaaagc ccctccaagaaaggttcctc 202 MMP) mMMP-24 (MT5- gacgcagcctatgaaagagc gtaccgttcgcctttgaaga 201 MMP) mMMP-25(MT6- ccatcagcaacacaggtgac cgcagtgacaatcacagctt 201 MMP) mMMP-26 atgcatgctctgctacacca cacattgctccagatggaaa 276 hMMP-14 ctctcttctggatgcccaat acctccgtctcctcctcagt 300 Supplemental Table 3. Primers used for RT-PCR for mouse ADAMs (mADAMs) and human ADAMs (hADAMs). Forward Reverse Size (bp) mADAM 2 tgagcatatcggggctga agcatggggctagcgtat 397 mADAM 8 tgtcctggagggaacagaa aaccggttgacatctggaa 400 mADAM 9 catgaattggggcataac ctcactggtcttccctct 399 mADAM 10 agcaacatctggggacaa aaagttgggcttgggatc 398 mADAM 12 ccttaagatgaccaagta cattcagacagccccctt 401 mADAM 15 acaagcatcttaggcgttg ttgacaacagggtccatca 400 mADAM 17 tgagcgattttgggatttc gtccttctcaaatccgtca 405 mADAM 19 tgctcagctaatcacggg gaagacggtgaagaatgt 402 mADAM 33 gtgattgctgtgcgaggt gtgccgcacatagtgact 398 hADAM 10 tccggaatccgtaacatcag agtttgtccccagatgttgc 450 hADAM 17 tcattgaccagctgagcatc gagtctgtgctggggtcttc 400 Supplemental figure legends Figure S1. Suppression of the expression of ADAM 10 or ADAM 17, but not MMPs, inhibits MICA shedding in Myc-CaP-MICA cells. A Real-time RT-PCR showing shRNA suppression of MMP and ADAM expression in Myc-CaP-MICA cells. B. Degree of MICA shedding in Myc-CaP-MICA cells with the suppression of indicated MMP or ADAM expression. ** p < 0.01 when compared to cells expressing mock shRNA. Figure S2. MMP14 and ADAMs independently regulate MICA shedding in TRAMP-C2- MICA cells. A and B, real-time RT-PCR (A) and flow cytometry (B) demonstrating that the expression of ADAM 10 was not affected by suppressing MMP14 expression in TRAMP-C2 cells. The anti-ADAM 10 monoclonal antibody MAB946 (R&D Systems) was used for flow cytometry analyses. Filled grey profiles, control rat IgG staining. C and D, real-time RT-PCR (C) and Western blotting (D) demonstrating that the expression of ADAM 17 was not affected by suppressing MMP14 expression in TRAMP-C2 cells. The anti-human and mouse ADAM 17 antibody PX084A (Cellsciences) was used for Western blot analyses. E and F, real-time RT- PCR (E) and Western Blotting (F) demonstrating that suppression of ADAM 10 or ADAM 17 expression has no effect on MMP14 expression at mRNA or protein level. G and H, co-silencing MMP 14 and ADAM 10 or ADAM 17 generates an additive effect in inhibiting MICA shedding. Co-silencing was done by sequential transducing MMP14-shRNA cells with ADAM 10 or ADAM 17 lentivirus. ** p < 0.01 and * p < 0.05 when compared to cells expressing mock shRNA. Data represent results from five independent experiments. Figure S3. Peptide sequence comparison of human MMP14 (hMMP-14) and mouse MMP14 (mMMP-14). Figure S4. Real-time RT-PCR showing relative MMP14 (A), ADAM 17 (B), and ADAM 10 (C) expression in representative human and mouse tumor cell lines. M12 and PC-3 are human prostate cancer cell lines. MCF-7 is a human breast cancer cell line. Primers used for human and mouse cell lines are listed in Supplemental Tables 2 and 3. Note different scales of relative expression in each plot. Figure S5. Overexpression of MMP14 in MCF-7 cells increases MICA shedding and reduces surface MICA expression. A. Real-time RT-PCR showing overexpression of MMP14 in MCF-7 cells. B. ELISA assay demonstrating that overexpression of MMP14 markedly increases MICA shedding in MCF-7 cells. **, p < 0.01 when compared to control MCF-7 cells. C. Flow cytometry demonstrating that overexpression of MMP14 reduced surface MICA expression on MCF-7 cells. Filled grey profiles, control rat IgG staining. Figure S6. Histograms of flow cytometry showing MIC (A and B) expression on MCF-7 and M12 cells. Cells were stained with control mouse IgG, anti-MIC(A/B) mAb 6D4.6, or anti- MICB MAB1599 (R&D systems) followed by PE-conjugated goat anti-mouse IgG. Grey filled profiles, control mouse IgG staining. Filled black profiles, mAb 6D4.6 staining. Open black line profiles, MAB1599 staining. Data show that neither MCF-7 nor M12 cells express MICB. Figure S1 A 1.6 1.4 1.2 1.0 0.8 0.6 Relative0.4 expression 0.2 0.0 B mock shRNA Specific shRNA MMP2 MMP3 0.3 MMP9 0.2 MICA shedding 0.1 MMP11 shRNA: MICA (SN : LY) 0 ADAM10 mock ADAM17 MMP-9 MMP11 MMP15 MMP24 ** ** ADAM10 ADAM17 Figure S2 A B TC2-MICA ADAM10 TC2-MICA 1.5 TC2-MICA- shRNA MMP14 TC2-MICA- 1.0 shRNA ADAM10 0.5 ** Relative expression 0 1 2 3 4 0 1 2 3 4 0.0 10 10 10 10 10 10 10 10 10 10 shRNA: mock ADAM10 MMP14 ADAM 10 C D ADAM17 1.2 17 AM P14 shRNA: D 1.0 mock M A M 0.8 0.6 ADAM17 0.4 ** Relative expression 0.2 ERK 0.0 shRNA: MOCK ADAM17 MMP14 F E 4 10 MMP14 1 M 17 shRNA: ck P M o DA 1.2 MM A DA 1.0 m A 0.8 0.6 MMP14 0.4 ** 0.2 Relative expression 0.0 ERK 4 ck 1 10 17 shRNA: P mo AM AM MM D D A A G H 1.4 MMP14 1.2 1.2 1.0 * * 1.0 0.8 0.8 0.6 0.6 0.4 ** ** ** ** ** 0.4 ** 0.2 MICA shedding MICA(LY:SN) Relative expression 0.2 0.0 0.0 10 17 7 10 k 10 17 shRNA: AM AM MOCK D D shRNA: P14 M MMP14 A A moc M AM ADAM M DA D / A A /ADAM1 4 4 / ADAM17 14 1 1 P P MM MMP MMP14/ADAM10 MM Figure S3 hMMP-14: 1 MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS mMMP-14: 1 MSPAPRPSRSLLLPLLTLGTALASLGWAQGSNFSPEAWLQQYGYLPPGDLRTHTQRSPQS ******* * **************** ** * **************************** +- hMMP-14: 61 LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ mMMP-14: 61 LSAAIAAMQKFYGLQVTGKADLATMMAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQ ********************* ** ************** ******************* hMMP-14: 121 HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF mMMP-14: 121 HNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIL ******************** ************************************** hMMP-14: 181 FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE mMMP-14: 181 FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHE ******************************************* **************** hMMP-14: 241 LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT mMMP-14: 241 LGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTT ********** ********************************* ** *********** hMMP-14: 301 SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF mMMP-14: 301 SRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF ************ *********************************************** hMMP-14: 361 WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF mMMP-14: 361 WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF ************************************************************ hMMP-14: 421 WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG mMMP-14: 421 WMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG ********************* ************************************** hMMP-14: 481 NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA mMMP-14: 481 NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAA *****************************************************
Load more

Recommended publications
  • Discovery and Optimization of Selective Inhibitors of Meprin Α (Part II)
    pharmaceuticals Article Discovery and Optimization of Selective Inhibitors of Meprin α (Part II) Chao Wang 1,2, Juan Diez 3, Hajeung Park 1, Christoph Becker-Pauly 4 , Gregg B. Fields 5 , Timothy P. Spicer 1,6, Louis D. Scampavia 1,6, Dmitriy Minond 2,7 and Thomas D. Bannister 1,2,* 1 Department of Molecular Medicine, Scripps Research, Jupiter, FL 33458, USA; [email protected] (C.W.); [email protected] (H.P.); [email protected] (T.P.S.); [email protected] (L.D.S.) 2 Department of Chemistry, Scripps Research, Jupiter, FL 33458, USA; [email protected] 3 Rumbaugh-Goodwin Institute for Cancer Research, Nova Southeastern University, 3321 College Avenue, CCR r.605, Fort Lauderdale, FL 33314, USA; [email protected] 4 The Scripps Research Molecular Screening Center, Scripps Research, Jupiter, FL 33458, USA; [email protected] 5 Unit for Degradomics of the Protease Web, Institute of Biochemistry, University of Kiel, Rudolf-Höber-Str.1, 24118 Kiel, Germany; fi[email protected] 6 Department of Chemistry & Biochemistry and I-HEALTH, Florida Atlantic University, 5353 Parkside Drive, Jupiter, FL 33458, USA 7 Dr. Kiran C. Patel College of Allopathic Medicine, Nova Southeastern University, 3301 College Avenue, Fort Lauderdale, FL 33314, USA * Correspondence: [email protected] Abstract: Meprin α is a zinc metalloproteinase (metzincin) that has been implicated in multiple diseases, including fibrosis and cancers. It has proven difficult to find small molecules that are capable Citation: Wang, C.; Diez, J.; Park, H.; of selectively inhibiting meprin α, or its close relative meprin β, over numerous other metzincins Becker-Pauly, C.; Fields, G.B.; Spicer, which, if inhibited, would elicit unwanted effects.
    [Show full text]
  • 2335 Roles of Molecules Involved in Epithelial/Mesenchymal Transition
    [Frontiers in Bioscience 13, 2335-2355, January 1, 2008] Roles of molecules involved in epithelial/mesenchymal transition during angiogenesis Giulio Ghersi Dipartimento di Biologia Cellulare e dello Sviluppo, Universita di Palermo, Italy TABLE OF CONTENTS 1. Abstract 2. Introduction 3. Extracellular matrix 3.1. ECM and integrins 3.2. Basal lamina components 4. Cadherins. 4.1. Cadherins in angiogenesis 5. Integrins. 5.1. Integrins in angiogenesis 6. Focal adhesion molecules 7. Proteolytic enzymes 7.1. Proteolytic enzymes inhibitors 7.2. Proteolytic enzymes in angiogenesis 8. Perspective 9. Acknowledgements 10. References 1.ABSTRACT 2. INTRODUCTION Formation of vessels requires “epithelial- Growth of new blood vessels (angiogenesis) mesenchymal” transition of endothelial cells, with several plays a key role in several physiological processes, such modifications at the level of endothelial cell plasma as vascular remodeling during embryogenesis and membranes. These processes are associated with wound healing tissue repair in the adult; as well as redistribution of cell-cell and cell-substrate adhesion pathological processes, including rheumatoid arthritis, molecules, cross talk between external ECM and internal diabetic retinopathy, psoriasis, hemangiomas, and cytoskeleton through focal adhesion molecules and the cancer (1). Vessel formation entails the “epithelial- expression of several proteolytic enzymes, including matrix mesenchymal” transition of endothelial cells (ECs) “in metalloproteases and serine proteases. These enzymes with vivo”; a similar phenotypic exchange can be induced “in their degradative action on ECM components, generate vitro” by growing ECs to low cell density, or in “wound molecules acting as activators and/or inhibitors of healing” experiments or perturbing cell adhesion and angiogenesis. The purpose of this review is to provide an associated molecule functions.
    [Show full text]
  • Nuclear Matrix Metalloproteinases: Functions Resemble the Evolution from the Intracellular to the Extracellular Compartment
    OPEN Citation: Cell Death Discovery (2017) 3, 17036; doi:10.1038/cddiscovery.2017.36 Official journal of the Cell Death Differentiation Association www.nature.com/cddiscovery REVIEW Nuclear matrix metalloproteinases: functions resemble the evolution from the intracellular to the extracellular compartment Yingqiu Xie1,2,5, Aidana Mustafa1,5, Adina Yerzhan1,5, Dalmira Merzhakupova1, Perizat Yerlan1, Askarbek N Orakov1, Xiao Wang3, Yi Huang4 and Lixia Miao2 Matrix metalloproteinase (MMP) is defined as an endopeptidase in the extracellular matrix (ECM), which plays essential roles in physiological processes such as organogenesis, wound healing, angiogenesis, apoptosis and motility. MMPs are produced and assembled in the cytoplasm as proenzymes with a cytoplasmic domain and require extracellular activation. MMPs can degrade receptors, extracellular matrix proteins, PARPs and release apoptotic substances. MMPs have been found in the cytosol, organelles and extracellular compartments and recently many types of MMPs have been found in the nucleus. However, the mechanisms and roles of MMPs inside the cell nucleus are still poorly understood. Here we summarized the nuclear localization mechanisms of MMPs and their functions in the nucleus such as apoptosis, tissue remodeling upon injury and cancer progression. Most importantly, we found that nuclear MMPs have evolved to translocate to membrane and target ECM possibly through evolution of nuclear localization signal (NLS), natural selection and anti-apoptotic survival. Thus, the knowledge about the evolution and regulation of nuclear MMPs appears to be essential in understanding a variety of cellular processes along with the development of MMP-targeted therapeutic drugs against the progression of certain diseases. Cell Death Discovery (2017) 3, 17036; doi:10.1038/cddiscovery.2017.36; published online 14 August 2017 KEY FACTS MMP-10, MMP-13 and MMP-14.
    [Show full text]
  • Gene Symbol Category ACAN ECM ADAM10 ECM Remodeling-Related ADAM11 ECM Remodeling-Related ADAM12 ECM Remodeling-Related ADAM15 E
    Supplementary Material (ESI) for Integrative Biology This journal is (c) The Royal Society of Chemistry 2010 Gene symbol Category ACAN ECM ADAM10 ECM remodeling-related ADAM11 ECM remodeling-related ADAM12 ECM remodeling-related ADAM15 ECM remodeling-related ADAM17 ECM remodeling-related ADAM18 ECM remodeling-related ADAM19 ECM remodeling-related ADAM2 ECM remodeling-related ADAM20 ECM remodeling-related ADAM21 ECM remodeling-related ADAM22 ECM remodeling-related ADAM23 ECM remodeling-related ADAM28 ECM remodeling-related ADAM29 ECM remodeling-related ADAM3 ECM remodeling-related ADAM30 ECM remodeling-related ADAM5 ECM remodeling-related ADAM7 ECM remodeling-related ADAM8 ECM remodeling-related ADAM9 ECM remodeling-related ADAMTS1 ECM remodeling-related ADAMTS10 ECM remodeling-related ADAMTS12 ECM remodeling-related ADAMTS13 ECM remodeling-related ADAMTS14 ECM remodeling-related ADAMTS15 ECM remodeling-related ADAMTS16 ECM remodeling-related ADAMTS17 ECM remodeling-related ADAMTS18 ECM remodeling-related ADAMTS19 ECM remodeling-related ADAMTS2 ECM remodeling-related ADAMTS20 ECM remodeling-related ADAMTS3 ECM remodeling-related ADAMTS4 ECM remodeling-related ADAMTS5 ECM remodeling-related ADAMTS6 ECM remodeling-related ADAMTS7 ECM remodeling-related ADAMTS8 ECM remodeling-related ADAMTS9 ECM remodeling-related ADAMTSL1 ECM remodeling-related ADAMTSL2 ECM remodeling-related ADAMTSL3 ECM remodeling-related ADAMTSL4 ECM remodeling-related ADAMTSL5 ECM remodeling-related AGRIN ECM ALCAM Cell-cell adhesion ANGPT1 Soluble factors and receptors
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • ADAM10 (A-3): Sc-48400
    SAN TA C RUZ BI OTEC HNOL OG Y, INC . ADAM10 (A-3): sc-48400 BACKGROUND APPLICATIONS ADAM (a disintegrin and metalloprotease) proteins are a family of over 30 ADAM10 (A-3) is recommended for detection of ADAM10 of mouse, rat and membrane-anchored, glycosylated, Zn 2+ -dependent proteases that are involved human origin by Western Blotting (starting dilution 1:200, dilution range in cell-cell, cell-matrix interface-related processes including fertilization, mus - 1:100-1:1000), immunoprecipitation [1-2 µg per 100-500 µg of total protein cl e fusion, secretion of TNF (tumor necrosis factor α) and modulation of the (1 ml of cell lysate)], immunofluorescence (starting dilution 1:50, dilution neurogenic function of Notch and Delta. ADAM proteins possess a signal- range 1:50-1:500), immunohistochemistry (including paraffin-embedded domain, a pro-domain, a metalloprotease domain, a disintegrin domain (inte - sections) (starting dilution 1:50, dilution range 1:50-1:500) and solid phase grin ligand), a cysteine-rich region, an epidermal growth factor-like domain, ELISA (starting dilution 1:30, dilution range 1:30-1:3000). a transmembrane domain and a cytoplasmic tail. ADAMs are expressed in Suitable for use as control antibody for ADAM10 siRNA (h): sc-41410, brain, testis, epididymis, ovary, breast, placenta, liver, heart, lung, bone and ADAM10 siRNA (m): sc-41411, ADAM10 siRNA (r): sc-270165, ADAM10 muscle, and catalyze proteolysis, adhesion, fusion and intracellular signaling. shRNA Plasmid (h): sc-41410-SH, ADAM10 shRNA Plasmid (m): sc-41411- SH, ADAM10 is a TNF-processing enzyme that cleaves pro-TNF, a membrane- ADAM10 shRNA Plasmid (r): sc-270165-SH, ADAM10 shRNA (h) Lentiviral bound precusor protein, at Ala 76-Val 77, which causes membrane shedding Particles: sc-41410-V, ADAM10 shRNA (m) Lentiviral Particles: sc-41411-V of soluble TNF.
    [Show full text]
  • Prognostic Significance of MMP-1 and MMP-3 Functional Promoter Polymorphisms in Colorectal Cancer
    594 Vol. 11, 594–599, January 15, 2005 Clinical Cancer Research Prognostic Significance of MMP-1 and MMP-3 Functional Promoter Polymorphisms in Colorectal Cancer Franck Zinzindohoue´,1 Thierry Lecomte,2 INTRODUCTION Jean-Marc Ferraz,2 Anne-Marie Houllier,1 Matrix metalloproteinase (MMP) belongs to a large group Paul-Henri Cugnenc,2 Anne Berger,2 of proteases, which includes over 22 known human zinc- He´le`ne Blons,1 and Pierre Laurent-Puig1 dependent proteolytic enzymes. These are capable of breaking essentially all components of the extracellular matrix (1, 2). 1INSERM U490 Laboratoire de toxicologie Mole´culaire and 2 MMPs take part in high tissue turnover and remodeling, both Poˆle de cance´rologie Hoˆpital europe´en Georges Pompidou, Paris, France physiologic and pathologic conditions such as cancer. MMPs are also implicated in all steps of tumorogenesis, cancer invasion, and metastasis (3). Tumor invasion and metastasis formation ABSTRACT always begin with blood and lymphatic vessel infiltration. As Purpose: Matrix metalloproteinase (MMP) belongs to a these processes involve proteolysis of the extracellular matrix, large group of proteases capable of breaking essentially all MMPs are suggested to play a major role in tumor progression. components of the extracellular matrix. They are implicated Colorectal cancer is the most common malignancy of the in all steps of tumorogenesis, cancer invasion, and gastrointestinal tract. It is the third cause of cancer overall and metastasis. Among them, metalloproteinase type 1 (MMP- the second leading cause of cancer-related death in the Europe 1) is implicated in tumor invasion and metastasis in and the United States with an incidence of 300,000 new cases different types of cancers including colorectal cancer in (4).
    [Show full text]
  • Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation
    BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the filtration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green fluorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in
    [Show full text]
  • Extracellular Matrix Alterations in Metastatic Processes
    International Journal of Molecular Sciences Review Extracellular Matrix Alterations in Metastatic Processes Mayra Paolillo * and Sergio Schinelli Department of Drug Sciences, University of Pavia, 27100 Pavia, Italy; [email protected] * Correspondence: [email protected] Received: 17 September 2019; Accepted: 30 September 2019; Published: 7 October 2019 Abstract: The extracellular matrix (ECM) is a complex network of extracellular-secreted macromolecules, such as collagen, enzymes and glycoproteins, whose main functions deal with structural scaffolding and biochemical support of cells and tissues. ECM homeostasis is essential for organ development and functioning under physiological conditions, while its sustained modification or dysregulation can result in pathological conditions. During cancer progression, epithelial tumor cells may undergo epithelial-to-mesenchymal transition (EMT), a morphological and functional remodeling, that deeply alters tumor cell features, leading to loss of epithelial markers (i.e., E-cadherin), changes in cell polarity and intercellular junctions and increase of mesenchymal markers (i.e., N-cadherin, fibronectin and vimentin). This process enhances cancer cell detachment from the original tumor mass and invasiveness, which are necessary for metastasis onset, thus allowing cancer cells to enter the bloodstream or lymphatic flow and colonize distant sites. The mechanisms that lead to development of metastases in specific sites are still largely obscure but modifications occurring in target tissue ECM are being intensively studied. Matrix metalloproteases and several adhesion receptors, among which integrins play a key role, are involved in metastasis-linked ECM modifications. In addition, cells involved in the metastatic niche formation, like cancer associated fibroblasts (CAF) and tumor associated macrophages (TAM), have been found to play crucial roles in ECM alterations aimed at promoting cancer cells adhesion and growth.
    [Show full text]
  • Cadherin Disruption to Promote Melanocyte Loss in Vitiligo
    Type-1 cytokines regulate matrix metalloprotease-9 production and E- cadherin disruption to promote melanocyte loss in vitiligo Nesrine Boukhedouni1*, Christina Martins1*, Anne-Sophie Darrigade1,2, Claire Drullion1, Jérôme Rambert3, Christine Barrault4, Julien Garnier4, Clément Jacquemin1, Denis Thiolat1, Fabienne Lucchese1, Franck Morel5, Khaled Ezzedine6, Alain Taieb2, François-Xavier Bernard4, Julien Seneschal1,2, †, Katia Boniface1† Affiliations: 1INSERM U1035, BMGIC, Immuno-dermatology ATIP-AVENIR, University of Bordeaux, FHU ACRONIM 2Department of Dermatology and Pediatric Dermatology; National Reference Center for Rare Skin Disorders, Hôpital Saint-André, Bordeaux, France 3AQUIDERM, University of Bordeaux 4Bioalternatives SAS, Gençay, France 5Laboratoire Inflammation Tissus Epithéliaux et Cytokines EA 4331, University of Poitiers, Poitiers, France. 6Department of Dermatology, AP-HP, Hôpital Henri-Mondor, Créteil, France. *,† These authors contributed equally to this study. Corresponding author: Katia Boniface INSERM U1035, BMGIC – Immunodermatology team University of Bordeaux 146 rue Léo Saignat, Bâtiment TP zone sud, 4ème étage 33076 Bordeaux Cedex Phone: +33 (0)5 57 57 13 73 Email: [email protected] Supplemental Table 1. Distribution of individual features of 135 vitiligo patients depending on their spreading score Stable vitiligo Active vitiligo Feature (n=69) (n=66) Total (N=135) Sex, No. (%) Female 41(59.42) 45(68.18) 86(63.70) Male 28(40.58) 21(31.82) 49(36.29) Age at inclusion (years) Mean (±SD) 43.43(±12.98) 43.64(±14.32) 43.53(±13.65) Range 16-76 14-80 14-80 Age at vitiligo onset (years) Mean (±SD) 28.76(±14.93) 29.28(±16.87) 29.02(±15.9) Range 3-57 4-77 3-77 Disease duration (years) Mean (±SD) 14.75(±12.65) 14.79(±11.93) 14.77 (±12.29) Type of vitiligo, No.
    [Show full text]
  • Ultra-Processed Food Targets Bone Quality Via Endochondral Ossification
    Bone Research www.nature.com/boneres ARTICLE OPEN Ultra-processed food targets bone quality via endochondral ossification Janna Zaretsky1, Shelley Griess-Fishheimer1, Adi Carmi1, Tamara Travinsky Shmul1, Lior Ofer2, Tali Sinai1, Svetlana Penn1, Ron Shahar2 and Efrat Monsonego-Ornan 1 Ultra-processed foods have known negative implications for health; however, their effect on skeletal development has never been explored. Here, we show that young rats fed ultra-processed food rich in fat and sugar suffer from growth retardation due to lesions in their tibial growth plates. The bone mineral density decreases significantly, and the structural parameters of the bone deteriorate, presenting a sieve-like appearance in the cortices and poor trabecular parameters in long bones and vertebrae. This results in inferior mechanical performance of the entire bone with a high fracture risk. RNA sequence analysis of the growth plates demonstrated an imbalance in extracellular matrix formation and degradation and impairment of proliferation, differentiation and mineralization processes. Our findings highlight, for the first time, the severe impact of consuming ultra-processed foods on the growing skeleton. This pathology extends far beyond that explained by the known metabolic effects, highlighting bone as a new target for studies of modern diets. Bone Research (2021) ;9:14 https://doi.org/10.1038/s41413-020-00127-9 1234567890();,: INTRODUCTION penetration of blood vessels and bone tissue formation by The vertebrate skeleton has evolved as a dynamic system that osteoblasts.1,2,4,6 The EO process is tightly orchestrated by various serves numerous functions, such as protecting internal organs, signaling molecules and transcription factors, including transform- creating attachment sites for muscles to produce locomotion, ing growth factor β/bone morphogenetic protein (BMP), fibroblast providing a reservoir for minerals, and serving as a hematopoietic growth factor (FGF), Wnt, hedgehog, and the transcription factor niche.
    [Show full text]
  • Mapping Transmembrane Binding Partners for E-Cadherin Ectodomains
    Mapping transmembrane binding partners for E-cadherin ectodomains Omer Shafraza, Bin Xieb, Soichiro Yamadaa, and Sanjeevi Sivasankara,b,1 aDepartment of Biomedical Engineering, University of California, Davis, CA 95616; and bBiophysics Graduate Group, University of California, Davis, CA 95616 Edited by Barry Honig, Howard Hughes Medical Institute, Columbia University, New York, NY, and approved October 28, 2020 (received for review May 22, 2020) We combine proximity labeling and single molecule binding assays proteins that directly interact with a transmembrane bait would to discover transmembrane protein interactions in cells. We first be positioned in close proximity to both the bait’s ectodomain screen for candidate binding partners by tagging the extracellular and cytoplasmic regions. Consequently, if the proximity-based and cytoplasmic regions of a “bait” protein with BioID biotin ligase labeling enzyme was fused to both the bait’s extracellular and and identify proximal proteins that are biotin tagged on both their cytoplasmic regions, identifying transmembrane proteins that extracellular and intracellular regions. We then test direct binding are biotinylated in both regions would enable us to narrow interactions between proximal proteins and the bait, using single down the list of possible binding partners for subsequent AFM molecule atomic force microscope binding assays. Using this ap- binding measurements. Furthermore, an integrated extracellu- proach, we identify binding partners for the extracellular region lar and cytoplasmic BioID measurement would significantly of E-cadherin, an essential cell–cell adhesion protein. We show that increase the precision of the screen by dramatically reducing the desmosomal proteins desmoglein-2 and desmocollin-3, the focal the number of false positive hits.
    [Show full text]