COG4 antibody - middle region (ARP55242_P050) Data Sheet
Product Number ARP55242_P050 Product Name COG4 antibody - middle region (ARP55242_P050) Size 50ug Gene Symbol COG4 Alias Symbols COD1; DKFZp586E1519; CDG2J Nucleotide Accession# NM_015386 Protein Size (# AA) 789 amino acids Molecular Weight 89kDa Subunit 4 Product Format Lyophilized powder NCBI Gene Id 25839 Host Rabbit Clonality Polyclonal Official Gene Full Name Component of oligomeric golgi complex 4 Gene Family COG This is a rabbit polyclonal antibody against COG4. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ Target Reference Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718 Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.Multiprotein complexes are key determinants of Golgi Description of Target apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4 (Ungar et al., 2002 [PubMed 11980916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-265 AK096557.1 1-265 266-555 BP282697.1 230-519 556-1072 AU125729.1 34-550 1073-2838 AL050101.1 375-2140 Partner Proteins COG1, COG2, COG5, COG7, COG1, COG2, COG3, COG5, COG7 Reconstitution and Add 50 ul of distilled water. Final anti-COG4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-COG4 antibody is Catalog # AAP55242 (Previous Catalog # AAPP33069) Immunogen The immunogen for anti-COG4 antibody: synthetic peptide directed towards the middle region of human COG4 Swissprot Id Q9H9E3 Protein Name Conserved oligomeric Golgi complex subunit 4 Sample Type Confirmation COG4 is supported by BioGPS gene expression data to be expressed in 721_B Protein Accession # NP_056201 Purification Affinity Purified Species Reactivity Human, Rat, Dog, Horse, Rabbit, Mouse, Guinea pig, Bovine Application WB
Predicted Homology Based on Immunogen Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% Sequence Human, Mouse Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) 3. Human Cervical Cancer Cell transfected with Myc-COG4 (15ug) Primary Dilution: 1:1000 Secondary Antibody: goat anti-Rabbit Image 1 Secondary Dilution: 1:40,000 Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's Lab University of Arkansas for Medical Sciences See Customer Feedback tab for detailed information.
Human 721_B
WB Suggested Anti-COG4 Antibody Titration: 0.2- 1 ug/ml ELISA Titer: 1:312500 Image 2 Positive Control: 721_B cell lysate COG4 is supported by BioGPS gene expression data to be expressed in 721_B
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.