pîoneerlocal.comgXRY MARCH 19, 2009 * A PIONEER PRESS PUBLICATION * $2.00 NILES j

THIS WEEK DIVERSIONS

CLICK ON OUR b' WEBSITE TO SEE Spy VS. SPY THESE STORIES Julla Roberts and Clive

, AND MUCH MORE Owen star in aiDupIicityr z4/i. featured this week in ' Film Clips.

Daily News from SEE PAGE 02 y.ur. Local Source ,.

SUBURBODDITIES FOOD Wacky crooks and their crimes

BLOGS Entertaining Ideas looks atpop culture

EATING RIGHT Healthy food choices. can even include Clare huller of NIes, wfth her children Mark, 5, and SKATING Amanda, 7, get to skate durrnq St. Patrick's Day pancakes. ice skatinq at IceLand Skate and Swim Corniez ¡n Nies. SEE PIONEERLOCALCOM GREEN (Herb Shenkln/For Pioneer Press)

SERVING OUR READERS SINCE 1951 * YOUR LOCAL SOURCE Start here withahealth caìe career. Ot1O9 lI 93-4 Attend a free Health Care Information Session. Is NU1NQ M 0969 Pharmacy Technician and .L$XQ.i.ra ¿èeIax1 AwaIi 3X1Ofl. ci-ir S1XNs- Aseptic Pharmaceutical Preparations Thursday, April 2, at 6 p.m., Skokie Campus, Room A151 00:E10(0Q0O00 Oo39t;91t For more information, call 847.635.1629. 1&ri L 7701 N. Lincoln Avenue, Skokiewww.oakton.edu CommunityColle'- ir A S'lorreor ANION ONAAtlliN-AlNONS Tku1oNloy, Morok Il,ZOtlSJ3 A 'NOON l'ROMA

MONARINR EDOTBBN H100 Albedo MARINO REALTORS- News m.NbirIsApN000000l550LOOSeO 110471 4R61209 Oniuiv 5800 Dempster-Morton Grove Maine Township candidates face crime issues (QUO MILOS NLLNNNIOAMO.000LA_ A m 000-NNO I I The Gold Standard www,cmntury2lma(lflM.00m By JENNIFER JOHNSON 450i0005'p (ANO tod oreo orN JjOhn000@p10000I/000/.cAm Unincorporated areas of Maine Township yridoy sod Sotorduy migkto. For Cook Colooty Aher- Cumdidoteu rooning for ISA/s POISoN, liso 04000img of ooperoiscr ofíoloiee Th050- oprimg uoloero in 1ko Or- ship AgrIe Ske arco 000ld risSol ofoomotkioSg teso ap- Novo moro Ifflboro, hut ouy 700050441w potAloI in- fondo aim nob 000iloble foe 000000 in gonM wc050ity. mere "hiom beoko." At W More/s S meotimg "Yoa always wonS moro SIMPLY SENSATOONAN' NEWCONSTRUCTION - ONLY $790NSI llORE FOR MOONS MORE/O ORIGONAL OWNERS PRIDE & JORA oluninborpNr0000l Moine offocern entise 000001, hut MONtAR SN000...J001 A/sIedA SI0RRInO SPIN-/Aol ro/ob MAIAEN SINAO...A000IO/O/y A A/ANNA IN GANOSO & MANAR Sl000...Nom LINA/TUI 00(5/000 roo/y AUN/SEO MASON SE050...FIIOA 0/UNI UNbo/levoSo 0000/y h it boeomwo o motter of 000S3MI00200thN/Wo/I000Y000dI00000ANNpOOIIA/NO AIA/INNE0000/p/MOAM/IANRN 2AtOrO IO/OR M/AOU 401-250/ SpI,/-/000/. 00F (OlIN. (bo/I-/o 005k 00000 000lpo! ChoImlsL & 0000p?OA100 S NANNY bl/AN lONm Tomsoshipk Neighboo'kood SPOON 04 maIR leoNi. Chef's kAOlINS ON/MD' ANA/lOtO,OtklN0050.00kIIAArs, IONNIFGIOO/t0/0/0Rdk/AO/ERNW/42ON /04 I/SAN Lb/SU 101/dAINO 44 In/MO/O F01400 1111. Copo Cod AO 000125/0/ SoPmobRoorpIao. SNININIIO Wotek, dopSoty Cmdr, As- how do wo pAy them," neid AMBITO COSMOS 000001 IN/and MOI Rodeo/good /oweI 000100$, SS app/s & oop 2.00klaol0100. Spao/Auooat-IN klIcken. 00go 0000monA WON 000I000d sewer w//A SAUIIEAOA ISA/NA APUNO to orge sunny molo Toot Tron100 Peter Ryoo, who OSmA 4/lUIR//A 01 & tu/I NOII. AIOIAW250 tAM. (ARNO ILREOYRRR NA/PP $ FIONNI1 dOOM t/sony Or000miok twIrl rosi- NO POlIO. MOOINRNANNNO & SAlOP(Alp.2001M hoot/NO -I- ANT/Aol 0/1.21/2 Aal tUlOIIy000w. 000 /00w ORdONONESON IN 00100/NERI AA/SITO io rhaOlenging incombent SONNO/NO RIN 00 2 AOl (01. 0ISh000IANOI IONd000PN. hON Oath NI/OAR/SO, whIR/pool Nob &oop 1/oso o/AAwor NT0000d005NEUN NANtIS ININ00000U loll toNo/Od 4001 ERE b S 5M. SO4000I0 dIR/TO NERA. FAIl ONINIEO( bowl donAs thoO oo 5ko 01005/ANN P0001 MEtO/A patIN. NOON /0401 PAIllA ------(Ago'sONO/U Ao/I 001lIt. SOON a/SANA Soll DIOS A/TI ------$7000 011044/NA, Sohoolo, MMM. 000&//bIOIy/------$3/0,000 NS/rOO RIRI, (NP/ONO & mot bON OBRO OOtOrt/ ------$4020 soonoos, officers will be SoporuOnor Coral Toorhhy. mo/sing their 7050001e Teschky ooid tau oops mod hnowss in tOse oreo ond Will bodgot OonotroinOa pRe- oundroot outdoor roll OASIS vent the township from POa'SiCNOAOrI2'Mt Robin poying odditionol ulfioer Grime and Dompotor A/OreeN, on wroo losoWrSn for Ryan eolIoS the area's gong oo/snity. police c000roge "Joot above 'We'll kw sondiog o 2 the loo of odeqr000e," while mesA/ge Abat owAhiog'o go- Thnehhy ogreed Nollocera &1(±±MQ54010 PN/AMARI IS 101E WORST 021$TANFDINA MOR2050/RF" LOCATION RPNIC5I PISES MORE SPAA7F FOR A SHEAr PRICE?? AFAOIN...SAISOAAO Oo/idNEioAOl-/esoIw SN/100I5IOIION MAIO2 AINAN...00IO/y 000ilAblo'Out//NAyCANIN MOIN000E000..,PSA005IONONSI000II1JAI00000510/IN SOS------1/NA MON 1100E ONO N/IA opOAI000 NOM b/AU ing OW be 5000N000SN" ore 'aS spreod pretty 7301.0(0, bl/AlI1001 pIso. Abro & 2 1,51/ SPOONed 14001/0000/ OwothNOkARg ANO SoloMo LOMO 112/lS7101 AI-/SANI w///gh/, a/y lioso (lao. CollioNlol Aol/loo, $040110 NA/NedNOON/I/E OOEAIOOSIRL 10000001 LOlOS Arewoniob soiS. thiot' PAlPA. W000 004011/A tIlo 10004 A/OMM/AA IloldwoodNOI AA/hLl0000d TIRO & 000/led NR/lIRA. Soy S/oil0 10100 (IA N/eOAiNg AMA & wAdOM 000000k/IO (I/AO/O //S/TAII1E&ENpd/NINONw. AS bM&2NIo000aMlo NaSO. Gong oetivity ken lomg Aeeeenioh odmitNod the AONIO & ANOI001 00111001 S//ndo. EL/-II k//Shell WIth 00,3 hugo 0M & 2/0 bollo.MSS 114020m NO/NAO/O-IRFold 00000, ANUO WOO/NI SI AN//N No/ANO//A-il 21000/ & CA/-IO OOARON. MOAANINE N/TM/I baS. PA/I 110/0005 NOmI ROW Opp/l00000 M ooEom/o A/NtIoA, Now w/ndowo AnN A/Noel, 000001, sOp 000001 0 dAMN/N MONI/y. Fanli/y NM mootol bath. L000IY aMI/yEm 4/SI/S/IA O/ONO @00(0 w//l090raoIm,MaAhoI.ha/lbolh,450N/S/AoO/050l&NRAp beow 00 SonAr for 1/sm unin- county in "upeeolirg with a 20010. f50401 NOON.A0 MAI, new OMEN dONO 2 ½ oar 0//NE_AMASS I/EoMtllNyiaAm.Ea/-I00000000l000/oolF bodA SA/lA yard, 0100/0(0001 NOEOUO NA/S/root ONUS, 00/01000.2 NOUIONS L520IOSI50000IAO/O,Nh005/RO ham ndnimoom number of 001000. LARONOS500NOER/ol00000rpRIloroI corporoded oreo, with two .... 035go LAMOR I000/ RNA 0E, 2 OUR UNI. NONE MO------0300'o 0MIIlAI/0AIOE ...... 03300021/ IRSTodoyl & 0011/ So/olI SirIrlot /0 Al ...... $SAO,000 olMcere," although new re- NNNNO feudiwg Hioponiogangn deal wit/s tkem. that bao 010imed Golf Ter- Nos beicg parE ofo nil- klo (Nro naonbee of Mom- otoisoing tOeritOofy in 000amwniAh told moi- race 0000M territory. Inge Sr ciTy mo/sso tho oorpoosled moos spread cruilo ore uwdorgoing training. (I - denoely popsolotod p01(0000 Sento that dAmage SoDA The NOmR two gongs more han A/N/MM resi- acceso a large 000tixn uf of Ihr Sovl000hip, Drug vehicles porbed niNloie S/so left dueling goafliti dento of anincorprlmtod northern Cook County ond BetON Ryan ood Thschluy I0enliograffiti boo'g lo- Golf Terraoe apardmenl opeoyed wce000 the wall of Mein T000nosloip depend- moy nnt aboyo have a said Ikey area pleooed NSNOA proper/sR damoge complex during Che early oflebin Drive tnwnhoone, ents Anon the Cook ountinNosrAN, 24-hour preo- wilh the worh sheriEf k po- 005. soommlimeo, viot000e kooro ef Fob, 7 woo goog wand eodw enfnrcemesb of- County Shcrill'N Depart- once in Maine Ths0000ldp. Meo hooe done in regards bolo boon ottrìkutwd NM motivoled. He said wino- ficer ito/sort Peoro/A. The weot orpolire oervieox, o Ana reoult, the Meine to curbing gang aotini/sr department funded by Township Sourd hoe, for ond erwdiootiog goofhiti in FANUL0050S"OAAKTON TER$&CS" C/NM/I Abose two googo, ond N/se dows And/se vehicles worm graffiti woo removed CORSO NOVIllO AT TA MESTI NNEYNEPORLE LOW PRISES '$0590055 510&N...SMpoN/y L000tod 5100w ColMo aSI000 fEUIl SNOWS LIOSO ATRUP MODELl nhoriff k deportmono hoe smo0000d ouI, ond investi- nhoetly oftor o call lo Cook koopayers from ceroso the seveeol ymaroA sot aside u ow/Aft manner. MON/OR Sr000,.,AA0NI 0(001000 1/0111 SA bOUlA 51m SI/00.,.MOMO/1IANIESANtAO 50100e/05 I/Ao, CNOSS DAN P/A/Iou ..AENA/l/a&og 0100m ToNAr/soaso Sa//A/O Libr0Ey AJO 0100/AS to DOMIIOWI SOAI/Ol P101/ON 201-2 CAnI/A rear 005ppllg, boo, 101500 000101, IeOAoslallo oouoty The sloeeilf k po- Saodiug tu "Idre hoch" on Ioloomy om005y/ LuN/Ng 100m o/iI 1011101 SIAIA OINO,70551/3 bNoroomo 01 II IN/ho 2.1103/NONIO oIl/NinA ooboblinbwd a gong noiI gotom holieve it woo rASoI- County/s gro/USo removol boll NIA AlcI. MII lOW 501(0510, I/oIl 1IAIIIIOO 0,10001SA mONO1 FO/sl/Sao p110010 bo/AANE ON//N000I/tO/ All I/OSI AlUN NOI-/RI k/lAbor 10/Oid/RS I/Moro Io bol000y /100OFOAN, SSÍA0000 OSI Il/s/S/OR W/42 Nab/IN/s. 01001ro witbln Maine 'lkwnoohlp So iotioo ogo'mOI bbs gonog deportment, lleeN hxwevor are reoposAni- 0150er to patrol juot the CRUmOMA $sfle.deNU Opp/I00500 &SAArteluNp. 11001100/101 I/NINO 05001000 A/ONO, 1/Allg Nll000I000AIO1SNNy,IOEIIM/ SipAlog Em & 000110 O/NOS 17'rnoouor bow/boll,, br-olI! boAndly. /101110 11/ 0(000 ElIO plya/e bo/OSIy. P5440/ 51,1109 0000/011572 0510/0/000 o/Nel SppIioAoNo. 0015004 olI NIFSOtR000t-lllk/toS/Oe0000iErto,OAAUINIO o/pl/0000SI 001 00440 07000, 14M 010111/I 050NA000I/ lIS/AIRO 1W & /AMAR maNtel 5100/Io W/ONO/k.Ifl A/500I, FlIlIlNo. A/O/RAlO W/IIIOPIOAO. Molo DOOR banNIR Ill /501 & 1/000 HOUR 20' 1100101 SS ad/o N/wa/A-/I 010011. NNOpool.lOROS OOLItO & 00010/00 Im LAAN led ANOI 210101/ 001000. C/Aol to OOIOAO. R0SAIA00E052L/.rI...... 1/95,000 OhASPIOO & IMflO5OII0000. 51000/nO NINOCIOWbOIO. I OONNPOSO------51000NIISP/IIA, E0AAOSINO/M &AIolOpSriAIlonil Visit our website wWwcentury2l marino cornLOM000100MONIOI ...... 5000.0 NMN-IINALOII-AN51201MAN] Hanusiak outragedovercampaign sign thefts OMNA'OAl 1mo publio ntatemeNt 0W io/smidotioO,A meNto the oihle anti-establishment Honuolalo said his eem- hume 000dloeted my coon- NANO MANGO - ATA/NAO- ANNOICLIIANNA1104111M By TONY BERTHES 0001 ANCNNANO - AA.ION_LMINI INdIN Ill-A UNII] NNI,El 05 SMAINI-AIISIII4IIIINNILINIINII lborloCaApioAeeII000I.cSm leased olor the wee/soLoS, FoUoh-hnre llN000aiah. ehoieo to oppose acting poign woe 000dueting on paigm'oo o digeoiAed meo- ATAN ARANA. OA?N.500- SANN OANNIIi.IiN NNNAA Alt/s dole in the oniddle of "They didn't rame bere Sa Moyor Robert Colbero and iooveotigution of Oho mutter nor, end I coold color 00ÑOS000 NINA MANSAISIO - 0014200 - R GAINA RAI-2MIII Eloe sig/si und it iodeSher- hove N/so 0000e Ob/sog hop- Trastee Rho Siederman. mod hoped other omoyxeol 0100pta nook oleooy moth- NNNNOAAAA. OlIAI- LAINNNVNNINNINRA NUI-N NAIN 0NN.iOAS0INllWlMSA.01IANA0RSAONNA1.NA Ndeo moyoral candi- doto lCryowtof 'Chris" ate and pAooned. TIlOs io mot pen lo their obddreo, o( mow there are soNne c000didotoowuuld con- NASA AREANNOAF - NINNA_PNINAM ANA' A AI-N 55010!10101 NATh000 pathetic rMvn- UNANRANNA. ONOOINI NIIAANN.A NA lIlA. ANII ONIIII AIRAIS ldonuoialo soiS ho oe NAboil dooM hy bids wafloing homo ilonoaoiok kas enrour- residootu who don't want demn the thefts, NOIA OAOIAII - NINGA - ANOdINE ARI AIANOMOIN 000NINAI IO ANION 00000 0 1NI0 h lANAS NO-1 001051 Sog mod"ofterhrmioAgeM- fasmoohool" aged blu Oupportero tocen- One os mayo01" H000uuiolo "0 do not huyo verifed, ardo ohoold be aohxmod of OI/NSNINRiI001 101A INNI. AUNAN- ANIINNIIN NOLiSANI-1 NY UNNA porlo from oroppuo'tem Abat Sook toe/sos oem mot aoo' loot the ootborities if ony onrobe. 4Thut/s their choice speciAc nomon that loon lhenooelncs. I mn fnndieg it RNA-ININNIIIINIII.ANAIIIAOIINNNI.ANAIAIÌ UNA hooeokofino l000lpo/sMoo, of their olges ore loeN- If you want Sn battle politi- give sut, ood I mill not hordor end border to ong ANNIGRIIO-NAIA,ONA- UNNNIIINI ANIlIN UNION- NAO. INNO OlION.1M - OIACASN. (NbA 15(4 EN W' IO INI AlbA 44mo of/sw 0500poigNAOigOSu 000100I1100N1IN11 - NAO uNNI INNO Nl. ASIlI III fAllI ¡RIMA NIA N ANION ASAN] SNSIIIII.SAIIIAIIINIIIN0ISAS5ISEIINANAN050II - bono beAn stolen from Aboie cod Oho Miles nooyoosl 0000e pored with nr stolen. cally doit ho Ike opee, not 0000nent on the ioovosoigo- 'Father, forgive them, they NNA000NAO-OANAA-IONIAAI.I I/,OANI AIMOAAI000-UANOEA_AIANINNIIINIIIINIINUINAIIINI 0l0SIANIONlSl0o//N1OowOI/NoA As a poStioal new- ho tloe aodddla of Oho night. lion we ourselves ore do- know not what they do/ NOII 0111 NI IONS-ION/N AIINANA-IINNIIIIINANNII.I INI UNI (000 oboped opt.oAoreope- NONA TIINONNIA OSUNO - IN AlAlIA N OB ANNI-ANNA ONSON.NNI.NNII AAAENwI./w,IIA0,0NNISAINOIAMNINA oomer, H000Asiab kas boon Everybody looeo and shod infi" he wrote. AOj do OMS hecaooe 1/soy know eoaetly 1(01115 AONIO - 01000-Al AIIOA0OIO0 01.0 0511 AlLANO not the wind/so- eioAycon000/souo- AIAIANANO INN-ININNN ON OINNI-NN.AIANAI AI NINIINIRO ONO NNMypmoetoloftgoenpe one f Riba' tloreo most eoempla io t for tho know mho these cewooslu oohot they are doing." NOII AANINIM-OIANA_NIINNINAANINAAMNNINAINR AANNANNIA-ONAANAONIANANINANNINNNNAINA040NNAIIA 001000 we pwid ontm mosey end thimsem ore doing INI2. NON SN IAN-lOAN bANN IINIONNO N1OINNI000I 50010nao to kuvo oigno that ormoo'l Io avoid the Comm000iot visible mayoral eAndidatoo ynoang people who we want SOdANN NONIO NAInS SAM NONO A_AJAN -NAA&NNN - SAI NA IA ION AINI000A ANO NMIAANIN, - (847) 967-5500 0400 050Mo - AINIIIIIIA 0111] tootimofrwprrooionand sod bao emerged awe pos- ta ho good oitioeno" theSe oriooiooal thingo. I CRUm RUmdtUm SNI4NNAIOAANSIANANANAIIAN.AOIOAIINI,AIN4_AAIAN NNlONM0NAoolSAI24OdIo5,Nl"Our 37th Year" west/see offthoN EN be NOWONEO Thnreduy Maceli 10, 2000 I 5 IThnnesdut Mooch 19,2009 i NEWS i A T'innnncec I'nvrn l°ublíenntinn i NEWS i Candidate givesreasonfor absence Differences bared in Nuesmayordebate By TONY BOOTUCA "Os that day, J lent my estate bosioesn with hin tlarce,oh isa "giunsi cenndt' By TONY BERTUCA knnnw bmw Uncut bodgola, [email protected] best friend and the love ei date" yet brun by incline est critical and altnchrd ltetluea@yiotertluoalcam the coiling mayor Foc luis Cohlemw poinLod toare- my life, she serale, "He was able tedie Mayan iteben't Cillero to itonce on tases mmd rvhnut coot bodgot vili the nulloge Nues mayoral candi- Fiarcaah, who has been sitnhco fernnnlc cintes ninny peacefully is my croon," 'I'hcee Nues candidates she said wane lurch of iroplemonted, in nvhinh dote Corsi Harnaals issued neither seen ser heard on from 'rrnslce Kino Sieden- Haresub sneote. stepped loin the ring h cod n csbip. a statement March II osy- the esmpaige trail sisee Hercsah said she mould ?lenuoiab, seching Ip were h'invwed io suive Caliere acid itorceob 'E'huridoy night atibe Orni ing she was usable teat-- the end of December, raid remain io tine race and discredit ido noce peuh- $30,000, "I mime sun-liare have denied that elle1yuliain. mayoral debate the town tond the sec0raeal debate tier obsence was the rosoli planned to uttend a may- eonro bosisemmnnnn ond "My lnnnvbnod loved this hen Irantm in recent loewney, coup entohillnhed oIPa- that sight because she of her banbasdb paar nennt, pointed out that that Lv enootby moitit Filos oral debate scheduled io villoge end wins theilied 'rho eandidoten who seeded mora time te health. they hove becs is village nimio now in those loungh have bees held at the Puteo that i inni 'inning," nine SKILLS TESTSlsth-uadwr, MUSAN GMIÓnCntI,ltlsni chnne to ynnrtìcinate in the mourn the death of her debito being eo-bnnuted by government mr years rind conunuwlo times," Cahote Richard Hsrenuh, s fsr- Public Librar7n Mesmo Kessel. perttntpotw let thsto-i..,,deatInsIto, mese husband, Richard, who mer Filles trustee, owned Same media cowmen- Olemples st Receto CttrSRM,s et Em.r.,w Mieti, SRI5OeI lis Mlle, ube 511,5 IIeoeldSp,steiur nove yet Lo moho the chungeu they premise is died Feb. 21. and operated a local real totora hace syacaloted Csmmrntl: ploneerl*sal.som lest Theesdey. (Pleito by Rathiw Ihen5.JSWI Pheteicptiwn( asd tIne Lcigtio nf Women Flooding Veteen af Gicnrienv were tlnnir eoiupeigns, 'l'easten Kim iiiedecmao, Flood mitigaliso hou LEITERS Taxes and spendIng bees o hot o:tmpiuign issue 'F1brCi-dft INDEX unlieg Mayar Robert Save on heating costs ODiN OVA N Collera and KrOrselol One of iho mesi eon- since lost Septeorber's with u high efticiesecy system-- CI100IPIOO ADtEiTIONtill tenVoun issues nE the Ovods, when viltoge sf0- ,, -.:whcue a1e PE ER AT THE WEB R "Chein" Hinoyioh. Take advantage silbe sew CN 0015 DR Dt Oli l'ina niher candidatos, evening won Files' loper- omIs wore cdticinod by Crfts foe Rieft end MulEs POLICE BLOTTER gnorremest stimulus paskuge- rjae a bag - you fill the bag lEtTi buCEO BIT Luigi Nitti end Cocal Flor- cent sulco tau, residents naid their prop- ROLL CALL crues boss flooded repeat- tASiIOea's! DIVE it ION I il collln, declined to epycast ttiodecmon bus said ube Save Upto mould work lo lower the edly for noverai yeunn, '"When RibardMsrnh 2kO 2009 FILM CLIPS If SCHOOLS All three eond'ndates 1500 were given iwi misotes ii oeles lao by 0.00 peceeoi, itmnnanïohi toob albo ut FIXER ii IHOWIlMiS wulneepeningind cloning hoi Cnnllcco culled her um- both Biederwun muod 'iTfmeaRem tu 12 seer Ft Rt M lo SPOilS - 847-967-2200 itotemeota, acid oneln iras bitinios uoco',ulistie. Cattero. "The IO pereeol soles "Those innoinle hove sod osos sstpvoon givenn Ill sceondo te re- LocatIon06i0OttattReat hoes horn Our a sog timo," spond tu sluentions oshed tamis u necessity," Collona Nt1llRO7PI NILES HERALD-SPECTATOR enid, odding thoi cutting u be ooid, "Tluio hltooilingl by a league moderator, Skokie Valley bon beco going on foco STAtING RETtERS SIIICE19SI * YOUR LOCAL StORTO subinnitted by oudienee q us rtos"p cre est equ ohn long time. It should have Air-Control memberu and Herald- obout $5 million in n'en- - iloi,'t Miss the Great argaiiis! Eniroo'AL CUSTOMER SERVICE coow "Without it, she'll bees cesohved o 00g time Heating & Air Condilisning, Sales & Seraice tpweiaine staTi, Monotint EMsr'MUo AMO DELIVERY ttO°,iEt have io oui occvlccs," neu alberto issu> fIn-7209 ianw Tbestrlitegire wove Meriti, 6:10 ne:ipnel Cultero siso argued that Celbro countered ihot i-rail eaiisrlaepioneerloaalesn Ostt:iüss-taceliae,saan-llre elect from the culant, Fac ItslIiastaRi Wann: the nomi too does nui mo' tine Sepiembec Sood was Instufas-noo CilIcio, cinwpuignin5 from aannotte5 EaIl5r-lysets duly bort resideslo be- iba very first thing he had TO SUBSCRIBE u yositiun of strength ou est barile 10411 sIn-tail cuonc touch of tise revenue Is dreI wilh after he won 0-nani neaniieeeeeearlcnatsao riese 18571 406-900 the incumbent, touted oc- i-sail:aliislelinnlpinsnenlnasiaas cabas ham shoppers who appointed aeting moons Fas (asti tei-itta complislnnoaote fcom bis tiasoting Odttsr-Blanrduns Clnstaletlsss DessIne live mutside Nileo. "We home noi bono punt nia woothn io alObe. lenn:Isn (sonsa 15411 iIi-7055 Jay BlaIse 10471 455-tOil Hasusiub tomb issus amare of how bud this libe 1-nail ttamenepsnasr(aasirse He portrayed his eppo- ARYORTI510G with the omIno tun und said Ooodingh woo," hn said. "I Fsrqncaindanlintny er amusai oeste an all taOn, and said s-noir span lenepiscnnlsns (nan 51o5cy .ds,ntlslet ii burla buoisnsn sonoro. will not cheep oshl we get Dillon ads Inni assttoa Ins has nhowo himself to "The 10 precoci salas this emrrected7 A gift to yo rally froto Chicago'sJnwlsh community Ost news? 1-seil tiaylateeiaeeenlsnaloan ceci nies (INtl Nil-Olin bee meo uf action, toots buio0 businesses Is November CalIere tpart tes lanti nit-ibis DispAR seise nsiee,noeteels,s Conspicuously winning elikererhas wilh lurge'tiohei itcms," he estubtishod u otocmwoinr i-nain rarindesnpsnasnlana(ens lnetlslSttlt from iho debate, huyeren; seid, udding he will nvocb smo'vey commillor logen You invest a lot in qour babq. Andnow so does JUF. Etilos le rnnlne lleRAs Mseeflel,q Meeet,r aran Slain ltftl itt-7004 v'ere any qoentioss about Jell filien (047) io lower il, utelcened, to ihn bottnsn of tUo Omod- fusil ianepiafle,rrsnstile Inne Pnwnld000t et adswdtsist Immer muyan Nich Stase, Siedormun seid nhn ing issue ond do ian-i sine (UF believesjewish early childhood education dnnbnnlilnrineg (lati sas-77e wlnu pleaded guilty to miii in no important, we'll help pay WEB SITE mould est do aoythisg whcee el-niob arc-os urn. Cle,slset eIns n,ynessnlstlsss the tuition of the first child in each family to enroll in nnss,ploneeetsaatssnis hood und thing a false tan jeopacdioe city secoices, He ums alen seid 1mo wnuld a participatingjewish ileatlei sis lesti 99e-1400 rotant tini yrer loin deal sock federol shmmtnns preschool or daycare - regardless of family income. i-nei Ielaaaili5050plaaaanlanainan but soid Via 0010m tuo MAIL with pcasccoiocn, who brnd Xli isnold-Spenla(nr 00,515,5 lesse elector could be towered cespanol- foods to miligoin lbs vil- 270(5. talente, ileeaisv EtolOs trail Ondoie (5571 ist-tu? also charged muon with bly litho village cui moine logr'u druisage pi'sblnwn u lecci'ng cilluge busiseus exposons, Colloco noted Bindermon suid Ocy- towardyour child's tuition PRESSIERt? toioin,vunonbi ugonicy ohe did cot mastino whoi tennbee's Osudiog inanes $500 to $1,000 ARID PUBIISIIER owood by e friend HennIth impmrtust fueler is her Ja Deseen fut ohne would cut, Syectwtor munoging edi- Caters ovid of sA ihnen deilsion In ras. She bruti-

tar Mure Alberts nuid u casdidates, he had the - cinod CotIcen foc sot act- Mwyaral sassdlstelwe Choie Deslestek (Fep) Cubed C.11wrn (eniddis) and OIes Misdeesnew Ilsettemt For more information about eligibility, contact yourjewlsh early question inhing the oundi. most espectits Sn cutting ing uwitily enough. epede dorleg a libele test The,sday at tilles Reel, Clabhessn, Thu deteste ones epseared toy childhood center, visit juf.orgfriststart or call (312) 37-4513. dates absut their assess- wasiehml spending bceaam "This io use uf ihn rea- Pleswwr Pons, uCd (tee testen si Warnen Votwrs si Ul,eolrnw, ment of the SImone edminin- bets ne uccusnlant and is sons I dncidnd torus," sho trullos was approved by direotac of the sillogeb PI- uaid, "It hmm bees fur tos his anam eampumgu suons, bons plan," he said. "Ecco'- said, "S slatted along- i,i n, ,: 1505e ore sin,, nvtoas 'r : iS 5 Ehe screening oseowitice nsnce Committee, lung. We need tumore for-Caliere created u comosit- thing acre son short- rongo urbes planning oiwhtoh hemos n mem- "She Ißtederwasi lias word and fast, tonto sludy the tonos eue- cnmmitton, We see not go- * ber, bui noi rend by the not bcought opone lits nl lier this year, bui Huno- Callerochocuetociond isOlo ïhonge from low fiSAtStZebygnikdredFssod Long-term plan sink bon criticised tbsp os -himself ano "doer" und tuses und greet sendens, I beddn Fed anuas uf Mnsespotleasn OninagIs the Reese D PlanasSe Ness debuts mndccutar, u mew- wssiefut opendiog," he noming too lain, but juut insold Hapusiab is u"imIher"em doing ii, t've done St Ohenelorn Enaut sa t the Levis oeil Átie 110 s 5 dat Pserossehosi bar of the LWV, said, "S watch thoi budget Hunusiub hes mode his 55%tisiaaoGnaenli eso n:sn,,nnnesó ienI'i,le,ro4en'asai5sni'nt tiwn foc iba eumpuigs. "Whet you ovemld dolo w i0iadecmon, scehtsg te eiuooly This is my forte; deuire for olceg-term ur- "Wo do sni hove o nr- help tho people, I diA' he De100e, PAREO e..n i,,, 505,isniienó diuoeedit Culleco, came ibis what I'm lince funi ban pion foc Nitos une of 6 Thursdsy, Msreh Ill 2009 A Pioneer Preen l'sblirshi,,s j NEWS A Pinner t'mw Pabhientino Thsrsdsy, Mereb 87,2082 I i

Suburban j( blessratescontinue tj There's never been a better time to buy, By LOGRE STIEFEL Chieagek north asd west profit agency, Glich lus publie librories. othor people whot lis si,,." Islief elkplaseeslouul.çom suburbs ere mere likely to been offering half-hour Shrh luhlsud svilli uoss Surepsyroll, o Giro. Homes are well priced, interest rates are at historic lows, woeb for professionol, 0- 00000eliog neooions by ap- slrselius warhose, mort- earlier thus they want be- view-hosed onlinePuysoli Unlike the peuple sock- suonaI, edsestional,,, poietmeot free of change gage bmhees, bookers, ad. uuuse their spouses urn firm, han its Ossee lukeso i, and sellers are motivated. 'There's an incredible value ing her advine, earner health and sereins related at the IleerSeld, Glesolew, misistralive oosioiastn out of work. the employment picture, noonselor Itobeeto Glich is industries, senIors thot ,,Vilme,tle und Noethbroah acid relail wuchern. Shuk Glich helleres the sud- hosed osa' monthly booked solid fur the nest havos't bees as ljkldt sleslyusemyloyed should sey it eesduetn with its out there, just waiting for you to walk through the door, See sreeks. es enosteuetios, trade, Area unemploymènt statistics expect lebe out of stork 20,000 emoll business "They're all seared to- transportation and moos- Oar six months to u yeur. clients ucross the suso- According Io the Illiesin fepuslOesl si tsployssenl tenarily, desth," Glich, nslssvosrins fertsring. So they would- "lt's sul realistic to lesen ueempieysenl ens up belssees 0.5 ysscenl old tl pesassi s Jesuasy trs for the lonsioh Voeullsoal s'the os badly uffeated by Iseo the psealous sooth asneo sesideets si lheseCklsnonsea job usd find nnuthsr one Date frnos its Pebeuury Servieek Career Planning Ihr reeessisn es sober cr- stbusbo, all sith a lnpulnlins niel lanci 2kOIh Ihr uoeeyloysrssl iou month," she sold, survey indieoted on io. Caster in Norlhbroah, eee of Illinois, estate em- estes ass sot seasesally adjusled. SIso tallo them they creusois hieing ossues- onid of bee jobless chests. plOyOsest speeislist spera- Lati. seed tu get nut und con- ege hast month, allhosgh "Even peuple with jobs bled. 5.5.. J.... Osa, J... MonthlyOese! cert with peuple, siseo the Orma were is muoy Is, 5 20092008 2008.0.5..oh.. ore scored nf losing their Though the nobuchnos tise mnjnrily nf jubo urn coses hiring nontruelorn Opportunity is Knocking. jobs." jobless numbers are simi- 23,698' 5.8 5,2 .3,6 0.6 2.0 found by netxvsehisg. l3ut, rother thus full-time esa. The unemployment tarts thnse is the eco- £tmtsi.st 24,501 5.2 4.3 3.0 0.6 I.t she udvioes, they ohould- ployer,. rate far suburbs oerved by nomie slowdasoss that fol- DVNliì 12,948' 7.0 5.9 , 5.2 1,1 1.8 01junI nob friendo for Sularirn, however, de- ______'«r' Pioneer Press with mare lowed the Sept. 0,2001, Esorntos. 41,055 5.3 4.6 4.1 0,1 1.2 specific job referents. clined, according to Ihn than 25,000 residents rese teerorinl attoebs, Glich .23.701 '.5.2' 42 R4 2,8 0.6 "Suy, 'These are my survey. "So while nomo Romos 00,4th 6.9 6.4 5,2 0.5 1.7 in January frame mnnth said the unemployment shills nod I'm muhing s people are coasting os I6dp.r. 5803 59 46 38 04 12 earlier, aeenrdieig lo state pietore this time lo differ- trsnoiliun. Cao you give cosnomern to obsorl, Iba otiitistioo released Friday Moso.d 11,039 12.t 11.3 6.1 1,3 3.5 me advice sod osgges poin of bailouts, these '6"Ï.1l,576 8.0 5.1 4.0 0.8 1.9' Of the 16 suburbs, only Lssbt the stores P.000iag. $515,500 Slinks. - OsSeous 05okt. Carenes 5459,955 Lissnlssoed 5559,055 Mosd.IeIo 17,399 9.9 8,7 7,5 .2 2.4 tians?' That's amare days, us avrruge, con- Mundeleis und Maysvaed thut 0er rInsing. We didti't MIa,':"'":14,00y'--6.3-9.s 4.9 1.0'1.8 helpful route," Glich neid. sumers beve leso msvey showed rateo higher thus hose the stores cOming NoiUeb,.oh 16,900 4.4 3.0 3.5 0.0 0.1 "Plus obrad al time what is their poohets snore. the state's TO peroeot. But then," she said. "This is RatPost 39026 56 45 35 08 21 yso want to nay, whot you sull of nntaey deohisses," oIl were ubeut 0 percent to reuSy orrore the board" nf Post Rido. 08,511 5.4 4.9 3.7 0.6 1.7 want ta get from neon- stated Surepsyrolb COG 2 peraest higher than a the warbforre speotrum. 06.64. 346 59 50 41 58 18 veesatior so pus eon ash Michael Altor, year earlier. Beeuuse Jesdab Vece- WIlesesIte 12,521 4.2 3.5 3.0 0.7 1.2 the appropriate 00es' Mesy residents of ttnnol Service isa sot-for- esu,m515s1, Depauresss(t,er,so,,i ossee veneer P50,5405 tinos. Peopls love ta tell Commente ploneoeIooaI,cem

Paid 005nsslsswast slinks, saneenescinde, S 505,050 5,SP5,sn,S 53e5,S00 Saea,ssn Join the Caucus Party in CelebratingWomen's History Month-March 2009 "Men, their rights, and nothingmore; women, their rights, and nothing less," SusanB. Anthony

5550,0050,.P5.is.. 5290,55e Skekia sisaSes Ooensaues,rle5Co,k,ei550d 82594m MsOossso, saname

2507m Ea,s.sos SleSoesUeaeisoesd scorre,Oaeaieues.e 5e09,550needeos, tisanas .,ejisn.Ssd ueno,a5b,a,,,e,i,uie5ses,IinLe,,elO se' s,,,sO,r,iloi 5,5,5 e,d sss 5' ro re,seae,e,,,e,eel,.sb,e,.o/oveii,,ie.us,r,,,,,eenui,,ea,,ws,u,,a,o,,,,i,ouuuks,,,e

Skein, cesarenSinks. $eae,ms The Caucus Party practicesequal representationby Women & Men. Our Opponents have an all male ticket-norepresentatiort by & for Women, Puid foe by the Mortes Cesso Caucuo Party. A copy of asr report filed wiIh OhoCobol7 Clerk In neuilable for parchane from the Coanty Clsrh al 69 WesI WushinglonChicago, Illinois A Pioneer Press A Pioneer Pi'ess Publication Thursday, March 19, 20099 8 Thursdny, March 19, 2009 I NEWS t Publication

"That's just doing your mittee that will comprise ing attorney Mike Siegel said that doesn't mean he problems at the OTB." Debate job," she said. 'Anyone of citizens and be advised by to help create the ethics has no good suggestions. Hanusiak said hew enigtrey GMP& l-le has been critical of the in favor of the 0T13 be- VIEW OVER 100,000 LISTINGS Real Eslalt' Continued from PAGE 5 us could have doria that. attorneys. subcommittee, saying it i 009 Wrnikegan Rood village's environmental ef- cause of the revenue it Glenview . I'm very glad we got the l3iederman criticized was n waste of money. 847 729 0130 . gienviw@kgmo cOrn stimulus money for the All three candidates forts, saying they are generates. for six months. Thesepeo- Callero for not being open Tho (Ion . 2610 Volo, Dr;vo were open to streaming mostly cosmetic and not In closing statements pie talk about what they roads. But it's unfortunate enough when making the thgion@ksgrnoc corn far-reaching. Callero cast himself 84?lo 5000 are going to do." it took this long." decisions to create various Village Board meetings on as a sg mac.com "We have one of the Biederman sought to new committees and has the Web and posting de- no-nonsense businessman Ethics, transparency largest manufacturers of who has the financial Well Fargo flome Mortgage 'Fort Dearborn rand Tit'e, L.LC. nsurònce me WarEmty Commercai .Relocation downplay Callero's ac- asked the attorney gen- tailed board meeting in- . solar panels right here in men needed to get things tions, which include creat- Transparency and eral's office to look into formation online. Now, t Niles ..." he said. "Why are done, as well as the time Ing the urban planning ethics were also hot top- possible vioJations of the only the meeting agenda is we not using them?" needed to be mayor. committee, the stormwa- ics. state's open meetings act. available online before the "The biggest problem ter committee, the ethics Callero pointed to meeting; more detailed Hanusiak again be- 018 facing all of us is keeping strides the village made material is made available committee and seeking rated his opponents for L' '. I ! to trustees and the media. Lucky Magee's off- all these services witha stimulus finds for road- after he created an ethics not taking action on ethics .- track-betting facility was balanced budget," he said. 6e51nL.xhigton.cùm Nilu 3925 M O 4Oiuáig.m Pr..q.ct Hs*s 6$378.dcwfth.tcm Mo,$on Grov. 680V Mllwauk..706.comNitsi work on Oakton Street committee several months reforms years ago. He also Spacious6 immaculate at Eagle Point Ready Green efforts approved by the Village "It takes a great deal of Builder's own custamdreom hause in sought 8eautilu conavahon os compIood Hdwd Absolutefystunningt Updated and expanded Lovely Cape Cod in mint candrtion and Touhy Avenue. ago, along with a subeom- 2 5 car garage Full bsrnt, huge inviting kit for now owner Great tiri sizes, storage criticized Callero for pay- Board in 2005 and has time to be mayor. Since after Bunker Hill Estates Exquisito nowbomo lI,_ ko w/granOo, cherryabs, sland, high brick ned cedar Ranch on o beautiful corneT Going "green" has been I oilers pristine and serene views of forest end oppio Sliders to geoi polio & lonced lot Open fir pian ccl remodeled kt open to w/ioadu of cobs, newer appi Cozy iv rm thuout Neutral decor Bright kit with picled a popular campaign issue been a steady stream of am retired, I'm willing to preservo High-end quality 4 bedroom! yard 3000 sq ft 4 bed/3 both Abo for huge iv m w/fpic Hardwood floor wrth w/fpic & hdwd fir n note levels very oak cabs, skylightin-unit w/d wth cobs 4 5 bath $1,299,000 tent Rent to own $575,000 stone bars 4 bed/2 5 bath$429,000 inviting 4 bed/2 bath $384,900 Bölcony 2 bed/2 bath $274,000 in 1411es. revenue for the village. give the 20 to 80 hoursa Cathy Fceedrnon 847J29.0330 Karen Wright 847.823.4144 Quality, Value &Serviçe Inny Lanuae Linda Kramer - '773.435.4300 j. Rfzzo/J. Suflner 847.51OE5000 Kenneth Sorenson 847.362.6200 Each candidate has But it has become a polit- week it takes." voiced a commitment to ically charged issue in the Biederman said she is renewable energy and en- campaign because Bie- qualified because she has L vironmentally friendly derman voted against it, been an advocate foi- resi- Produce World.- practices. But Caliera, a and Callero in favor. dents on tax and ethics cr)fr INTERNATIONAL MARKET . DEU . BAKERY. MEAtS SEAFOOD member ofthe village's "I did not feel at the issues. - , 'n _s__.----,.-"- -'.-'.r' '' environmental committee, time that it was worth "1 have been a voiceon criticized Biederman and the perception of what an your behalf," she said. 143R.dwood.m Mou,* Prosp.d 894Aus5In.com Morton Grove 5701 MoinSt.com Morton Grove 8_ Mod Grc. Fresh S836Prosp.cs.com Nilei Hanusiak for never at- OTB is," Biederman said. "Leadership comes from No assosmenisall remodeled 3 bed/ This nicely updated brick and siding Ranch A perfect starter home with possibilities ta Meticulously maintained honre mcl hdwd immaculate bright, sunny corner top floor Asparagus Lemons 2 5 bath 1H w/Iin burnt The best n the areal has been lovingly maintained Features add Nicelyromodoled Ranch in desireable fit, updated both Lrg corner lot w/fenced- unit Nothing to do but move right in Great Delicious Apples tending a meeting. "I felt the residents the top. We need to pro- Hdwd throughout Ltg catin kit, newer largo aatin kit, newer windows, sliding Morton Grove Hardwood floor, fullf in- in backyard & nice patio for entertaining eatin kit, lrg din rm 8. liv area open to nace, siding 8 tuck pointing lots of closet glass doors, refinished hdwd Floors and ishedbasoment, granite cauntertaps, maple Huge enclosed front porch Gar w/work southern balcony hg foyer 2 heated go "The committee should have madè' this vide a culture (of open. $239,900 129. space Ciosetoshopping&trans $269,900 much more 3 bed/ i 5 bath$260,000 -cabs 2bed/i 5botir $259,000 area Great foci 2 br/f bu$250,000 tage spaces 2 bed/2 bath 49g. u L started in 2007," he said. choice (in a referendum). ness) for residents. I Nadia Appel 847510.5000 Janet Wilson, ORI, ABR 847 2720330 Joanna Kodo 773 435.4300 Maria Ner,tz 847.362.6200 Nadia Appel 847.510,5000 Re B- UI have never seen these I did vote 'no' on it and I would say, moving for- Peppers Strawberries Spinach candidates at a meeting. would vote the same ward, this is going to be They talk about being way." one of my priorities." ,1'tOtìtI t,'wJ i. FOR$200 150 Ip LB. .J tLB. 2FOR green. I am totally behind Callero contended that Hanusiak said the vil- cl it." Biederman showed poor lage needs more long- Biederman ignored judgment voting against term goals and told vot- Lean &Tendr USDA Choice Grade "Aa Freih Lean & Tender Callero's attack and sim- something that brought ers he is the person to de- , 4 ' Pork Steaks Rib Steak Whole Chicken Pork Tenderloin ply praised the committee so much revenue into the liver that vision. d 922Linder.comMorton Grove 7O51TouhyAve3O7.com B62OWaukegcmRdlO8.com Morton Grove redm M Pehabbed to the maxi Spacious & up' Envoy condo living w/ioundry in unit Un Solid brick Ranch lovingly cared for on Bright & aiiy condo in the Renaissance Awesome unit in Morton Grove Estates for its actions and said it village. "It seems like we're graded Now kitcheriwith SS opplx, cherry i39 $I79 derg,ound htd pikg w/ztorage Updated quiet street Now beautiful hardwood floors Open floor plan Park like views Eat in kit Updated kit & baths w/wapd cabs Open cobs, granite counters, booutifuihardwood (FiUyM)U LB. was one of her priorities "I voted for the OTB standing still," he said. kit Spacious din Tm, liv im w/poai views in the lvinroom/dining room combina- w/tablo space Balcony in-unit washer! fir plan 2 bed/2 bath $ i 79,900 JLB. 89g. floor 2 assigned parking spaces, i heated ir9 balcony All appls stay Golf course E tian Sunny eat in kitchen Full fin basement dryer Heated gar & staroge Shows like Koren Wright 847 823 4144 to leave the world a better and I would vote for it "I'm a planner; I'm a I bud/i bath $154,900 Dell sido ofbuilding 2 br/2 bu 2 bedroom/i 5 bath $225,000 new I bedroom! i bath $ I 95,000 $230,000 847 510.5000 place for her children. again," Callero said. "This doer. I believe my skill set 847 874 6800 Ellen f,itern 847 510.5000 Susan Tush 847 492.9660 J. Suttner/j Rizzo .Sara Lee LaalOLakes Black Fqest Rich Ku1ok Hanusiak acknowl- OTB has brought in is leadership. You want a Chicken Bread-American Cheese Ham Osi,Turkey Go directly to the property-web address for detals,photos and more. R.u.d, A edged that he has not $500,000 in taxes, which person who will imple- gone to any environmental cuts your real estate tax. ment." $334,900 - SølnGoodwin.com $339,000 - 96S5WoodsDri8O5.com $99 H4 N lIE S committee meetings, but Corner brick Ranch 3 bed/I bath luuury living 2 bed/2 both LB. LB. We have had very few The election is April 7. $519,000 - 6820nKe.(er.com $199,900 . 7O3lwTouhy2Ol.com 0th)' 5$ßfl5 847.823. q.,, 7IVVW - e .. . SusN Trnli 847.492.96& Ail brick beauty. 4 bed/2 bath Aboluteiybeautifuihorrre,greottoc 3 br/2 be Beautiful private locationI bed/I bath $319,000 . 74lnGoodwbnAve.com $3 19,000 - 82 1 1 Ko.tnerS.com 773.360.3000 Joseph Germinaro 173.435.4300 Borden Notaba Gt-.benaiacov 173.435.4300 Sandy .ynth Great value, great foci 4 bed/2 bath Inviting Ranch, convenient foci 3 bed/ f 5 bath Deant Dutch Farms I'hy«;s Panker 847.823.4144 Susan, Solislxwy 847.493.9660 $499,000 - 6l36nKnox.com PARK RIDGE $425,000 - 8ß2lnkilpotrick.com Extra Large Eggs POLICE BLOTTER $279,000 - l8l3sFoirview.com 2% MILK Cottse Cheese Uncoinwood Terrace Roncht 3 bed/2 bath, Updated Ranch 3 bcd/2 batir, $299,000 - 8350nK1mbat1303.com $539,000 - 82lAIdInoAve.com Great starter, manyupdate2 bed/f both Refurbished 3rd fIr unir 3 bed/2 both ini Pelea 773.435.4300 Alleon 51Ryei 847.945.8200 The following incidents were a Alexis Santiago, 46, of Dempster Street and Charming Cape Cod, 3 bed/2 bath Jean Meyer 847.823.4144 s.Sd4siiry/J.MGow*i 847.492.9660 $41100 listed among the official Kathy DiVaeriO 847.823.4144 $399,000 . 8lOONítes.com i99 80c 2711 N. Laramie Ave., Potter Road. He was $459,900 - 444üGrenløof.com $272,000 - 283)I»mpsner.com $299,000 - 400 lEmerson.net (Limit 4) Ea.g1j. 2 FOR '1 Ea. 24 Or. f Ea. Dozen Sprawling Ranch, near park 3 bed/2 bath Good condition hamo 3 bed/f 5 batIr Groat bc, 2-unit house, 6 bed/3 5 bath reports of the Nues Police Chicago, was charged released on $1,000 $524,000 - 26O7Wood!and.com Ail brick and stone Ranch. 3 bed/I bath. MkbOeI Stem 847.492.9660 Rorelyovailoble homew/good lirplan 6 br/4 ba Nina Oohiova 773.435.4300 Mwi. Nethsc GRI 847.272.0330 Jean Aisdenon 847.295.8400 Department. An arrest does . GROCERIES with driving under the bond and is due in Jean M.yer 847.823.414 $159,000 . 1017wPetersonB6.com $349,000 - 451 0ChurchStcom $174,900 - 4838wHoward4O3.com Carmelita øsagsteiiberg Kvwzit Yivie not constitute of finding of $299,900 . 6400nCc.ro414.com uveinyouruelf, orbuyforinvestmonti 2 br/f ba influence of alcohol court April 16. $499,900 - 1 91 lFenton.com Brickpiit level, updated kit 3 bed/2 bath Large immaculate unit, groat bc i bed/ I both Corrrerurrit, clean & wellmaint&ned 3 br/2 ba LorryMartin 847.823.4144 Etha Virgin Olive Oit Red Cabbage or Sauerkraut 01 ives quilt, only a court 01 law can March 15 on the 7700 Sharon KoIber 773.435.4300 Sprawling Unditrom Ranch, 3 bed/f .5 bath Phoebe Co, GRI, .PO 847.129.0330 Davfd Rigmey 847.823.4144 make that determination. Lorry Martin 847.823.4144 $129,900 . l333wTouhy3O6.com block of North $254,900 - l2OlnLIncoIn2O2.com Affordablecondornrnave-lnconditiant t br/iba THEFT $479,900 . 322ntlortbweit.com . Great building, spacious home, 2 bod/2 bath. RichardRign.y 847.823.4144 #i Koenig & Strey GMAC i'99 $199 $199 OUI Milwaukee Avenue. He tnvestmenl income in great oc 5 becl/3 both, I Ea. 3 Lt. u Ea. 35 Or. Auidü I Ea. IO Or. . Nisveta Buljina, 53, of Justii Gmnberg 847.272.033 847.823.4144 u Todd Krae,ner, 30, of was released on $1,000 Larry M'in Pb. fr Agent in Glenview 8158 N. Susan Court, Swantan. $464,000 . 836,Courtlond.com Raccoat. 0.11.4er. bond and is due in ... $649,000 . SOOaalre.net 5856N. Forest Glen Petty English Tudor, qrat lac 4 bed/2 bath Broth Chicken, NUes, was charged with s i 29,000 - SSlOnLlncoIn2O9.com Exquisite two-story brick Coloniali 4 br/3 5 bo Artichoke Heads Tomatoes Sardines Ave., Chicago, was court April 13. Lynda COI$S 847.823.4144 2005-2008 Top Producer Beef, Vagi (ARw) retail theft March 11 Greatcondo, I bed/i bath John Monk p73.435.4300 charged with driving I Michael Manna jcobion 847.510.3000 $444,900 . SONortbwest4Ol.com $159,000 - O23Jonatbon2Ol.com Sold over $26 Million in 2008 after she allegedly stole t-low uptown condo,, 2 hed/2 bath, Beautiful completely remodeled uniti 3 br/2 bo OOC $159 oo 7o under the influence of 847.823.4144 u Ei. 14 Or. Ticmchaiyapum, 23, of $153 of merchandise . David MoAithuc øwtitii. Zemo.q 847.510.5000 I E,.14Oz. Au.rt.4 F #',. O:. I, FEa.40z. Missy Jerfita alcohol March 15 on the 9432 Lowell Avenue, from a store on the 200 $279,000 . 740Cr..kiidelO4.com $359,000 . 1l6lPavaion4O2.com $69,900 - 66$Pncrest104.com 847.510.5010 7100 block of North Golf course & pond viewI 2 bed/2 both, Beautiful erst w/pond views 3 bed/2 bath 2br/2 ba unit w/hdwd firs Sold os-is, 8800WALJKEGANRD. MÖRTOÑ GRbVE,IL. Skokie, was charged block of Golf Mill NomWìb. K-en KÑtc 847.823.4144 Janus Mko 847.272.0330 CORER OF WAUKEGAN & DEMi- ER HC)URS vlO FR ¿9 SAT R H SUN 8 7 Milwaukee Avenue. He with driving under the Center. She was was released on $3,000 - I-x,-tujit'e-liftier.tt " influence of alcohol released on $10,000 . 847-581-1029. . k-sgrnacopenHouses.com Viey photos. descriplions and viriucd lours bond and is due in March 15 on near the bonLand is due in CHRISTIE'S 1:î:l Fo u complele list o open houses visit . SALE DATES MAHCH 19TH - MARCH 25Th GREAT ESTATES ' ' court April 13. _ intersection of cotht Mäkh2O. !_JThrd; Mat i. 2rXg A Pione ?ubucatic kiiecr fess Puhlicatin I OPINION I Thursday, March '19,2ÔÓ9''11 ¡cation to using the most to-play riolitics and un- Republican leaders are your 2008 tax bill. thxpayersifl Maine Town- Opinion ou say cost-effective methods to qualified appointees. Let's best for township The Republican Patty ship, we cannot allow 1ò- rlocaLt* operate Maine Township not let those entrenched is the type of govcrnme rit towski and Murphy to tinued frört PACE 10 In the recent weeks, I and keep taxes down Cook County Democratic , we want,tokeep in Maine havé been keeping up bring this kind of dinas- while offering even more Party practices infect our Township, not the Demo- WE SAY lbwnship Incumbents with the local Maine trous government, which 1000 WORDS services and aid pro- township government. cratic itiFty of overspend- have served us well Township race, L found they hand-picked, to grams. Laura Morask and her ing, debt, and one of the I urge everyone to vote out some interesting Maine Township. ;Another election is ap- Republican colleagues - largcstax increases in Incumbents factwhich are very dis1 I urge both of them to our choice in -ioaching on Tuesday, for Carol A. Teschky mid hta.e governed with a tied- ' histoy turbing tome as a tñx- devote all their energy to April 7. As a former elec- the Maine Township in- ¡cation and competence, The county is millions Ion judge, I know that the cumbents on Aprii7 Use payer in Maine Township. sto'aighten out the state of Niles School keeping Maine Township I find it ironic tluit Sen. ': of dI1sin debt and put District 71 ter turnout will likely, be your tote to contii\ue good among the best, most effi- ;' the laet tax increase in Illinois, and Cook County Very low because it is for local government;' Dan Kotowski and Corn- Nies Sc}xw)l Drkt 712150 exE; h cicntiy run in Illinois for history on Cook County and leave a fiscally sound nmnhg for re-ektjon local positions on school Audrey Naitkervls mitteeman Laura Murphy is oe ci the mo fscaDy . . many years. In particular, township government F4edbyaBlueJjb fl are trying to force upon residentS, and still scvent scb s &Iort them all with boards, township boards, JnincorporateI Maine dithcts in Morask, with her experi- the reaidents of Maine wantedmore tax in-. alone. award in 2007 in physical the expe they will brary boards, villagegov- Thwnshlp the area, and that iszo se. ' once as a county gang John Anderson education and theuse of rnments, e(k. For some Township Democratic creasesfor next year's crto ridt Th (a- continue the fine szeward- crimes prosecutor, pro- ' supp4emj es'aluation ieason, the electorate Support Republicans control. budget. As residents and Des Plaines vob!e retail mix in the ship of the thctriet they . in Maine Township vidè a unique perspective doesn't recníe the im Ifwelook at the t,I,. district certainly heIp ts to biittres required has-e demon-j al- on combating gang'activ- portance ofthe elected I urge all Maine Town- record of the Democratic keep the Jevy o residents -- tesfl& ready. Challenger Michelle i ity in our area. positions even though . ship voters to choose corn- controlléd state of Ìllinois H r, The top brass of the With city taces domi- ctmk, Hornme a dispatcher for they have a direct effect petetice and expeièhce and the Democratic con- NeL4. iile spending per stu- se± board, President nating the local headlines, HAIR SALON Niles, is supportive of the on all of us. and cast their votes on trolled Cook County, you dent remajy pt RYT.., Vice Presid don't overlook the impor- 2'etO .'dómer oree of the district but doesn't make As a resident of Maine Aprili for tl,e Republican will find that both goverñ- 6Ó43 highest in the area. KaU NsIbis. and Seere- tance ofyour vote in the mental bodies are bank-' . morton.grove the case to replace the Township's uninëórpo- .slateheadedby incum- But the overafl edzica- tPwn!iip eletion. Be Ñespa pe rs tary Mary *r..r, as wet]othe rated area, I appreciate bent Supervisor Climi : rupt with billions of dol- tion at Dis*ríct il's &.e sure 'to cast yourvòte for tars in debt, and have ,.viit ' as two-term ?Dember the commitment of Super-Tesehk and two-term REASON#2 school, Culver School, is KMU JÑssis,are all visor Carol A. Teschky Trustee Laura Morask. the'provenRepublìcan constantly put new ttix NewLòcation!. and the Maine Township - The Cook County De- slate. burdens on the residents Willard "Bill" Bell AFFLUENT incumbents to the corn- mocratic Party has al- of Maine Township. Un- tlighe! ' I(:c.meTirnIPy '25% OFF YouSAY munity They offer nerv- ready given us Rod Bingo- Former Maine Thwnshipder the incumbent Re- 3ChJIts jite more avid ANY SERVICE i: ices and provide programsjevich, Todd Stroger and trusteepublican slate, you will nèws .ir)er E,3d'r5. Teschy, înciimbespt elect a township ForNow Customers super.-i- ship superjs»., is that for every resident in . Roland Barris with their Former Park Ridge 3rd find a balanced budget, e '. Exp.4/18/O9 sor ajyj board that has person Maine Township.As a for- brand of governañce fea-' War1 alderman no debt with money in re- Citizenjournalist, : PIONEER PRESS Or) April 7 voters will been the taxpayers' friend. In this najop report for duty mer township board mcm-turing nepotism, crony- Former District G4Sèhoolserve, and a tax rate that eco- t_. -r-?--- CA L 1847-486-73Ó() have an opportwiity to Also, the Maine Town- nomic erisis, we need to other study indicates that Don't get me wrong. An ber, I witnessed their ded- ¡sin, bloated payrolls, pay- Board memberactuallyent down frmn 847-9669555 cast their heJJts for can- ship Food Pantry has ben- retain public servants around Web sites involved citizenry has efited from a new is altering our attention dídates who willrepresent paper with proven track record& been the grassroots of im. recycling progr thn at the gressroo and Teschky has servedas spans. Texting is in, writ- portant social change. MOR7VN GRO VE Avenues to Independence ing is out. OTL4MBER OF leve! - people who seek Maine Townshiptrustee Newspapers need credible COMMEROE has been helped hya new - . Plagiarism remains an election to Iocai bOacjs for20years,the1 no -L sources. Intelligent read. --;IAND IND L7RY eIectrosi issue. In a nationwide such as the Maine Town- recycling pro- as supervisor. She has a sur- ers can contribute. But e= grani introduced by the CHERYL O'DONOVAN vey 64 percent of high Announcing the 2009 ship BoarcL In 1989 1was reputatjo for honesty can the experienced jour- Toship Board. These school kids admitted to elected supervisor of and competence, twoes- VAN MOM STRiKES AGAIN nahst be replaced? Street Pole, Banner Program cheating. Maine Township and initiatives, along with ¡in- sential quaflties Wonder if we all took proved service to vetes- Given these stats, how Carol Teschkyjoinjme Teschkys strong fiscal up "citizen" professions? ans, senJor and those Another newspapei can citizen journalism Advertise your business or organization as a trustee. discipline has enabled "Step aside from that with disbiliti, show that The Rocky Mountain help ensure accuracy, by joining the Morton Grove Chamber of Teschky remainedon Maine Township to bai- News, folded. Surviving carburetoz" I gruffly an- the incumbent Township ethics and good reporting? nounce. Since the Maine Township anca jts budget so that papers Continue to tighten Commerce and Industry's Spring and elected officialsare right Editor: "Tiffany,we Board and now is itssu- : goals can beachieved their belts. "Citizen jour- "What? You're Van Summer Street pole banner prograni. to continue the job. can't include LOL and Mom." pez-vísor. Having spent 20 without resorting to nalists" are being enlisted. J urge you to Vote April BFF in your exposéon the years as a trustee or su- higher taxes andmore "I'm also a citizen me- 7 in the non-partis Regular follact as re- meat packer dispute." pervisor, Teschky under- con- borrowing. chaide." The banners are a large 2.5 feet wide by tests for cit>; parke grade porters. One article pro- Tiffany: "It's my story! stands the responsjbjlltj On top of Carol "oi; yeah? What quali- 7 feet tall, cost $275.00 each and will be and high school and Oak- Inoting the concept ob- I'm going to blog about of the job. Her board has Teschky's achievements, I served: "Eainstream fies you?" ton ComrnunJty College me- you Stomping on my sited on Dempster Street and Waukegan achieved somethingre- appreciate her compas- "I read a leaflet in the beards, plus the Maine dia reporters andproduc- dream." road in Morton Grove. More than 41,000 mai-kahle in today'secon- sion_ A big part of her job ers are not the exclusive Jiffy Lube waiting room." Township ineumhens. Editor shakes head, omy: In the past seven involves administering center ofknowledge Thomas Jefferson said, cars travel Dempster Street and 30,000 Joan 13. Hall on a turns to other citizen don't have to. years the township tas services for people who subject - the audience jour- "Whether we should have cars travel Waukegan Road cacti day and --.--""; Former Maine Township nahst. "Larskyou called rate has decreased from have been hit by life's diffi- knows more collectively a government without youI. subject a 'big fat will view your prominently displayed Supervisor newspapers, or newspa- Advertise 24 hours a day, Full rangent Allresultsare Eight screening More than 13,000 7_59 percent to 6.5 per- culties. She has done this than thereporter alone." Same-day Fast-frack ParkRïdge louse.' That isn't objective." pers without a govern- 7 days a week! mamnwgraTn scheduling (or state-of-the-art interpreted by facilitIes located mammogram cent. Keeping towmthip with a true quality ofcar- Isn't that truegener- business or organization information. Larslçy: "But Santa ment, I should not hesi- apolntiuents diagnostic breastimaging our speclalloed near Chicago screenings taxes Jaw has always been Teschky is best ing. alls'? The collectiveknowl- frequently procedures. technology. radiologists- inck'ding at performed per year. c'ouldn't let mego toy tate for a moment to )re- a goal and your Town choice for Maine Teschky is a breath of edge of a thousand available at which research Nordstromin people shop clubbing withthe Board has been living Township fresh air. She deserves ill surpassOne individ- fer the latter." select locations. showsincreasestheOld Orchard elves." Show community spirit and give extra visability to your store rate of detection! Shopping Center. . within the statetax cap voters' support in the ual's. Unless it's Jeop- People pay for online It's Wonderful and too Critics contend theme- or organization by calling the MGCCI at 847-965-0330 or Jïits every year since election on April 7. ardv's Alex Trehek. poker, but won't pay for a rare to find a person of in- dia is alreadyflawed. newspaper subscription To schedule an appointment, call (888) 3M-6400. Our 2001. Joy Hajduk-Deff OK, f admit. I'mwar3 e-mail directomgcci. org for more details ' tegrit:y in public ornee News is editorializedTV online or in print? representatives can schedule your mamniogiam screening based Un+NorthShore IversIty health System Surely voters in Maine Morton Grove Why? Becauseresearch '.'on'first avaltabilityor löcation. Or, requnt an appointment online these days. Carol Tesehk hosts and punditsex- I don't get it. Township will want confirms more Americans at nodhshora.org/nanrnongram. to re- running for Maine Town- change insults. Opinion Ateaching affiliate of the UnIversity at ChIcago Yousay,PA$Efl watch TV than read. is An- nodhshor..org ois uiaIuis,syt.m Pritaker School of ModIcIn Positioned as the truth. Comment: ploneerlocaLcom 12 J Thursda3 March 19, 2009 A Pioneer Press ISCHOOLS J ===-- p11., ,oneer Press Publication Thursday, March 19, 2009 13 SCHOOL DIGEST INCPEDIBLE AVINS POl OVER Distdct 219 behind Uni High (351.5) years (hat Harry kyriazes commendahie attitude nno Faranak Ghorbanpour, the Board of Education and only two tie-break jnct ivat iOn, (l(1ll)flSt riti()fl Hristlna Mincheva and The NIJOES North Chess has been coaching the will narrow thefielol of points behind Whitney Team demonstrated its (earn. of I})ílity to ()\'el(o)Ill(' (Ji)- Elnxel Reyes. candidates and PREVIEW DAY FRIDAY ONE DAY SALE SATURDAY Young who earned second con(iict dominance at the llinois sticles, roi ct)flt iJ)IJJfl)S CX- second interviews place. i'niplary J)erforIJlanC(', À nalists this week. 1-11gb School Association The Niles North Chess Nues \Vest IJigh School Tb0 SPECIAL k4'i SPECIAL State Chess Meet, at the .. 4 0 faculty IrICIIl))Cr from the board plans tjjname Them sas represented by BiologyTeacher Tom su- 89.99 19.99 I'eoria Cic Center Feb. Nues North Chess department that nominat- perintendent by early Reg. $275, Reg. $38-$44, senior 11Ml Meerovich; jun- Jodelka received an $800 A after special ed the honoree somma- April. The new after special 12-14. The team won third Thain also racked upscv- iors Justlo Braddy, Gfen Target Field Trip Grant for SUperin. 99.99 MICHAEL 24.99-29.99. place after going 5-I in eral indMdual awards. rized the student's achieve- tendent will Michael Itors Only at Macy's. Ko and Fedya Tftov; sopho the 2008-09 school year. 0SSUIÌIe his or center-vent Style & Co. Competition and closing Freshman Eric Rosegs IflPfltS. The reniarkable her duties on July . navy blazer. a tops and Jeans. mores Michael Chinitz, Jodelka will take 53 biolo- 1M it support of the students' For misses and out perennial z1 brought home a second- Che-Sitien Chu, Saaqar gy students this spring to moves forward with this petites. SeIec styles Evanston to fmish in the families was also lauded. for women priced place medal at Board 2, Gupta, ch.d Hirsch, Evan the Bunker Hill Forest Pro- selection process,the slightly higher. top titi-cc. The only team hoard of Education where he played flawlessly SI and Tom Valente; Students who received serve along the North 0001m. to beat the Vikings was the to earn a perfect score of freshmen Mil the Principal's Award Branch of the Chicago. Co- ues to draw on inputof- eventtwl State Champion, 7-o, and sophomore Su Dieløoyic, Ben Marks and 'ere: Karla Calalang, Ja- teachers Shaun Kennedy fered by thecommunity University High of Urbana Gupta went 5-1-1 toearn [dc Rosait. cyin Sarmas, Zaac Azor, and Erich Kaiser will also via an online Surveycon- (Uni High),iio became ninth at Board 4. Saagar Nohammad Farooql, accompany the classes as ducted throughoutmost of Nues NortWs head .. the only teaiui to finish SPECIAL BUY, also eaJ the prestigious Matthew Hanson, Ashur they gain an appreciation January. SPECIAL without a loss at the tour- coach is Harry Kyriazes; 0 A Larry Stilwell award, given Joseph, Sam Powell1 John of illinois ecosystems, en- 4.99 GET 1 FREE nament. The compelition, the assistants are Heather GeminI CLEARANCE Reg. $39-$59 each. annually to the Outstand- gage in the scientific Only at Macy's. American Rag Shaha, Chanalee Orig. $30-$60, SL I P which involved nine gruel- ing Sophomore in the Jfiraham, ,Jolm kretsos after special 9.99. I a denim jeans or cargo pants Ilocharoen, Mihir Shah, process through an au- Gemini Junior High ing hours of chess a day, and NkhaeI Boll. has Sportshirts & for JunIors & young men. state, Ordy a select few Ashour Badine, Edward thentic field-based experi- sweaters from released its second-quaer I Free Item(s) are at time went well for the Vikings sophomores are nominat- .. 4. Van Heusen, 6; Bote, Lakshmlmaniteja ence, and create connec- honor rolL our Alfani SPECIAL of purchase; free item(s) except for the loss to Unì SPECIAL ed, and the award is decid- Nues North PrIncipal tions amongst various sub- & others. must be of equal or Duqgishetti, Saagar Gupta, 69.99 lesser value than High, which came in the ed by a vote of those chess HighHonors 8.99 Robert Freeman ;'elcomed AUnawaz Ismalli, Glen Ko, jects including biology, CLEARANCE CLEARANCE purchased Item(s); tough fourth round. Head Orig. 37.50-$85, Orig. $200-$360, returns must Include coaches representing all students and their parents chemistry, mathematics - Coach Llyaguat Lashkariya, Eighth-graders: Masei after special 10.99. after special 99.99. purchased and tree Items. H3FTI?Kyriazes was schools participating in the Famous maker Pansuits, skirtsuits at the Principal's Award James Mac, Shanon Math- and language arts. Ahmed, Ashley Antony, pleased that his team was State Thurnament. Saa- dress shirts or & more. For misses, Recognition Breakfast held al, Evan SpIegel, Alvin Leena Antony, Afra Ashi-af, neckwear. petites & women. able to refocus overnight gar's award marks the District 207 Feb. U. Students werese- Thomas, Kirsten Pasia, Nazish Baig, Cina Marie and come back to domi- third time in four years lected for the honor based Joseph Boersma, George District 207 Board be- . Barbera, Jasmina Basic, nate the final three rounds.that the award hasgone to SPECIAL SPECIAL 75% OFF SPECIAL EXTRA on the following criteria: Mikhael, Dure Shahwar All, gins Superintendent inter- Kathy Borowiec, Michelle SPECIAL NUes North finished third a Nues North chess player, extraordinary achieve- Jana Schneider, Samuel views The search for a su- Choi, Praise Daniel, Jordan 24.99 54.99 +EXTRA 15%OFF 50% OFF with 342.0 points, not far and the fifth time in the 10 Reg. $65-$70, i.:::9fter CLEARANCE For total savings of 65%-75% off. ment, outstanding effort, Cuya, Jonathan Cabrera, Perintendent to succeed Delev, Avni Gandhi, Kate after special 34.99. Special 10.41-42.29, Special 2.49.19.99,orlg.' 7.98-$85, Dz Joel Morris is well un- Men's designer dress Men's Rockort orig. $49-$199, after after special 4.99-39.99. Gebultowiez, Michelle Con- pants in solids and athletic special 12.25-49.75. CLEARANCE der way in Maine Town- patterns.Waists 32-42, Select boots for her. kldswear. Girls' 2-16; zalez, Thalin Hernandea, boys' 2-20; infants' 3-24 mos. ship High School District Johnny Ho, Jeslyn Joseph, 20 where the Board of Zainab Khan, Christine Education this week is Lam, Naphat Lcr- SPECIAL SPECIAL 59.99 SPECIAL SPECIAL conducting its first round Reg. $200, after special $85. tratanakul, Brandon Le- 1/4 Ct. t.w.' diamond & blue topaz $179 $499 $59 Reg. $1200, after of interviews with candi- i.mg Thomas Malitz, Cisel Reg. $200, after bracelet in sterling silver. Reg. $400, after spedal $85. special $204. special $714. i Ct. t.w.' dates presented byan edu- Martinez, Etnan Masood, 1/8 Ct. t.w.' creen amethyst diamond ring in 14k cational search firm. diamond earrings and diamond ring white gold. Eliza Mazgaj, Elmedjna In 14k white gold. in sterling silver and 14k gold. The search firm, School Muniti, Bridget Murphy Exec Connect, has -. con- Priya Naik, Natalia -- docted numerous superin- 'bc SPECIAL 99.99 Okonska, Kiaudia Pajak, SPECIAL SPECIAL 50% OFF ' lU .,',. tendent searches in high- Special 49.99,reg. -5s$o4afte - Ial -299-, Reg. $350 & $400, after special enjoyed the ABS prr Rachit Parikh, Jay Patel, 79.99 99.99-$100, . 249949.99.A1Ifeaherbth& 149.99 & 179.99. Only at Macy's. gg because it's profile suburban districts. Reg. $200, after after special 59.99. Briarcliff or Knightsbridge -':.,,' Jill Patel, Karishnia Patel, . about dealing with peop!e in ever'day School Exec consultants special 99.99. Only at Macy's. 16-pc. room ensemble. situations... ICrupa Patel, Shwetarìg Ri- Only at Macy's. All Tools of the Trade Queen & king. You learn to understand how Linda Hanson and Thomas Pacific Coast Basics 12-pc. cookware people think and why tel, Riddhi Paudel, Divyi sets, including the Classic Madden ìeport that 42 Valiant 4-pc. they do the things they door say the things they Bamachandran, Dustin luggage set. set shown. people have applied for the say. lt fits into any career because Reisber Fatima Rogaria, you deal with District 207 job,a majority Shiva Sabet, Emily Scan- people no matter where youare. of whom have experience . the magic of * as eithei a superintendent Ion, Jay Shah, Niraj Shah, Maniderjit Singh, Sniital Shnn Hayes (M assistant Superintend- Soni, Artur Stasiek, Nun- BA in ppbed Ba.oraJ ceccs CABS) cnt. The field of applicants MS. in HUrnn Resourc, 11anagerntand DeveIcpm my Thomas, Kevin Tom, includes a large numberof PartII Triitha, Shilpa Vel- both nale and femalecan- * macys macys.com Classes start theweek of didates. lookunnel, Magdalena Wierzchucki. STARREWARDSOpenaMaCy'sAccountfor April 6th. Applyonline While the majority of OPEN EARLY 9AM FRIDAY! SHOP 9AM-1 i PMSATURDAY - extra 20% savings the first2days Seventh-graders: Gnu- LEDGEWOOD & STATE STREET candidates currently work 9AM-1OPM AT BROOKLYN, HERALD SQUARE, STAMFORD, METRO CENTER, CHESThUT HILL ESSEX GREEN, PREAKNESS, with more rewards to come. at WWw.nI.edu/applyóntjne. ray Agnihotri, Anne John . 9AM-9PM AT HAMPTON BAYS, DOSTON (DOWNTOWN CROSSINGS), ST. PAUL (DOWNTOWN),MINNEAPOLIS (DOWNTOWN) . 9AM-8PM AT CENTER ill Illinois, SchoolExec Exclusions apply; see below.. Anu, Aishwariyha Chock- CITY & BELMONT 9AM-7PM AT SUBURBAN SQUARE - REGULAR HOURS AT FURNITURE STORES Connect's national search New cardholder savings are subJect to credit approval; excludes services, certain lease departments and gift cards; onfurniture, mattresses, and floor coverings, the new account savings is limited to $100; application must qualify for alingam, Daniel Choi, Ro- has nettedapplications immediate approval to receive extra savings; employees not eligible NaticnaILoujs from Landjdatesin nine han Grover, Lucy lvkovic, REG. &ORIG. PRICES AREOFFERING PRICES, AND SAVINGS MAY NOT BE BASEDON AC)UALSALES;SOMEORIG. PRICES NOuNEFFECTDURINGTHEPAST9O DAYS. 'intermediate price reductions may have been taken. tct. t.w. represents approximate weight photos may hâve been enlarged or enhanced to show detail. Most gemstones have been treated to enhance their natural cotor& other statesas well. Baisy Joseph, Juliane total weight may vary to up to .05 carat. Extra savings taken offofalready-reduceçl prices, 'special' prices reflect extra savings. Jewelry beauty; some treatments may not be permanent; please ask your sales pofesslonal about special care requirements. FlneJewelry not at Belmont.Select finejewelry items at Essex Green, Middlesex & Hampton Bays. Home items not at Suburban Square orChestnut Un¡versity Joseph, Torn Joseph, and Orig./Now items are available only while supplies last. Advertised items may not be at your local Macy's. Selections vaiy by store. Hilt. Moderate sportswear not at Cheriy Hill, Short Hills, Chestnut Hill, Suburban Square or Bridgewater Commons, Clearance After completing this Luggage carriesa warranty; to see a mtr.'s warranty at no charge before purchasIng, visit a store or write to: Macy's Warranty Dept GPO Box 3200,NV, NY 101 16, attn Consumer Warranties, For store loations, log on to macys.com initial round ofinterviews, - Digest, PAGE 14 IThursday,Marchlg,2009 A Pioneer Press Publication Thursday, March 19, 2009 15 ! i SCHOOLS A Pioneer Pre Publj8t10 I SCHOOLS I Jimmy Connolty, Matt In- Andar Hadth Sade Gonzalez, Alexandra Gro With remaining funds presentation about their what; the colorsand s tional activities for all Howell, ivoty Johnson, ethnic background, Titled grade levels. In addition to fusino, Sophie KozIol, Digest chowd, Asfa Hasan, that were collected from bols on it mean.1f them VJStudents, theIr families Anne K uLearning about Your Eth- checking out books, sorne Heather Mall, Hannah Re- Continued from Pø( tZ &tty Shafaq Hasan, Melanie the John Brebeuf School an ethnic food thatso atd members of the corn- Kra nicit)ç" thiS project ties in of the activities they have mo, Patrick SchaJ, Mark Hiveb Enea Hofmann, family, the St. Vincent de one in their family isfa- VmÛnit.y recently participat- Varghese Kantha1aCkaI, Eyed Hussain. Paul members also sent a perfectly with this school mous for, they're inclu ed in the Mega Event Fun enjoyed include: Kinder- Sliwka, Jan Solano, Dolly Patel, Keyur$w- gartenand first grade Sandra Kietlinska, David donation to help the Moth- year's theme, UA Kaleido- that information in Pair at the Parish Minister Gabriela Vander Vant, Gus mar Patel, Roban Patel, Matyida Iskra, Kiana the choosing an object from Krzemien, Syed Matin. er Teresa's soup kitchen, scope of Children and Cul- presentation, as well. VCenter. Vroustouris. Second hon. Rachaej Ptasze1 Paliaba Khoshaba, Su Ji Lee, Asra tures." The students have the Wild About Reading ors: Mandy Araqon, Jessie Stephanie Nikho, Amila as well as purchased socks, V are also detaiJj Ranjit, Christian Reyes Mahmood, Albert Mar- Whether There were games for been using their family Story Bag, prompting a Bacon, Haley Belerwaites, It's Your Move Omerovic; BatxanIaj On. hats and gloves for a group - or not they've ever Subhaxn Saha, Gerelt od fineMaria Anna Pa been to children of all ages. The story Lime related to the Anthony Clemente, Lauren togtokh, Aniisha Pat of homeless men and members as one of their the countay their Saianchimeg Breansa meren, Veneri Priya Petal, fanuily older children played object drawn that day. Holmen, Sen Joseph, Mark Megh Pate], Pooja Patel. women. main resources for infor-- originates from and Thinking about buying a home? Schnirer, Sherilann Sohns- Shruti Patel, Nicole Pter. if they 'Pungeo Basketball' '10i Neuhenqen, Tommy Polcyn, Maria Protk, Marko PM- mation and many are find- haven't, they're The third-graders have da Ah Shal Krishnason, Kevin Iranu, The Jr. St. Vincent de including VDhlt Screen Guitar Hero" Janessa Sachiti, Magda k, Samue' Ratnei; Swetha Ing out information they enjoyed participating in Li- reasons why they Would V Shah, Danny Shamoun, Richard PbkOrSIÇi, Emily Paul members are first- or and "Gladiator Joust" Szata. S Aasun Sha1, Aneth never knew about their would not want to visit brai-y Spelling Bees and Tiriing the market is a game you can't Win. Barbara Skrzypek, Janaki Rafahlç Noel Rathod, through eighth-graders. it while younger children en- Szyba, Charmie Ann Teja- family's history and her- writing Arthur stories to Room 31 Seventh grade Soul, KostanthSpano, Umer Rogaria, Ashna Saji, someday. In the eventa joyed *IBowler Roller," "Mi- With today's low interest rates, competitive prices da, Isabelle Trier, Maria itage. student is a mJ of ni Golf Hole" and many celebrate Marc Brown's first honors: Melissa An- Aarti Thbillan D Thl- - George Sizos, Antonic*s maiy Vachaehjra, Monica Wiod- Things in the tecimolo- birthday. derson, Christopher Bar- and great selection, now is the time to buy br, lirai Thilor, Nicho1as Skondras, Thmasz Suchec- The sixth-graders are different herlthg, they other games. Children also kowski1 Patrick Zajac. gy department at St. John glone, Chrissy Bucior, Mee- a home. There's no reason to wait Taylor, Akashah Wan, Ja- Jd, Casey Sutherland, Zafia including such information chose the heritage that headed IL) the concession The seventh- and Brebeul School are pro- area and enjoyed hot dogs, gas Early, Danielle Cornez, maludin Wan, Elena Ward, Sutot Allan Thd Shirley as whether they're first, dominates their back- eighth-graders created to make your move. greasing along well. Alexandra Guzek, Tia Jusi, Patrycja Wardynskj, Tho, Ganesh Uppalapu, ground or the one they'd popcorn and dilly bars, candy corn Halloween second, or third generation. V Eigbth.graders Sofia Through a generous dona- like to learn more about. while others chose to pick Robyn McNauqhton, Angela Krzysztof Wszotek Saba Nayeli.Vez, Amanda They are also finding out if Haiku poems VWl1 deco- Agaillu, Ftima Agic tion, St. John Brebeuf up prizes. Poothurail, Christina Print- Whelan, A Wisiilews-- Zilcaria. their family has any ethnic In addition to the Pow- rated the school hallway. Jazinin Marcon, Ayah Al- Id, Aithea Yaji School recently received zis, Don Protofanousis, traditions, if there is any erpoint Presentation, the Organizers also came ial. Eamen Amm Laila. . &venth-graders Alwin 80 Dell flat panel monitors. The fifth- through Sarah Ryan, Luisa Velu, BrebeUÍV kind of clothing that is par- up with a hula-hoop eon- Baj William BTad% Abraham, Marycarmen st.John Because of this generosity studente will be given the eighth grade students have Jennifer Voss. Second hon- ticular to their heritage test, where girls and boys, Brenda Chavero, Ferny Chi-VAguilal;BushraAJi, all teacher and student opp?rtunity to bring inany enjoyed doing book hunts ors: Amanda Durava, The 62-member Jr. St. as well as the moms and V (and its specific name), ethnic items they'd like rayath, Raxi Dajani, Kaila . auhne Areno, Miriam Az computers have had their to and playing READO, a li- Patrick McDonaugh, Daniel V'mcent de Paul group at they're finding out the type dads, participated. De la Vega, John Depa, CRT monitors replaced share with the classas brary game that teaches Rogalskl, Olivia Schoen- iz, Precious Babi, Elle St_ John Brebeuf SchooJ Kayla Dia; Robin Eapen, of music that is listened to part of their final presenta- Funds raised at. this the Dewey Decimal Classi- Veldt, Tom Sora, Frank BathHa, Michelle Baginski, collected moreVthan $1,000 with flat panels. Not only is . Kevin Francis, Simone or celebrated in their her- tiOfl,WhiCh they'll show to event will be used to up- fication System. Swing. Aayush Bahendwai for the Christmas project the quality of the picture Francis, Theo Caznmell, itageand ifthere are any the class using the laptop date equipment at school. Mai-zena Bizon, Ewe Bog- to buy 40 robes for the infinitely better, but they In Februar3 the St. Room 32 Seventh grade Lakulish Gandhi, Jacke1 are space severs.- special ethnic dances that and projector. This preet V dWVJUIIan Brummjtt, women at Grace House + + 4 John Brebeuf fourth- first honors: Cristina go along with the fl1USiC. Ifl has been a lot of fun for Garcia, Kevin Gau, Christi- BuIaìnaa Chinbat, Deanna graders researched the Aguilar, Melody Beltran, The women also received In computer class, the addition, the students are The St. John Brebeuf na Giannakopouios, Sthvia Chioros, Marija Djeric, the students and they're hand-made Christmas sixth-graders have been School Student Council re- presidents of the United Andrew Cichon, Basia Fol- GIOWÍIÇ Neveen Habeeb, learning what their native learning so much about che11e Foley, Jus*'ily cards along with the gifts. cently organized a beach States. Each student crc- ga, Jacob Kulaqa, Cather- working on a Powerpoint country's flag looks like and their family's heritage. party dance for the scv- ated a poster for their me Mazur, Martyna Nowik, r orth- and eighth-graders. president and prepared an Rodney Pintang, Alex The entire school dressed oral presentation for the Plezia, Jan Suarez, Steven as if they were headed to class. They creatively Tarver, Mimi Speri, Angela the beach. The movie shared all the information Tomas, Chelsea ibvilla. "Beethoven's Big Break" they learned. Suino stu- Second honors: Chia Catal- was screened in the Parish dents even dressed like lo, Emily Lalich, Lulu Mon- Ministry Center. their president, or thought toya, Annie Reynolds. V of unique ways to highlight Room 34 Eighth giude +4+ their president's life. Upcoming event.s will fimst honors: Nick Bargione, uit-lude a talent show and +4+ Nicole Chavez, Krlsty Get- Wecanhelp! an Easter Egg Hunt. rrIe ty, Cassie Hansen, Emily Decideyour own St. John Brebeuf Honom talent show featuring SJB Lapinshi, Sofia Lyskanows- ItoH released its most re- Look to Today's New Homes to help you find "stars" is scheduled for ki, Ryan Martin, Shannon fi nan cial destiny cent honor roll. March '23. McGinnis, Andrew Nitz, the perfect home at the perfect time. Room 29 Sixth grade Jessica O'Grady, Megan The Easter Egg 1-lunt liest honors: Evan Baler- Zachacki. Second hom)rs: will be an exciting day for Has your bank bc-en waltes, Cara Caputo, Victor Banek, Katie as honest as Abc? the kindergarten- through EVERYTHURSDAY IN Nicholas CarseUo, Darrell Brehmer, Jimmy Casey, + One week rack bandcamp V Liberty Bank has earneda rock-solid fourth-graders as they Today's New Homu DIas, Natalie Fries, Kather- Tim Duffey, Danlella Gob- reputation l'or operating with Trust search for eggs filled with PIONEER PRES +Len from the pr6! and Integrity. In fact,Bauer Financial hie Gittings, Eva Hagman, ho, Krystyna Kotlinshi, Dedicated Exclusivelyto candy and homework pass- YO.UR LOCAL S0V10E New Home Builders & Developers just awarded LibertyBank with a Jessica Klug, Kelisle Mur- Zach Koziol, Daniel I es. V 5-Star Superior rating...for the 21st phy, Alyssa Pilac, Eric Pietrzyk. The Student Council Ponzetti, Anqela Printzis, July 13-17, 2009 Consecutive ycarl Fewer than10% of Room :35 Eighth grade banks are awarded this is doing a great job with Eric Rodrluez, Anla Ros- 9am to 3pm honor, which first honois: Gabrielle rates such factors as capital the recycling program. tkowskl, Anetak Siemi- Ages10-17 adequacy, Carsello, Arun George, asset quality and stability. Members faithfully recycle anowicz, Tiffany Stack, Lunch will be provided Ralph Joseph, Rachel each week in an effort to Mike Wheeler. Second bon- To advertise in Today's New Homes contact your AH instruments welcome And since there's Macam, Teena Mathal, Har- no point in changing go green. ors: Katie Doherty, Ray a good thing, you can Trust & In1e itomane Nikolaou, Tara account executive or Rita Walker at (708) 633-4924. No experience needed count on Joseph, Courtney Klinger, Attevo Liberty Bank to Since 1898 4 Quinlan, Anthony Romano, Limited space continue working Anthony Morys, Kiarie music center, ¡nc. The students of SJB V with the same principleswe have Sophia Sldlowski, Anna 800 W. Devon, Park Ridge Ojenus, Sherin Skariah. been-for thepast 1 10 years. have beenicarning new VV Tomas. Second honors; Tofindout why now is a greattime to buy, V NAHB thin in thelibrary V NFTIONA1. ASOCIMX Room 30 Sixth grade Carl Carrabotta, Kimberly 0'HaMUBUØJ)VRS visitwww.pahb.org/tlmet.pbuy. 2392N.Milwaukcc71 1 t W. Fstr 6210 These busy months have firsthonors: Kristen, Sign up by Mayist Chica o IL N. Milwaukee 6666 N. Lincoln 1018 W. Touhy Digest, PAGE 18 . Call 847.692.6021 to signtip orfor rnpre info Chka o,JL Chica o,IL included fun and educe- 77338.4000 773.79221j LincoJnwooj,JL ParkRid,IL Brebmer, Angelica Casado, 773.7G.436O 847.674.130o 847.825.93 F p,

IN 'turotsii Murvh ir, 2oor I NEWS J A i'iooeer P11k/sir lareaoseyott don't spend truss i'illoliv'otitin. 'l'koeodny Mooch IS, tOilS Bi something theycao ini l2-year confusion enotsgh. A ehettp drill gets complicatedal'ili,iti' hark on. Thebollos5 hod elio cas es eon oso capen. service in my name, t u-ill need lo hase phers, from sorneore line is it'n VOI/ilsed sise saie dos's ihn rttad, and I ts,ld her os. For the this venice inmv name oho oust lx he one. ding- VOI/orethou. M1188G100 EDITOR .bnr4ar Thnnten Il there's goad wttrd toC last .111 years the sen-ice because l'es ttsio'htsg il's a shame thai (v'il. rector und prod005, Diversions [email protected] 11047) 4067358 has nisvag n heen inmy almos selling mv hsme pie are euoght op in tari.mosilt. Mike Insets hnohand/s namva. lino'. and moving, ant'li orni non schemes, hot there If ikey voy titey ttnly es-er, I hate used myper. to vet Op eieelricni arc way,too,i,id them. vhi,t,t lo digital, tell them Dear Mike, 't'bis sanai vhevko for the inst ice at my new-residence For sine, don't hein. loa seul purchase tIse wonderful adsieveo. STEPHANIE ZIMMERMANN 12 Years In pay these timidaiu'd by The i'ack. fisuiscard that teas in ihn halfofbridos und 'Arsenic and Old ace'akillercoed Aayihing you cundo le gross5 tolto. She seid that didn't age. I'hotographers scantcancro. SISEergeChicago Sso-lises help otraighten this noi throughout theaeon, 'ARSENIC & OLD LACE' Aunt Ahby and Aunt matten 'the phoiographer'n mould he most apprevi. make av noch nlssey thank ynu. by Jamos Don/los Ihoolte al Mac/ho, s,hnno elderly She told me there isa as too want to opend. Ai. ooly sorry Is shot you'll ated. l/SS ye. Sa/li/aya.isSu p.m. genl/omen rol/eco boIve the Dear Fixen t've hers Social Security (srm wyo ask foro covk,m sec osti the shots thot llarl,aro Iilockmore ' GeOjtolt/izoiaas' Sss/ap, 81/uk 2/-Orsi Sal anftirlunn/o hobit of vto trying la gel Coml/d Lo that I need to obtain and package. lt's mach ienv osuid have ended np abouta c050seierpm)h,5, Yo" John ISa/dIon 0/it Co/let, 6040 inhing. Moiy sold Obst change my monthly hilLs mail lo ComEd. So leen. Dear Barhara This j' cspettsive ifoo oinpiy ou the cutting room hilf ii la fSa[/oe,0 N. Oliy)tsl Sue,, Chinago. S/5- shoot' nisleco "hune out into my name. My has- taeted Social Security. I ovo of those things that tell them whist viso wont, floor. hat that shows co $10. /113/092-303/nr seco affoclod by liinoc." hand passed nnayla was told that no noch tctcWpis000rl0001wei 0/555 isoiss waddenivgly simple l've dt,on weddings hosn mach confidence none/in no ya nha e t., o e. Noii/sor has i/io c/soroio/vr yearn ngn, and the hills form eninted and Ihry yau'Sfisdoeiorp/efasa /ofi/l quartet of activities hat tsr same ec0500 tondo n here I knew the coo. the vitmeraman han in not ifyou dsil'tSaaooi May p/sips - Mtsolio,ec's are aliti addressed to nere not clear on what Op in 00000mer limbe. We pien voaldn't sffnrd huge hi.sotvo mark. potar,yato 005 oioiia),5ef15 for the cerninq week. B0 MORRA PETLICII) ,/e/o,ione/ heol/irs; w)io ComEd wanted. portraits, longs franco When I opake with ware happy to get thiogs Foe video, ash tsr the aero'ptiaonfyourpml/pe CO/Ir/IlIon ho/lotos belo Teddy I/os- n 'they suggested I gato hack so trocla, or psoed ohais. to mere tape, anedited, at the Customer representa. Ihe Social Security oiliee slosgosilShyvursa,iit ui/- We took year lettes to theo 00e inntance, lof. cod of the shoot, Ilather Myoteeiouo tltinga um Munaging Producer Live, I s'ao anked tormy and get a leIter atteottng dleaoectdte/epheoe,iooikt Sonlol Seeariny number Peter Fedmaa of CsmEd/o (cred the eanpie the 111m has svoitlng vin months, to' Thciise 3701 liooyeoiog is the house ./oshoa 0/os/ip is eneileil in my Social Security cvmmunieationo dupais. ll/Lgh in order lo change the right oat of the camera the caaple can os.'r the .4cc., OleaeieiolLvol0g loliobiled by Mocihoor lobe mol/eng his rhvesbo. number to give Io meni. He didn't have a service into my name. ut the cod of the resol,. obole thing (I bad neme. Dao'taeodos,/;O/40a Oresootork two oidor/y riel ,lrbst sviOh "Arurvic & ComEd, bat thin pros. thorough anooveron sabot aun/o. 'l'buI ohooll,/n't When I gave the Hum. liuo. lt was leso copen. Inc ohs saInted tst sieste. Boco,ae of/b/ag, Old Lace," coco though he entoa hardohip Cur went wrong, bathe did nice far me, and they oaryrioc Mueliloor be' liso scier noon il sui/io her, she naht thatcs the me since I'll have In tobe tvoieh their wedding on volooleofoo)osi.siks5 G, toilas that a trip to tite c,,aid kike their flim and the honeymoon). Vsa can ChimIe D,afldIInttt BIB Band 00050 il/I his co/si/ices aie itrio/odios 011ko show or number they have tinted a day off norh to go Fhoerms'toiakepeuo,su/ Social Security solvewas have il processed any. tabets I,, somenac else oeca/lar in Josoyk Konsol- i/so li/st verdon. Once/ir for my deeeasenl boo. there. 'Why can't liuto nrp/iovLeteerosroodiucdjot not nevessary. where they wanted, 1. Chiongn Geundttand I-log's comedy eloosk', reatI Oho son/Il, I/tough, hand, I told her thst ito mail a photocopy nia and have it dabbed Loa leogtSaodc/oo my Social Sevarity nom. ComEd bus slnitehed Any scddingphotog. SVS, and even e dit It Big Bund sn-i/il ps-esos/ o "Aeuet,io & Old Ieee," cl D/os/iy won /,,io/icd. picture ID anda ecpy the nenive to your T0000-ata mate/a/oc 000ceci of Astee/cao jasa toc name rapheros,rth his nati poorscif an year home Jumen Dosvviog Tbeolre "l'bene alo u/st of fun sil- nf my Social Security and they've also culled Liza/las/u Crolli 4.0 p.m. Murek haut She aoked if lever yoa isn't gsiog to ici you eanpatev io Ediouo Pork, Mcs'ch hi. iso//ions, it/sl o//sois/o to apologue. nalk loa) (risma ollie i/i/moo Pools Lushcvo,,t Alicil'.t. m000ingo sod mincomwc. I/o'es'yane deserses Cnmmnnk pilneerlocat,on Church, 0/2/i N. O/iphant, 'We had origina//y is/co/io,,," lie neid. Chicago. .01/-$10. /073/ wosled lodo 'il.'irvry," A/i/tough ho is disto/- hOI-/hOI. enpisilved 1/occo/ive Di iog foc the Stab 0mo, occlue Ployd A. May D/ouhy served iso 5cc/i 2. "Murder On Iba Ori- When Obey disa,-siscred /ise cocons ist klo Girls, higi, ent Exprnsu," Mucelt 21. c/glass were ooioos/ak/e, sclioo/ oionl his inno 000h Ayihi i at the Devooskire ehe of/he odoro sog. iuor/i, slogo t0000ggoi0001 Pluyli0000, 4450 Green- ges/ed Ohio shoon. "0 'son sod ionisionS diveolisg hsr mood Ave., Skolale. t'or/ar- vei'y fami//av ivilh 'Ar- a number of eroso i/rea/or,, sanees ai? y.m. Sa/se- scolo' k0000so I diooe/od inc/osling Jomes Dissvoing t/ayo; 3p.m. Sustduyo. $5 liii couple of limos,"liso A/lkosg/t D/ouhy io/o' $117. /547/ 671-0505, cut. facmer high school I/to- cooing no guiding 1ko cost, 2400. oler teacher sold. ho iso kil owed by one Muy be/i esos sudiencon bnchniool onpecto/Ohe Ars VIna aitd ce//ist ro/otto Os Olio obey be- oltoss. "l'bis is goiog take Jemes Deuda) Theatee in alaolet "Arsenic & Oid Lone" Ihe001l, April Sin Edleen Park. Gary Stitciso prosees osuno yoop/e i/ugo/io the biggeat set wo lioso "Soaring Strings," mocks l,ouble whrs "lhey loo io 000v i/non fur Ibis titootor," Mu,ido/eio ootor Suo until you learn oboat lico hold your choractev" layCriog, Mnsde/nsoho their onvo 1)111e world." Dioulsy noted. "t' lie y coon Moss/c/i yloyn Aaot Abby. sin/cods, "SIte peosoniflro Sud Aunt Abby iso aod Shostihuvioli, at4s3S mece nomo 000iro for Mey's Mrotehb yerfavmiog hoch who/you liho wish 000000 rotoples, rhaeoctev "lv Ohs ISOIOtIOB y.m. Macoh 22 and 7s30 Toddy i/0000ce/t 10000m. gc000d mo/odes ct-coiling - sowokody soho dolosos beginning, she is a softer pm. Maccit OSos Not-lb TIis/ioulatod vieto o) ice op sis ho yo/ls, and performing "A S/il/in you, solnokody ,nho'a pomovelity and then S/bce Ceoter fac She Pee. li/o is covi-,tinly trae of 'Chargel" Timo," comedy sIse/olios thom//od oben you welk io things begin to get no/of forming Arlo, 5501 Shohie Ilias oho bases 0005er- tho door, somcooe who vootrul for hoe," Mrotnh Siod., Shoide. $tO-$IS't. iirurd con5000sitioos. She laven the old list e cost'lony oop/oincd. /847/ 672.e300 t,e nosise.ur- pioviously ayt,coirnil ut of oioet 00/ greet." Mrolrh y/ono tobo a ooavot.arg /00005 Doioning'l'hootre in Am,ing 1ko thisigs Ihusb very coosinciog Aunt "Tho Loiomio l'roj005." Mrotrk is rnjoyivg siboot Abby. hot shea 00/wor- FNmIIy entertulner Mrotrh is as evbhosioio- belog Olio oko,o is porfoi'm- ried shot i/might moke Jim Gill performs at 15/ tic fov of Ike niovin sec- ing milk hoc vioge "s/sOar" her hiendo und rolo/loes um. Moreh Slut Gobbo o/av of"Arue,do & Old Liliano Mitchell. S/ne also ufooid 100050v' drink an Community Co/loge, 1600 Lsoco.""W/ien loom bassi Illion snorhing iso sstal/or her house. "l'mosto wine S. Golf Rood, Des l'laineo. /04,1 loped it," oho said. "1 Olirolets dninber end I'm nota $4-$2 ai she doov /047) diought i/soon the fonniest "I don't mind rooching nook, 01/her," she admitted. li3Y-i/ISS. musi/o bits/Shod neon." up oiese osd Oighb with on "Thry olwsyu brisg their oudirnor," Mro/oh said. osno food soben thvy come First impressions "ArsenIo A Old Lane" is Ihn senty u) Un,Iimer Brawetor and bin "You really buvote eon- nccmtric family members, lnuiudhtq Iwo nante and n brother who When i/comes la Aunt oestrale, orno if Ihe focas (biche i,lu Taddp Ronoeeell. Abby Mmteh sodd thot, isn't an you. You baso so Comment: ptoaeeelooal.tom ?koiçe.aPreSSPt1icaktíon Thursda.March 19,2OO9I 03

FILM CLIPS SHOWTIMES 6:10-7:10-9.0010:00 OltAUIIE 3-'R (P;) MiSS MARCH (R) Frt-Thur llS2lO-527:45-)025 OPENING Movie tImesre effective Friday and are compiled from Frl. Sat: 9.50-32.40 TAMIS (PC-13) Sun'Thurs: .50 informatIon available on Tuesday. Please note that theater Fri. Sat t25O-3:45-6:4.4113O Sun-Thurs: I25O-3:45-6:4.4O DUPLICITY schedules are subject to change. If no listings are provIded, RACE TO A pair o corporate spies with WITCH MOUNTAIN (PG) Mit ILAE MML c (PS) please call the theater for iniormatlon. Fil, Sat: l2:00:1:1O-220-3:40-5O0- a steamy past (C'ive Owen, Ju'ia F*Thta's I.15-355-&45 6:l5-7:40-8:40-10:ISII:30 Robefts) team up to con their boss Sun-Thais: 12.00-1:10-230-3:40- SLI mJJONA (S) es. Tony fiilroy (Mícbaet Clayton) ARLINGTON HEIGHTS I LOVE YOU, MAN (R) FrI-Thurs: 12:25-2:45-5:05-725-9:45 5:00-615-1:40-8:4010:15 m-murs: U:731OE45 wrcte and directed thè romantic . thrilter. Rated PG-13 (or langaqe DuPuCny (PC-13) LAST HOUSE 53 5. Evergreen St. ON THE LEFT (R) and some sexual content.. FriThurs: i:40-420-70D-940 WILMETTE -(847) 483 Fr1, Sat: 12:40-1:40-320-4:10-620- miomws (PC-13) Nlcolas Cae. In "RMIISq.' 715-920-935-1220-1:00 kNOWING oimjaiy pc-n) Fri-Thurs: 150-420-7:10-.50 Sun-Thurs: 11401:40-320-4:t0- ,iifl'Cen&Am.' A proressor (Nicotas Cage) FrI-Thurs ILSZIÓ-450-720-950 RAETOWffCH Fri-Sun: 220-110 620-7:15-920-955 (M7)f74U deciphers a mathematical code miiac (PG-Il) ' MOUNTANI (PC) SUNSHINE az*iiiic (i) Mon-Thurs: 135-6.00 WATCHMEN (R) TIE ILMR WJA PS43) troni an unearthed time capsule "DtJpficItr Id-Thurs: Il:45-215-4:45-7:lS-945 Frl-mw's: 12.00-2:15-4:30-6:45-9:00 Fri-Sun: 12:0100t30 TYLER PERRY'S MADEA Frl. Sat: 31:4012.45-3:15-4:15-6:50- Fil, Sat. Tues-Thurs 23.O-500-120 that predicts future disasters. Rated "I Love Your Man" RAETO1ITH John Hamburg (Along Came Po11y) cORAuI 3D (PG) 3:30-5:00-6:0O-1:38'.30 GOES TO JAL ¿PC-13) 75O-120-ll:40 , Sun2lO P013 or disaster sequences, dis dreams of a better life in America MOINflA* (PG) ' . language and some drug use. Coralina is feeling neglected In the MADEA GOES TO JAIL Fri-Thurs: 12.15-230-4:45-1:00-9:15 Mory-Thurs: 230-330 . Fr1: 4:40-920 Sun-Thurs: 11:4012:45-3:15- Mon: 2.3OO lurbing images and brief strong wrote and directed the comedy. Frt-Thurs: !130-I30-t40-240 and a young Mexican gang member new house her parents have 4:15-6:50-7:501020 Writer/director Tyler Perry is LAST CHAlICE 5:00-6:00-1:30-820 Sat. Sun: Th40-4:40-920 flESERUS(R . language. Rated R (or pervasive language, cross on a freight train bound for 3O-45O-6:I5-700-82O-iO JONAS BROTHERS 3-O (G) RACE TO WITCH MOUNTA1N moved to, so she's receptive to the back for another HARVEY (P643) Mon-Thurs: 3:40-8:05 Frl. Tues. Weit 2:00-430-L'CO Cross-dressing TWO LOVERS (R) . inctu&ng crude and sexual refer- theU.S.Winner of the Best Dfrector Fri. SaL 1:50-3:50-6:30-8:30-31:15 A Las Vegas cab driver attentions paid to her by the installment as the Pistol-packing, SUlD% UONAE (R Sat *20-1130 . I LOVE YOU, MAN ences. Fri-Thurs 1225-2:40-4:55'71D-92S Fri-Sun: 1210 TAllEN ¿PC-13) and Best Cinematography prizes at (Dwayne "The Rock" Johnson) Fri-Thurs: 1150-215-4:40-7:10-9A0 Sun-Thurs: 3:50-3.50-6:30120 ThJs:1O0-*JO .' seemingly perfect "Other Mother" trouble-loving grandma Madea, 2.45-5:45-BIO Eri: 150-420-650-910 Realizing he has no one to ask the Sundance Film Festival. (96 WATcHMEN (R) assists a couple of kids with super- and "Other Father" - until the Rated P0-13 for mature WATtHMEN (R Mon-Thurs: 145-5:45-820 Sat, Sun 1120150-420-650-910 TYLER PERRY'S MAOEA v osui ' to be the best mari at his wedding. min.) Rated R for violence, language thematic Fil-Thurs:120-4:40-800 SIN NOMBRE natural powers on a race to save ideal mom reveals herself as a Fil-Thurs:l2OO-3:lO-&30-.4O Mon-Thur: 150-520-720 liGES TO JAR. ¿PC-13) PICTIN GR' material, drug content,some vie' TIE GREAT a groom (Paul Rudd) courts a new The paths of a Honduran and some sexual content. Fri-Thurs 210-5:10-8:10-1050 the planet in this update of the 'lOs nasty witch who collects children's lenca and sexual situations, TMIØI (PC-13) saI:Pi!L best-fuiendforever (Jason Segel). BuCt( HOWARD (PC) PAIL BURP. MALL COP (PC) teenager (Paulina Gaitan) who . Fil-murs: 1:00-3:10-520-7:30-9:40 Disney adventures. Rated PG tor souls by replacing their eyes with Fri-Sun: 13:45 Fn: UI3:15-52O-7:40 SUNSHiNE CLEANING EVANSTON sequences of action and violence, buttons. (BI) (100 min.) Rated PG 2.50-530-8:00 Sat, Sun: lOSO-1:0O-3:15-520-7:40 . PUSH ***1I2 for thematic elements, scary Mon-Thurs: 250-5201:00 Mon-Thui: 2.00-4:15-630 frightening and dangerous situa- A group o? young Americans I-I- GLEN VIE W PAUL *UDD JASON .lt may push the Sundance lions, and some thematic elements. images, some language and sug- 1115 Maple Ave. Festival whImsical-dysfunctional. with psychic and telekinetic abili EVERLASTING gestive humor. (841) 49l1Th1 GlenlO t , fthriiiy button a bit too self-con- ties go on the run froma secret MOMElFS (NR) I WATCHMEN 1850 Tower Drive Fri-Sun: 11:30-220-5:15-8:10 sciously, but "Sunshine Cleaning" is governmeht agency trying to force DUPliCITY (PC-13) . A vigilante investigating the F!RED UP (847)129-9600 Non-Thurs: 220-5:35-8:10 "SMART, still well worth a look thanks to them into service, Paul McGuigan Fri-Thurs: 11:45-120-145 connection between the murder of A couple of high school foot- 4:10-5:40-710-835-10:00 wwwi(erasotes,com impressive performances by its two ("Lucky Number Slevin") directed S S. Prospect , INVENTIVE. a retired superhero and his former ball stars tHicholas D'Agosto, Eric DUPLICITY (Pc-13) female leads - and a gentle the sci-fi thriller. (111 mm,) Rated I LOVE YOU, MAN (R) I (847) 604-2234 colleagues reveals a conspiracy Christian Olsen) decide to skip Fil-murs:11:55-1:05-135-3:50 Fri-Thurs: 12:40-1:20-d.40 . approach to comedy that blends PGI3 for intense sequences ol vio DUPLICITY (PC-13) AND. HILARIOUS.. . .4 that threatens global destruction. 5:10-625-145-9O0i0:l5 420-6:40-720-9:40-10:20 Randhurst summer training camp and follow Fri-Suit 1:45-410-7:00-920 YOUIIL BE QUOTING IT equal parts heartbreak and grand lence and action, stronganguae, . Zack Snyder ("300") directed the guignol. the girls to cheerleading camp smoking and a teen drinking kNOWING (PC-13) I LOVE YOU, NAN (R) IDI Euclid Ave. Mon-Thurs: 410-7:00-920 FOR,ALONG, LONG TIME. adaptation of Alan Moore's ground- instead, Rated P0-13 for crude Fri-Thurs: 1l35-l1O-220 Fri-Thurs: 1:30-4:40-7:30-10:10 (847) 590-9188 S.nLyons,ATTHEMOV1ES t. a When she realizes her scene. WATCHMAN (R) . ' . '. breaking 1986 graphic novel. (163 , 4:O5-53O-7:0O-8:25-.5O www.amctheatres.com L-çe gifted/borderline-annoying son and sexual content throughout, KNOWING (Pc-13) Fri-Suet 1:00-4:15730 min.) Rated R for strong graphic 5Cfl'' needs private school, a cash- partial nudity, language and THE READER SUNSHINE CANING (R) Fri-Thurs: 1:1O-4:l0-l:OIHO:00 Mon-Thurs: 420-7:00 o. a violence, sexuality, nudity and Ian- some teen partying. Fri-Thurs: 12.00-1:15230-3:45 strapped single morn (Amy Adams) SUNSHINE CLEANING (R) NuES RACE TO ' . '. guage, *** 5:00-6:15-730-8:45-10:00 "ONE OF THE qoes into the lucrative (but extreme- Fri-Thurs: 2:15-4:50-7:40-10:15 WITCH MOUNTAIN (PG) Stephen Daldry directed the Show Place 12 ly messy) crime-scene cleanup busi- FRIDAY THE 13TH ORAUNE 3D (PG) a''Ç,,sçysI 'Is. drama about the dour, distant RACE TO Fri-Sun: 110-4:45-1130-915 FUNNIEST MOVIES 3: THE HORSEMEN Iii-murs: l'iD-7:35 301 Gott Mill Center, ness with her slacker sister (Emily He's back. Machetewielding WITCH MOUNTAIN (PO) Mon-Thur4:45 7.0O-915 A grieving detective (Dennis Hanna (Kate Winslet), a woman (800) 326-3264, 111643 Blunt), picking up stray body parts maniac Jason Vorhees re-terror- HE'S JUST NOT Fri-Thurs: 2:00-4:40-710-9:50 OF THE DECADE." Ouaid) discovers a link between with a couple of big-time secrets, THAT INTO YOU (PC-13) www.lferasotes.com 5.. O4d.ld. FO*4V and scrubbing arterial spray pat- i?es Camp Crystal Lake in this himself and a series of murders who begins a summer-long altair Fri. Sun-Thw's: 110 WATCHMEN (R) .1 I terns off walls and ceilings. Some of remake of the 1980 slasher Fri'Thurs 12.50-4:30-8:00 sp'Y the job sites speak volumes about inspired by the Four Horsemen of with a bookish 15-year-old boy JONAS BROTHERS: NORR1DGE. opus. Rated R for strong bloody THE INTERNATIONAL (R) Rosemont 18 human tragedy and "Sunshine the Apocalypse. Music video film- (David Kross) based an his love THE 3V CONCERT 'THE SMARTEST violence, some graphic sexual EXPERIENCE (G) Fri-Thurs: i2:í-3:50-6:30-.30 9701 Bryn Mawr Ave. Cleaning" doesnt take that lightly, maker Jonas Akerlund directed the for her and her desire to hear him Norridge COMEDY OF content, language and drug Frt-Thurs 11:40-455-10:05 (841) 4411030 FROST/NIXON (R) . despite the oçcasional comment thriller, (110 min.) Rated R for grisly read novels aloud to her in bed. 4520 Harlem Ave. THE TEAR!" k material. Fri-Thurs: 1130-320-6:30-920 u_ 4V about crime-scene and trauma and disturbing content, some sexu- L LAST HÜUSE (708) 452-9000 (BI) (123 min.) Rated R for sorne Rosemont18 Premier injury being "a real growth Industry." al images and language. ONIHELEFT(R) SLUM000 MILUONAI1E (R) www.amctheatres.com scenes of sexuality and nudity. Fri. Sat, Mon-murs: 11:40 FROST/NIXON Fri-Thurs: 1:00-4:00-650-9:45 9101 Bryn Mawr Ave. e .. Alan Arkin virtually repeats his 225-5:05-7:40-1020 DUPliCITY. (P6-13) . "frsTI.. * * * 1/2 (841) 4411030 . RIM Little Miss Sunshine" role as the sis- CROSSING OVER Sun: 125-505-7:40-1020 Fn: 12O-4:10-10O1:45 Screenwriter Peter Morgan TAKEN ters' eccentric dad. (BI) (102 min.) A "Crash-like drama about Sal, Sun: 1O:40-120-4:l0-N09.45 MISS MARCH (R) rHIGHLAND PARK AHIIlOUS, Rated R for language, disturbing immigrants of different nationali- adapted his Broadway play about Mon-Thurs 110-5:00-7:40 SKOKIE FOULMOUI1lIb A retired CIA field agent, who Fn-muís:4:15-1005 ties who struggle to achieve legal the epic series of post-Watergate Highland Park .5', T images, some sexuality and druguse. I LOVE YOU, MAN (R) .,, SIOsHURTED ', status in Los Angeles. Wayne has given upthe spy biz to be near RACE TO Garden 1-6 41 interviews between disgraced 445 Central Ave. Fn: 210-4:55-7:35-10:05 5 his estranged teenage daughter, WITCH MOUNTAIN (PG) STILL PLAYING Kramer ("The Cooler") wrote and (847)4321300 Sat, Sun: 13:30-2:10-4:55-7:35-10:05 220 Old Orchard Center S. former president Richard Nixon Fri. Sa Mon-Thurs: 11:30 directed, featuring Harrison Ford, gets backin the game when she is and British chat show host David 1145-100-3:15-4:35 ThE READER.(R) Non-Thurs: 120-3:45-6:05-830 (847) 673-4105 Ray Liotta and Ashley Judd. kidnapped In Paris by white slavers. c.' 5:45-7:OD-8:I5930 www.amctheatres.com THE LAST HOUSE Frost - which Nixon pointedly Ici: 4:30-7:00-9:30 KNÓWING (Pc"13) Rated R for pervasive language, (Rl) (94 min.) Rated PG-13 for intense . Suit 1145-2:00-3:15 regarded as a duel - for this Sat: 2:00-4:30-7:001:30 Eri: 1:40-4:35-1:151.55 Gardens T-13 ONTHELEn sonic strong violence and sur- sequences of violence, disturbing 435-5:45-70D-8:l5-930 Sun: 2:00-4:30-1:00 Sat, Sun: 10:45-1:40-415-7:15-9:55 Y Thugs who brutally assaulted sexuality/nudity. prisingly suspenseful and funny 115 Old Orchard Center LL2V! thematic material, sexual content, SLUM000 MILLIONAIRE (R) Mon-Thurs: 4:30-7:00 Mon-Thurs: 2.40-5:151:00 Iwo young women get painful (847) 614'0072 pay- adaptation by director Ron some drug references and language. Fri'Thurs 1:30-425-720-10:10 DOUBT (PG-13) THE LAST HOUSE www.amctheatres.com back at the home of one of the vic- JONAS HROTHERS: THE 3D Howard. (BI) (122 min.) Rated R Fn, Mon-ihurs: 7:15 TAKEN (PC-13) ONTHEFT(R) S Ums' parents in this remake of Was CONCERT EXPERIENCE for some language. Viffaqe Crossbiq THE WRESTLER Fri-Thurs: 1210-3:15-5:45-8.15 Sat, Sun: 2:15-7:15 i Fn: 1:30-425-725-10,00 AREYQUJ Craven's 1972 shocker. (100 min.) The title says it all about this 7000 Carpenter Road *** 1/2 ThE CLASS (PC-13) REVOLUTIONARY ROAD (R) Sat, Sun: 10.551:30-425-725-10:00 EPJO,TO Rated R for sadistic brutal violence document of the boy band's20DB , (84?) 6731486 Mon-Thurs: 2.30-525-8:10 HE'S JUST NOT "The Wrestler" could have been Fri-Thurs 430-720-1020 Frl. Sat 4:45-9:30 www.kerasotes.com including a rape and disturbing "Burning Up" concert tour. RatedG. THAT INTO YOU a sentimental washout, with its story Sun-Thurs: 4:45 MISS JIIARCH (R) images, language, nudity andsome THE READER (R) KNOWING (PC-13) ** 1/2 of a long-past-his-prime former Fri-Thurs: 100-7:lS Fri-Sun: 9.50 . drug use. STREET FIGHTER: THE FROST/NIXON (R) . Fri. Sat: l2:I0-t.00-3:lO-4:0O-6:O5- LEGEND OF CHUN LI Drew Barrymore produced superstar wrestler (Mickey Rourke in Fil: 420-100-.30 Mon-Thurs 825 WATCHMEN (R) 72091010:lO-1210 ,'5 ' ' ,..' S J 'S' ,, '. S ., s :s' . .' MISS MARCH An Interpol agent infiltratesan and stars as one of a loosely a must-see comeback performance) Fri-Thurs 1215-115 Sat: 2.00-4:30-7:00-9:30 RACE TO Sun-Thurs 12.101:00-3:10-4:00- underground fighting tournament, 4:l5-&05-750-930 Suw 2:00-4:30-7:00 A young roan who wakes up related group of gal pals(includ- trying to find a way to fit into the WITCH MOUNTAIN (PO) 6:05-220-910-10:10 hoping to bring down the crime Ing Jennifer Anniston, Mon-Thurs: 4:30-7:00 Fn: 2.00-420-7:05-925 from a (ouryear coma discovers his Jennifer straight world after a heart altack TiE METROPOUTAN OfEWk I LOVE YOU, MAN (R) syndicate that killed her father. Sat, Sun: ll:10-2.'0O-4:30-7:O5-925 :.usar.ir1msu .5 former girlfriend is a Playboy Connelly and ScarlettJohansson) forces him out of the ring. Director LA SONNA8ULA (NR) GRAN TORINO (R) Fr SaL 1I30-1130-100-3:O0-4:30- k' Rated PG-)3 for Mon-Thurs: 1:30-355-6:10-825 sequçnces of vio- Sat: 1100 Playmate - and decides to pick up trying to meet the rightguy, con- Darren Aronofsky doesn't go there, In: 4:45-115-9:30 53D-1:08.00-9'.3010:30-1201 S lence and martial arts action, Sat: 2:15-4:4S-7:l5-.3O .5 *SofldjQ Newton, CBS-TV j where they left off. Writer/directors and vince the right guy toget mar- though, and he gives his hero a cer- . WATCHMEN (R) Sun-Thurs 1l2O-1130-1O0-3:O0-410- S, , MOØII.E U8. rocahowumot some sensuality. Sun: 2:15-4:45-115 Tt DUPUCOY*lUi SOIS ZIP CODE lo 43K1X (4354I ried'and stay married when tri: 1:05-135-4:35-6:10-8:10-920 53O-7.i0-8:00-930-l0:30 ' I Trevor Moore and Zach Cregger ("The the tain sort of dignity in difficult cir- ELK GROVE VILLAGE ILov.YoUMafl4qffi right guy starts to Mon-Thurs: 4:45-7:15 Sat, Sun: WOO-l15235- STARTS FRIDAY, Whitest Kids U KnoW') coitar In the go wrong. (BI) cumstances. (BI) (109 min.) Rated R DUPucrIY (P6-13) CHECK LOCAL MARCH 20 I CORALINE Renalssincà Place 4:35-6:10-8:10-930 STARTSFRIDAY, MARCH 20 LISTINGS FOR THEATRES AND comedy. Rated R for strong crude (129 min.) Rated P0-13 forsexual for violence, sexuality/nudity, Ian- Fît Sat 1220120-320-42OE6:t0- SHOWTIMESI * *** Mon-ThursllS-215-4:3OE1:07:50 CHECK LOCAL UST1NGS FOR THEA1US AlIO SNOWUMU and sexual content, nudity, pervasive content and brief strong Ian- Riestettield & Arlington Uts. Rds. 1850 2nd St. 7:1O-9.0-10:00-1i5O Feisty, sassy, lonely little guage and some drug use. FInTsrwAn tMJ tW4 guage, (847) 44411LM 11559 (847) 258-7282 FIRED UP (P6-13) Sun'Thurs 1220120-320-410- - Reviews by Bruce Ingram ' Thurs'chy,March' 191'2ÓÔ9 i I 4 A Pioeier tThurí1ay. Mireh U.2(JO DIVERSIONS J APibtht Proit Pubtkatt

U.acth 23, 7:30 p ru: 'Soaring Strings. levy Senior Center, 300 Dodge 'MatftÀzs, t-jothlght A STAGE Th'z.re tfrOI4Ad 5t the ?octh with Gary Stucka, cello. BlOch: Prayec Evanston. (847) 448-8250 Marth2O GrIeg Holberg Suite, Op. 40: p.m.: Pianist Kristina Nyberq an s«e Lef- ec lcr tlPerforn Arts tidiSt What to do. MThN1ThPy CaTe for Rt Mendelsohh: String SyTTlphorly Ho tin Jessira Moore penforina free 99)1 Sbe &ïd. Sce The sta'es contea mNTeth the Worts «s'inc Fr& D Minoc Shostakovich Chamber Sn- tuIkk) IMfI at Northwestern are 'ien hafl-ssters inhrrt a Universi. This week 8pAdU12ani7piaAçd phony, Op. 110. t) 700 Unriecsity Place, Evanston. ocotr&estaoSthatrflaYiflCIUde Most at the the S'.okie Theatre. 724 L the crc'wn jee o( the coiectinq world. Bach Week Festiva!, April 24 and26 at ticket prices listed in three tth Mre. Sko&e. rts 529 U Cateçoçje The bellte lcr possessiOn takes a dan- the Music Institute of Chicago, 1ichols general public senior citizensan and beyond. (847)6Th vaitz $3 at the C qeris turn when tfree rwal collectors Concert Hall. 490 Chicago Ave. faculty and staff; and student rate. 7161 orvs4 mskokietheafruom appear wtU to go to any len to Evanston, will feature the Bach Week (847) 46T-400 MNth 22. 3 p.m El the Notth Se Cecdr Ca*e 1 stake th& claim on the fina Perior Festival Orchestra, chorus and soloists. berry Consort, Ecco la Primavera- b the Pe1orn* Wt %O1 SlrcJúe You sainR? #1 HOW nwe Tuesdays at ?20 pnt (except il 24. 730 psn. Bach works for solo The Musket Francesco Lanoini' m . Subnt s. eventse week Math 3Th Weesdays at i pin. and halpskhord, with Chicago keyloard concert features soçerano Ellen Hgí hNsaaI; dI241ÇI1& no pia: llusdayS at ?30 pJn F1 artist David Schrader, including Pre- ptior to the de of pt1icion. The Iskal S4& menosoçst.kjdith Malaftonte an AMK1 clays at 8 piTt si1rsm at 2i0 pin hide and Fugue in A MinoCapriccio in tEnOI'AMEN Stlan with ínstnxne. at 8 pin. thV . Entries mIEI tie typet We're 1.d 8 pin. and &iictays2:30 pm. B-flat Majof On tho Departure of his t_ DaWd Douglass, Torn Zac ari Sony, bt we c't it ovei the *lz,t and2 pin.rth29ad T pin (ecE 4arth 29 and April Most Beloved Brolher Toccata inCMI Rathif BmtcnPlne I5 ckton Ccmi,dy COãe9es $2cW$n. A Limited Tickets Available! Easter telephone. We prefer e-nI 5). TKj.ets: $S55- (847)673-6300 or nor: Paíta No. I in B-fiat Mor Partite pJft:kAr-nere, cell ad FocIThp«:i6OO E. Gol! ad. Des dh'erse sopra il Corate, .0 Gott du F: Ve!)It)Cl perforrì.ances (1111V &Ùmissions. pe. w1or Thdhy Lace, janwill perio Sunday 1áTK S2;$E fstuJt - ,s. Ings e free. kdude '*,d 1l* cMr* E,press Imniner GoU; and Chromatic Fantasy thWMirStTaussBlorhand resti Ctl()rlS 1rpply operit \()on semicn: Sf thrl 5 at the Devore and Fugue in D Minor. April 26, 730 84 7 N 7 l-6O() bdefdesaîptíonofthe eyent, mare A $5 ew ppcforrnict wil ackom.$$5.*IU30pjit: C; ill Box ()ffi'for (i(t1llS Pla. 4400 Graeciood Ave pin.: Works of IS. Bach. incking Can 10th irttidayTribote to Laurence time, date.dress, priceid be staged The OaÊ- s Party Room 8 pin. Sko The Skek Pk Dthth De- tata BWV 51, Jatjthzet Gott in aUen number. Davis featudnganists Laurence p ton (&ion wdl host a vomte Fae wiH stage Agatha Landerc Concerto in A Major for Oboe "t)II? Hf) (,iusfs dt2S Da'lsA keiko ASaIIaWa-GOldeÇI, Laurence -Bymail:gs. c/oFioneer sbeneft at the 8 pm. ctiistie's classic nuder mystery with damore; Motet BWV 226. Dec Geist hilft . perf-mance. TKIeI3 are$20 with pro- Je14 karen Kan, Seo lee, David Catering P;ess 3701 W. Le Ave., audience participatpon Peflormances unsrer Schwachheit auf Suite No. 1 in G Sdiane, Tomoko Shibuya and Marl cteds si,ottinç D1OnS Student at 7 p.m. Saturda 3 pJ7i Sundays. A G!enview, ft. 60026. Major (or violoncello: and Brandenburg leotL withcelllst Jacqueline Black 347) Hi;'-()ì()6 Sthoap Fud1kke4s for ttis per- silent auction will be held at the March E-mail: [email protected]. Concerto No. 5 in D Major Tickets S25- and soprano Nancy Gustafson. The \ %Hl% h%rnaKe o idjd a postihow 28 produthon. T,cliets: $lS8 students Uk1 I\U I FAX (847) 486-7451 $35. Call (800) 595-4849 or visit proam will feature Manuel Infantes }Ih, L s -..ulh ial Ion pt Can (Mfl 6351900. . and senior citizertCall (847) 674-1500, www.bachweek.org. DansesMda4ouses"; Claude Da- ' %% .j,III. II J "SUSPENSEFUL, 6ob;*( 2 pin. rth 22 at Lake et 2400. thkago chamber dan (312) Street chiscii 607 Lake St., Evanstort hussy's Prekide No 10, Etude No.fl and Twelfth NI pesentud by Piccolo 225-5226. www.chicagotharnbermu- 7:30 pit thV at Trity Lutheran Sonata for Cello and Piano: J.S. Bach's Theatre at 8 pin Myth 2021 at the sic.orq. Concerts are held at 730 p.m. churck 3631 Go4f Road, Evanston and leccata in E Minoc Alberto Ginastera's Evanston Arts Depot 600 Main SL Sundays at Pick-Staiger Concert Hall JAGGEDEDGED NCDLAS CAGE Allegro marcato from Piano Sonata No. T pin. Madi2B at NorthminsterPres Evanston rket: $25; 520 seniors: $15 on Northwestern University's campus, bytevian Ouch. 2515 Centrai Park. L: Maurice Ravel's Ondine" from '. students. Call (8471 4240089 or visit 50 Arts Circle Drive, Evanston. Tickets: Evanston. A free-wit offeñnq mil be wpiccolotheatrecoin. paid de la Huit"; Alexander Scriabins NI $20-$40. March22 Debussy Sonata ;.I taken at each perlonnance to benefit Etude in 0-sharp Minoc Franz Schu No. 2 Ligeti: Trio; and Spohr Nonet in F The Nt Ministry. an organization bert's "Gretchen am Spinnrade"; and CUSSICAL Major, Op. 31. providuq aid to thkaço's hornetess. Franz Lehar's Meine Lippen, sie Evanston Symphony Orchestra per- "A Lithe Pfiç4 Iisk: Mzth 229 in Ars Viva, conducted by Man Heather- kussen so heiss" from "Giuditta." Free. TERRIFICALLY forms at 230 p.m. Sundays at Pick- the Perfoniiüg Ms Center at Harper April 4, 730 p.m.: Faculty recital, Kurt ington. performs at North Shore Cen- Staiger Concert Hall, 50 Arts Circle Dri Coflee, 1200 Y Alqonquui Ro&L Pala- ter (br the Perfocminq Anti, 9501 Skok- Hansen. Schumann Abend," Tenor ve. Evanston. (847) 864-8804. tine. Performances at 8 pin. Fridays ¡e Bvd. Skokie. (847J 673-300. Hansen will bejoined by pianist Karina www.evanstonsyrnphony.org. Tickets in ENTERTAINING" and Saturdays 2 pin. Sundays Tickets: wnwarsviva.orq. Tickeis:$64 box Kontorovitch in a performance of advance are $25; $20 for senior citi- $12-$15. (841) 925-6100 or wwJarper- seat$45 reserved $40 seniors: $16 Robert Schumann's "Kinderszenen," zens: $5 for students. Tickets at the cot$eqe.edu. students. Marth 22. 430 pin.. and "Dichtenliebe and Liederkreis." door are $28: $23 for seniors: $5 for S91$11S5. students. March 22 'The Voice of the Music ofthe Baroque performs at Viola," with guest artist Charles Pickier, First United Methodist Church of CSO principal violist The program in- DEDBYPOPULARDEMAND! Evanston, 1630 Hinrnan Ave. unless dudes Hector Berlioz' "Harold in Italy," noted otherwise. (312) 551-1414. Felix Mendelssohn's The Hebrides Cíingals Cave") Overture and Richard I go., PAGE B6 Waqner's liegíried Idyll." ,tAN AT.IbNFACKEÒ . "'IRRESISTABI-E.... , THRILL RIDE" .WA. OYAN 550V MOV!5 SLANt", Ñ'l EVERYSECOÑD SNAPS,. CRACKLES AN.DPOPS', ¿t' -Chicago Situ- Tii;,cc s

I

1401111 U$LS Inn.I.n,i T.,! Me%nq kPIW1IIC and I.u, Z1P.COßI Io 43K11 43S$)

1AR1S FRIDAY, MARCH 20

I' UtMLT.

I YE

NOVLAU ti SIA Ii SsiuP%A I, . .847i673.63O1Jorwwwnorthg.Litrg . ' ,,cnI',or,I, tfl'SUCn 'cS,'IA'OJ 9) . ; _Utw ci U iUS5*j.. ISho iSNEV . nnrthlinht SULiCJIO41fls.AU MA UU tI*It5 Uen4niwra LshWAgLCc 5 ' ' COMPLIMENTARY PARKING For tjieati-es and showtimcs: Check local listings . PLAYING THRU APRIL (Ir Text RACE with your ZIP CODE to 43K1X (43549) or Iluli.iiiiii.itheatre .çI_s Visit disney.cornJracetowitchmountain r-

!!_l 'T11tirda MiiMi lfl,'2Ó09 i Ñ4ERSÌÒWS ,,ThursdnMnrcli b9()O9'I -'--.-----.---.- ,Ion chestra, Sarah Oartshore, soprano, 3 p.m, Sundays at Pick'Staiger Concert wwwparkridqecivicorchestra orq April Haydn ali wrote works for it, Zukerman the 1FB BantWednejay5 S:3Opm. Chicago. Tickets: $10; $6 for senior citi- retrospective of music from the $15 for senior citizens and students. at the door, March 21, 8 p.m.: David advance, Aprilt 8 p.m.: The Jazz Fauré forms. $10-$25. April 2, 8 p.m.; Graham go. Emily Iodine, mezzo-soprano, Ryan Be- FlaIl, 50 Arts Circle Drive, Evanston, un- and Newman, together with Bienen 26 2:30 p m.: The Spirit of Brahms: A North Shore Sleppin' (DJ), Wed.' zens; free for children under 12. (773) longie, alto. Harold Brock. tenor, and group's first 10 years, Including classi- Complimentary admission for breast Honeyboy Edwards (blues) with Adron Project, featuring singers Claudia Horn- Parker. $25 in advance; $30 at the door. less otherwise noted. Tickets $15; $12 German Requiem, with the Park Ridge School of Music flute students Beth De- days 10:30 p.m John 631'9131. cal, jazz, gospel, rock, folk, R&B and cancer survivors. Call (773) 250-SING. Continued from PAGE B4 Douglas Anderson. baritone, Thepro- Nance Urban Moore. $15 in advance; $20 at the door, mel and Sean Harris, pianist Bobby AprIl 3, 8 p.m.: Shawn Mullins with seniors: $6 students. (B47) 432-2263. Civic Orchestra Chorus, the Park Ridge toril, Amanda fuerst and Eva Ryan, wilt Dance Mix (Di). March 19, EthIcal Humanist Society Second Sat- qrani includes Handel: Coronation An- 7 p m: IiI other genres. "Celebration" will in- Skohle Theatre Music Foundation March 26, B p.m.: Porter, Batiste and Schilf, Tim Davis, drums, Jerry DiMuzio, wwnorthshoreband.orq April19: Community Church Chancel Choir, the perform their own Interpretations of Fest Presents ((0th/rock), urday Coffeehouse, 7574 N. Lincoln Avè, dude classical and folk songs from David McMillin, S20 in advance; $25 at them No, Zadok the Priest"; Haydn: March 19, io presents concerts In the Skokie The- Stolta of The Funky Meters (soul/R&B). saxophone, flute and clarinet, and Jim these compositions. $14/$1O/$6. www.baroque.org, Single tickets are Steve Cohen professor of clarinet at Music Institute of Chicago Chorale, p.m.: Northwestern Band Night (at Howard), Skokie, (847) 6Th3334. England, Germany, Finland and India as aire, 7924 LIncoln Ave., Skokie. Call the door. April 4, 8 p.m.: The Refugees, Mass in 8-flat Major, Missa Sancti lPOpl. $20 In advance; $25 at the door, March Cou, bass, The group fses the $30-$75; $25$3O students/sen ors. Northwestern University, joins the UCB Sarah Hibbard, soprano soloist, and Pe- Regenstein Recital Hall at Northwest- March 20, 5:30 pm,: www.ethicalhuman.org. April 11, 8 p.m.: well as arrangements of "Midnight Bernardi von orrida Pürcelt: King Prohibition Or- (847) 677-7761 or visit www.skokiethe' 28, 8 p.m Josh Rage with Curtis Peo' melodies of 19th cenlury impressionist March 29, 7:30 p.tn to perform Michael Daughertys orn University, 60 Arts Circle Driva, CeIebralel Han- 1er Van De Graaft, bass'baritone chestra BigRand Jazz, The SassI Trio and Andina & Rich, Doors Train to Georgia," "Fields at Gold," "So atre.com. Concert tickets $20 In ad- go., PAGE B8 Oberonts birthday sequence (rom 'The March20, 8O pies and Ernie Halter (pop/rock). $10 in composer Gabriel Fauré with jazz del, Haydn, Purcell, Mende'ssohn," Brooklyn Bridge. The all-American soloist. Evanston. (847) 467-4000. Most ticket p.m.: LV Banks Blues Band, March open 7:30 p.m.; no open mike this Cool" and Stephen Sondheirn's "Not Fairy Oueen Act 1V and Mendelssohn: 21,3 vance; $25 at the door, unless noted Jane Grover, Conductor. Featuring the program also includes Frank Ticheli's Pick-Stalger Concert Hall at North' prices listed ín three categories: gen- p.m Afton Presents (rock), month to allow for longer concert. $7 Getting Married." Tickets: $30: $20 for otherwise. March 20, B p.m.: Three Symphony No, 4 in A Major (Italian), March21, Music of the Baroque Chorus and Or 'Wild Nights; Chance's Eleqy; and western University, 50 Arts Circle Ori' eral public; senior citizens and NU fac- 8:30 p.m Sammy Fender inctudes refreshments. NodMiiore Concert Band perforns at Blues Band senior citizens and students: $10 for Troubadours - Jeff Libman, Brad Cole tulis "Sketches on a Tudor Psalm." ve, Evanston. Information: (847) 491' ulty and stall; and student rate. March Famous Freddie's, 1799 S. Busse Road, , - . March 21, 11:30 p.m IRCEvents Pré- children under 12, For information, visit and Terry MacNarnara. March 21, 8 p.m., a.. Northwest Symphony Orchestra, Paul 5441: tickets: (841) 467'4000. 30, 7:30 p.m.: U.S. Army Brass Quintet sents (world music). March 2 Mount Prospect. (847) 593-2200. www.lahesidesInqers.com, and March 22, 2 p.m.: Ava Logan's Irib- 7 p.m.: Vermel, music director, presents con- www.pickstaiger.org. Most ticket prices presents selections frani all eras and www.lamouslreddiesroadhouse.com. Ed Holstein (folk), March 26,7 p.rn:tii Myron and Phlls, 3900 W. Devon, lin- ute to Ella Fitzgerald & Friends, March It's a Weddngt It's teils at 3:,30 p.m. Sundays in the The- listed in three categories: general pub' genres of classical and popular music, Music at 9 p.m. Fridays and tO p.m. Sat- cofnwood. (841) 677-6663, Fridays, a FeutI It's s Show! Fest Presents (folk/rock), Mcrch27, 25, 1:3') p.m.: Music of the World, $10 in aIre loi- the Performing Arts at Maine lic: senior citizens and NU faculty and interactive entertainment, video and urdays, unless noted otherwise, March through Apl 24: Karaoke contest, 530 p.m Alte SchtiebebesBleamer advance; $15 at the door. Seniors and 'A West High Schoo 1755 S. Wolf Road, staff; and student rate. March 20, 7:30 works for children's concerts. Admis- Band, March 27, 8:30 20: Sure Fire Groove (blues/rock). Na Mele Aloha, the Hawaiian music Hiles Township residents, $10 In ad- W41C p.m.: Pistol Pete ) Des Plaines. Pre-concert commentaries p.m.: Pianist Jeffrey Siegel presents sian is free. April 4, 9 am.: Master March 21: Arra (classic rock). March 27 ensemble from Qakton Community Col- vance or at the door, March 27-28, 8 Blues Band. March28, 8:30p.m.: Live by Carolyn Paulin, a statt member of Keyboard Conversations, "The longevi- Class, Eugenia Zukerman, flute, Free, reggae with TRC Entertainment March X-Side. March 28: Kashmir (Led Zepplin lege, will perform at noon April 1 at the p.m.: Corky Siegel's Chamber Blues. radio station WFMT begin one hour pri- ty of the Short Piece." The program S,P,A,C.E., 1245 Chicago Ave,, Evanston, ' 11:30 pm TRC Events Presents tribute). Cultural Arts show at Oakton Commu- $25 in advance; $30 at the door. March -, or to each concert. Tickets: $20: $15 for features "Songs Without Words" by Fe- (847) 492-8860. (world music). trish American Heritage Center, 4626 nity College, 1500 E, Golf Road, Des 29, 2 p.m.: "Gershwin's Greatest Hits" ' seniors $10 for students. Children un- www.evanstonspace,com. March 29,4 I 'j lix Mendelssohn, "Lyric Pieces" by Ed' Bluepas LegendS Concerts N, Knox Ave,, Chicago, (773) 282-7035, Plaines, Call Earl Essig, (847) 272-0762. with Elaine Dame. April 1, 1:30 p.m.: Mu- presents der age 14 are admitted tree whenac- yard Grieg, rhapsodies by Johannes pro.: Den,pster Street Pro Musica. $24 www.irishamhc.com. Entertainment at Nites Public Library, 6960 kV. Qakton sic of the World, $10 In advance; Sl& at "Chapter NI of the First AnnualChica' in advance, April 5, 4 and 6:30 p.m.: The companied by a paying adulL Brahms and nocturnes by Piotr Ilyich go Bluegrass Festival" at 8 p.m. April4 9 p.m. Fridays and Saturdays In the St. (847) 663-6623. the door, Seniors and Nibs Township Www.northwestsymphony,org, Marth Musical Offering School of Music pros- Fifth Province Lounge, no cover - www.nilesllbrary,org. March 21, 3 p.m.: residents, $10 in advance or at the Tchaikovsky. $23/$21/$16. March 28,7 at the American Legion MusicHall, , 29: Scolland and the Sea," with br- p.in Zen arts master Shozo Sato will ents a classical music and opera per- 1030 Central SL Evanston, Performers March2O The Celtic Groundhogs, Crìcketthlll: Intertribal Powwow Drum door. April 3, 8 p.m.: Sons of the Never danka Kissioya, violin, Mendelssohn: guide audience members through a formance, in collaboration with the include Tangleweed, Whiskey Hoilo March 21: Dyed In the Wool. March 27: Group, Wrong, April 4, 8 p.m. and April 5,2 flngal's Cave;Stephen Paulus: Sea Por- concert of music by Japanese musical Chicago Academy for the Arts, the &luegrass Band, Henhouse Prowlers, Seamus OKane and Jimmy Moore. Northwest Café, in the Norwood Park p.m.: "This Ones For 'iou - The Songs traits; Bruch: Scottish Fantasy, Opera Company and the Dal Niente . Chicago March2B The Dooley Brothers, train station, 6088 Northwest Highway, ensemble Kola Sound Team Kyara. Bluegrass Band and James of Barry Manifow," starring 3Glrls3. $25 The Orion Ensemble performs at the Players. Sl2; $8 students and seniors. The Ura Singers will present a con- March 20 7:30-9:30 ,m.: Friday Night in advance; $30 at the door. April 5, Free. March 31, 7:30 p.rn Spring Eesti- Creek Road, Doors open at 7p.m. Tick' Music Institute of Chicago, 1490 Chica' val, The Darai Anqer'M:ke Marshall Duo ets: $20; S15 for youth 16 and under ceri of Italian and Polish iniusic at 3 Love Songs with Chris Corsale. Free- 1:30 p.m.: Music of the World, starring go Ave. Evanston. Tickets are $25; $22 p.m. March 22 at Our Lady, Mother of will donations will benefit Night Mm- Eddy Patay, April 8, 1:30 pm: Tribute to and Vasen. A string collaboration will POP/FOLK/JAll and senior citizens, Reserve ticketsat for senior citizens $10 for students. the Church Parish, 8747 W, Lawrence Istry. Nat King Cole, starring Marcus Gentry, bring together violinist DaraI Anger www.chicagobluegrass,com Ave., Chicago. A lree'will collection will Rosemont Theatre, 5400 N. River Free for children 12 and younger, (630) (founder of the Turtle Island String Allstate Arena, 6920 N. Mannheim Bliaes Bar, 2 W. Busse Ave., Mount $10 in advance; $15 at the door. Seniors 628-9591 or Www.orionensernble,org, be taken to help deftay concert ex- Road, Rosemont, Tickets are available and Nifes Township residents, $10 in Ouartet) and mandolinist Mike Marshall Road, Rosemont, Tickets are available Prospect. (847) 788-9971 wwwblue Marth 29, 3 pm: [aura Elise at www.tichetmaster.com or (312) 559- penses. A reception follows the per- at www,ticketmaster.com or (312) 559- advance or at the door. April 15,1:30 with the Swedish string trío Vasen: bar.com, March 28, 9:30 p.m : Lii' Ed k formance, Call (773) 626-3369 or (771) Schwendingers 'High Wire Act"; Max Olor Johanssan, nyckeiharpa, violist 1212; the ticket prices listed below do the Blues ln'iperials. 1212; the ticket prices listed below do p.m.: Dean Martin Sonqbook. $10 in ad- 508-7040. not include service fees. For more in- vance; $15 at the door. Seniors and Bruch's Pieces tar Clarinet, Viola and Mikaei Marin and guitarist Roger Tall- not include service fees. The informa- The Celtic Knot Public House, 626 Piano, Op. 83; and Felix Mendelssohn's tian line is (847) 635-6601. May 4-5, Morton Grove Public Ubrary, 6140 Lin- formation about the theater, call (847) Nifes Township residents, $10 in ad- roth. S16/$l2/S8. April 3, 1:30 p.m.: Church St. Evanston, (847) 864-1679, Piano Trio No, i in D Minor, Op. 49. 7:30 p.m.: The Dead. $95, $50, May 9, coin Ave, (841) 965-4220. March 22,2 671-5100. May 19-20 and July 7: "An vanceorat the door. Flutist Eugenia Zukerman and hey- www.celticknotpub,com Ho cover un Park Ridge CMc Orthetra presents 6:30 p.m.: Fall Out Boy with Metro Sta- p.m.: "Abraham Lincoln in Song," pre- Evening with Il Divo' $55, $85, $125 and S,P.A,C.E.. 1245 Chicago Ave. Evanston. boardist Anthony Newman present less noted otherwise, Mondays, 8p.m.- sentad by folksinger Chris Valilbo, $150, (847) 492-8860. concerts at the Pickwick Theatre, 5S. "Pieces for the Musical Clock." The mu- (ion, Cobra Starship and All Time Low. midnight: Bluegrass and roots music Music Institute of Chicago, Nichais The Sing to Live Community Chorus www.evanstonspace.com. March 19,8 Prospect, Park Ridge, Tickets are $25: sical clock - a clock with internai pipes S41, $31, $26. May15, 7:30 p.m.: Keith Ur- with the Mudflapps. Tuesdays, 7-IO $20 for students and senior citizens. ban's "Escape Together World Tour." Concert Hall, 1490 Chicago Ave,, presents "Sweets for Lovers" at 7:30 p.m.: Mitch Lavin Accident (rock). $10 in and bellows - was so popular during pen,: Irish music session. March ZZ 58 Call (847) 692-PRCO or (847) 823-8861 Zac Brawn Band opens. $59,50, $39,50 Evanston. (847) 905-1500, www.mu- p.m. March 21 at the Music Institute of advance, March 20, 8 p.m.: Paul Cebar the late 17th and 18th centuries that p.m.: Eric Lugosch. March 28, lO pin: or visit and $20. sicinst.org, April TI, 8 p.m,:The Lake- Chicago, Nichols Concert Hall, 1490 Tomorrow Sound with Pele Special composers Dach, Handel, Mozart and Naomi Ashley. April 5, 8 p.m.: Andy side Singers present "Celebration," a Chicago Ave,, Evanston. Tickets: $20; (American roots), $15 in advance; $20 Bill's Blues, 1029 Davis St., Evanston, White. April 11, 10 p.m Bluegrass Adca' (847) 424'9800. www,biilsbfuesbarcom, cates.' Cover charges vary. Sundays, 4 p.m.: Chamber Opera ChicagoPresents Dale Wasserman's Don't miss Chicago Grandstand Big Band will vili Eiltest Open Mike, Mondays, 8:30p.m.: pesent a concert of American jazz Mike Finnerty Pro Jazz Jam. Tuesdays, 't one of the from 4-6 p.m. March 22 at Edison Park 8:30 p.m.: Bill's Blues Jam, hosted by best-lovéd Lutheran Church, 6626 N. Oliphant, rnusicáls r n' of à " s äflo generation! - s - is - I. -I S S- SI I,. .a'. I

I C by Milch L&gh, Lyrics by Joe Dariori - !Wauct1a S IS Limitéd Engagement! I A Saturday, March 21, 2OO '"- - A I 'JjJ ,. 1 Sunday, March 22at 3pm J .JLIL.! Performance Location: Athenaeum I Theatre 2936 N. Southport,Chicago I Tickets ($15-40) availab'e Clue Hunt, at Tícketmaster outlets, byphone I Murder Mystery and Dinner I I'' I at 312.902.1500, atwww.ticketmaster.com or at the I I Reservations Limited Athenaeum Theatre Box Office:773.935.5860 I Call Mon-Fri(773) 267-6400 , t Directed by Rudy Hogenmifler s i ' With Orchestra, Coñductedby Nyera Basney Choreographed by Dame Libby Komaiko I www.inyste ltd.com featuring Flamenco Dancers i s s . from Ensemble Español Spanish 'i-I., , e o Dance Theater se Starring 1

a I s i u _iÌll;PI.L . , s S r - )Chan0be I

. . era !t. . i.,' . A ::jam s Ha?ms Barbara Landis 1homas M. Shea .:2c.1;I'Qago I 1'iA1aÓTîaT (ireag OI'c'ra, AIw1 ' :-. 't,Jftii'daf,!c'! s Fdr more informatj.cn, I. p'iase.vjs,t org or cIl 312.951.7944 L .1 p.

.08 Thursday,rtirch 19, 2(}()9 IID1YEfiS}ONS J rl Ölvtg I, .(P.I.uç,f;t,'Mnr1i 19; ÖÒ9 jr9 ception for Robert logan and lain Fras at Bank of lincolnwood, 4433 W. Touhy Prospect and Vine streets, Park Ridge between the l-59 and Beverly Road ex- er will be held from 68 pm. April 3. Ave., lincolnwood: and Claire L Hirsch Visit www.americansocietyolarlislsorq Blvd., Shokie, The lladassah fundralser Clnderella will be presented by stage "Thar's Gold in Them Thar p.m. April 12 In Northwestern Universi- Morton Grove PublIc LIbrary, 6140 Lin- its, Hoffman Estates. Proceeds will help !UO. Emily Oaks Nature Center, 4650 exhibiting her oil paintings at the 0e- or call (847) 991-4748, wilt feature the Israeli dance company Chicago kids Company at 10:30 am. Clothes" at 7 p.m. March21; 3 and? ty's Ethel M. Barber Theater, 30 Arts coIn Ave. (84?) 965-4220. March 21 and vxnshire Cultural Center, 4400 Green- ÇatI for artists for the Skoki pay medical expenses for retired Ranana Raz. Tickets: $36. Visit Continued from PAGE 07 Brummel St., Skokie. (841) 674-1500. Art and ñoon AprIl 14-17, 20-24, 21-28, 30, p.m. March 28; and 3 p.m. March 29 at Circle Drive, Evanston. TIre musical Is April 18, 10 a.m "Saturday Shorts," Maine West High School wrestling www.chicago.hadassah.org or call Through May a' Skokie Art Guild 2009 wood St., Skokie. Guild's 48th annual Art Fair, tob bold May 7-8 and 22; 1 p.m. APrII 25, May16 ihe Levy Center, 300 Dodge Ave., based on some of Aesop's fables, in- video adaptations of award-winning July 1112 on the Skokie Village coach Richard Carlini. Tickets: $62- (847) 675-6790. and July 11; and 10:30 am, May members' spring exhibit. "Nature's Green 12.14, Evanston. Tickets are $6 through cluding "Tortoise and the Hare," "The classic children's picture books. Red- Ieaturinq Weiidy Wadman, Deborah 5211 W. Oakton, Skokie. Prizes $202. Visit www.ticketrnaster.com or Palette." AUDITIONS G an 19-21,26-29, June24-6, JuIyl-2 and?- March 6; $8 thereafter. Call (84?) 448- Boy Who Cried Wolf," "Androctes and omniended for ages 3-8. March 29,2 Holland and Cindy Bullens (folk/rock) call (800) 745-3000. Evanston Art Center, 2603 Sheridan OPPORTUNITIES awards, E-mail ih0 BOOKS LPOETRY 10at the Stahl Family Theatre, 5900 W. 8250. the Lion" and "The Ant and the p.m.: Denis DeBondt: Very Funny MagicI $12inadvance. April 9. 8 p n.: The A Magical Evenlng7 the annual Ars MeIlOPI Road. (8471 4155300. call (647) 617'8I&3. - Belmont Ave., Chicago. Tickets: $10. Call Evanston Ecology Center, 2024 Mc- Grasshopper," Tickets: $20; SIB for sen- Nibs PublIc Ubrary, 6960 W. Oakton Trews (rock). SB in advance. Viva Symphony Orchestra benefit din Morton Grove PublIc LIbrary, 6140 LIn- www.evanslonarlcenter.org. Gallery (713) 205-9600 or visit Cormick Blvd., hosts its annual Arbore- br citizens; $10 for children and full- St. (84?) 663-6623. MUSICIANS MISCELLANEOUS ner, will be held at 5:30 p.m. APrII 28 at coin Ave, (847) 965-4220, March24,? hours: IO am-lO p n. Monday-Ihurs- www.chicagokidscomparay.com. turn Egg Hunt on April 11. Choose from time students, Call (84?) 491-7282 or www.nilestibrary.org, March20, 10a.m.: the Enmoor Country Club, 700 Vine St., p.m.: Discussion of Thefrfyes Were ART GALLERIES day: 10 a m-4 p.m. Fridays and Satur Canzonetta Youth String Chamber Or- Morton Grove Public Libraryseeks en Covenant Nursery School, 1420 Maple four "hunt' times: 10 am. 11:30 am., I visit www.tic.norlhwestern.edu. Polish Storytlme for ages 2 and up. tries for its annual writing Ilighland Park. The evening Includes a Wa(chiaqGodby Zora Neate Hurston. Ave. (in the YMCA Children's Center), p.m. or 2:30 p.m. Children search for TheM days; I-4 p.m. Sundays. Through April 5: chestra, under the direction of Hilel contest. In MchelI Museum of the Amerlcan In- Oakton CommunIty Colleqe, 1600 E, Block Museum ofArt at Northwestern silent auction, dinner, performance by March 29, 3 p.m.: DIscussion of The Evanston. March 21, 3-4:30 p.m.: "One 'WithOut Borders," an exhthtion of Kaan, is accepting new members for honor of National Library Week,the li' eggs In the Ladd Arboretum and ex- cUan, 3001 Central SL Evanston. (847) Golf Road, Des Plaines, (847) 635-1900. University, 40 Arts Circle brive, . the Magical StrIngs of Youth, and the Readerby Bernhard Schlink at Star- World," a family-friendly celebration of change them for small prizes. A special works by artists of the global multi- its spring season. Rehearsals begin brary is Sponsoring its fourthannual 475-1030. www.ml(chellrnuseum.orq. Mai-ch 21, lO am.: Family entertainer . the Hilarious Evanston. (84?) 491-4000. www.block presentation of the Ars Viva 2009 bucks, 6763 Dempster. culture who are living and working in March 21-22. Training Ensemble (ages writing contest, with Iwo categories, mutticulturatism featuring SOUL. Cre- area Is reserved for children age 11/2 Suggested donation Is SS adults; S2.50 Jim Gill performs, Tickets are $4; $5 at el eb rat Ion museum.northwesle,n,edu Through Award for Excellence to Betty Haag- ations IntergeneratIonal drum and to 4 years, Bring a basket or a bag to senior citizens, students and children. the Chicago area. 7-Il) meets 1:30-2:30 p.m. Saturdays; In- students in grades 7-12 and adultsage thedoor. f women arid April 5; ¶roni Michelangelo to Anni Kuhnke, director of the Betty Haag hish American Heritage Center Art termediate Ensemble (ages 10-14) 19 and up. The theme for 2009 is CHILD'S PLAY dance troupe, SIG suggested donation hold the eggs, Activities and a craft Maxlthurn suggested admission per .Sesame Street Live "When Elmo bale Carracci: A Century of Italian Academy, $175 per person. To make a per family at the door, Proceeds wilt follow the egg hunt. Cost IS $4.5OIper- family Is $10, Kids Craft MornIngs are lhe Change!' Gallery, 4626 N. Knox Ave., Chicago. meets 3-4:30 p.m. Sundays; Senior En- 'Worlds Connect @ Your Library."Rules Grows Up," 1030 am. and 7 p.m. May 7- Drawings (rom the Prado." This exhibi- reservation or request an invitation, Centre East In the North Shore Center (773) 282-7035. Gallery hours are l'4 semble (ages 13-18) meets I-3 p.m. Sun- are: Maximum of 500 words; entries benefit the Covenant Scholarship Fund son. PreregistraUon is required; call offered from 1030 am-noon, Partid- lion of 70 drawings explores the work- 81 130 am., 2 and 5:30 p.m. May9; call (847) 61 S-1811, for the Performing Arts, 9501 Skokie Ioprovide tuition assistance to fami- p.m. Saturdays and Sundays. Through days. All practices are held at the Wit- must be printed legibly Or typedo 8S (847)448-8256, pants must be accompanied by an and 1 and 4:30 p.m. May10 at the Rose- (ng methods of the most important "Dancing the Dream 11 Kazuarla," 7 Blvd., Skokie, (84?) 673-6300. www.cen- lies In need. Call (847) 475-2990 or visit March 29 "Irish Eyes," showcasing mette Recreation Center, 3000 Glen- X 11 inch paper and the author'sname, How Can You Run with a Shell on adult, No pro-registration Is necessary, artists active in Italy from 152OE1620. p.m. Aprii 30 at the North Shore Center treeast.org. April 19, 1 and 3 p.m.: Junio paintings and photography by lrislr view Road, Wilnretle. For auditions, call address, and age category must be www.covenantnurseryschool.org, Your BacltT will be presented at 7 p.m. tilarch28: Northwest Coast button go.,PAGE 811 Through April 5: 'Polaroids: Map- or the Performing Arts, 9501 Skokle B. Jones. $18. American Chicagoans. Artists include Helia Schramm, (841) 328-0570. printed oñ the back of the entry. En- Evanston Children's Theatre will April 10; 10 am. and 7 pin. Apdill and 2 blankets, plethorpe" exhibition. n lhe Alsdorf Pam Ryan, Mary McCluskey and Torn tries must be received in the libraryby Gallery. The show huinqs together 100 SINGERS Joyce. Students of the Center's Tradì- 9 p.nì. APrII 6. Winners will be ap- Banquets StCatering works, including self-portraits, ligure r Northwest Choral Society seeks bass, nounced April 13. For information,call for all your needs studies. stilt-lifes and portraits of tional Celtic Art Class will also be in- (847) 965-4220. friends and lovers. Some material may cluded in the show. tenor, alto or soprano singers with pre Fnrsh SeafoodDaily Lincolowood Village NaIl, 6900 N. lin- vious choral experience. Auditions will be Inappropriate for younger or more o . CasualAlmosphei'ne sensitive'audieces. coin Ave., Lincolnwood. Gallery hours 9 be held during rehearsals on Tuesday BENEFITS . LiveEnlerlaiunient Iïtmar Memorial Gallery at North- a.nt-5 p.m. Monday-Friday. Contact evenings, through March 24, at Im- DelkjousSteaks & Chaps Fundraiser Feast 2009, to benelit the western University's Norris Center, Shirley Engelstein, fine arts coordina- manuel Lutheran Church, 855 Lee St., ' OpenforLirnch &Dlniierøaily 'Carry-outAi'ailablc Evanston Children's Choir, 5-7:30 pm 1999 Campus Drive, Evanston, {847) ter, (847) 674-3806. Through April30: Des Plaines, The chorus presents three p March 20 in MacLeish Hall at Lake A 491-2348. "A Tribute to Hal Foster" by Sidney concerts of classical and popular mu- JoinUs ForOurEaster Champagne Brunch Buffet or online at www.CentreEast.org Street Church, 607 Lake St., Evanston, www.norrjs.northwesternedu/djttmar Weiskirch. sic each season, including a holiday Featuring an all-you-can-eat potluck 5L\ OnSunday,Apri112' CENTRE EAST AT THE NORTH SHORE php. March 30-May 6: Robert Logan, Morton Grove Public Library, 6140 lin- concert, a winter concert and an early dinner with live music by the ECC Main 1O:OOam-5:OOpm , CENTER FOR THE PERFORM!NG ARTS 'Constructjvists chicago," featuring coin Ave., Morton Gro"e. (8411 965- summer concert. To schedule an audi- and Junior Choirs, a silent auction and tlinncrt'lrntiloolloiv . 9501 Skokle Blvd. abstract large-scale photographs of 4220. March: 'Visions in Photography," tion, call f113) 504-3426 or visit r;' a raffle. Tickets: $15; $10 students and Skokie, IL 60077 man-made structures in and around by Morton Grove resident John Peter- www.nwchoralsociety.org. )A' EnjoyOver 80 SavoryFavorites! $27.95 seniors; $5 br children 12-li; free tor For discounts on Chicago's Loop by Robert Logan, a 90- son, will be on euhib,t in the Baxter Featuring Carving SIaIlon, Fresh Seafood Adult ARTISTS children under 12. For tickets, contact And hand Carved Prime Rib! year-old Highland Park-based photoq- Rnom. groups of 10+ call: Gary Geiger at (847) 733-0814 or DinnerFollowed BvSweetsAnd flesserisl $ 1.95 (312)423-6612 CALL TODAY! rapher, March 30-May 6: lain Fraser, Oakton Community College, Koehn- Artist applications are now available Children 4-11 0 Complimentary Ñ(imosa & Champagne "missed places." Canadian-born archi- line Museum of Art, 1600 C. Golf Road, for the 24th annual Evanston Ethnic Children U:jdcr 4 Reba McEntire and Red .Steagall will Rescrvalions R s ulted SoCallToday! caniiaimciiary test and St. Louis-based artist Fraser Des Plaines. 1847) 635-2633. www.oak- Arts Festival, which wilt be field July 18- perform a benefit concert at 7 pm. 3 . , will exhibit his three-dimensional steel, ton.edufmuseum Through March 21: 19 at Dawes Park along Evanston's . (847) 647-8282 Www.MenopauseTheMusjca( corn March 21 at Sears Centre, located in the glass and concrete constructions. A re- "Paste's Chicago," presented by the lakefront. The festival is open to ethnic v'' Prairie Stone Complex on Interstate 90 6881 N.Milwaukee,4ve., Nifes,IL Chicago Pastel Painters. The juried ex- artists and art vendors, Application 10 hibition features 100 works represent- deadline is April 6. CoIl (847) 448-8260 t ing a diversity of visual styles and sub- for information. I. jects. Artists and craftspersons are invited Skokie Art Guild artists showing to apply to participate in the 19th an- throughApril30 include Hope nual An Arts S Cralts Adventure, to be Salmanoff exhibiting her oil paintings presented May9 in Hodges Park, THIS SPRING p James and s s. River North 1ACflflt the Giant Peach rÖptRfo?Mr 11P15 4610 Northffaricm Avenue TAKE A BREAK WITH s I Chicago Harwood Heights I a , Phone: 708-867-4072 WEDNESDAY, APRIL 1 Dance Company ChicagoSouthland'g Premiere ThitertalnznentVenue I s lo A.M. & 12 P.M. SATURDAY, APRIL 18 'CARHY-OUT SPECIAL s A II. Join James and his lovable new insect 8P.M. friends as they journey dowh the hill, ..RJ&ans :ctiIì3 'M Salsa through the countryside, across thesea and si FefdsI'amiiyaIFosr % into the aid Discover, along with our heroes, how a little magic can take you a long way. ,$1989. ,

,,-. 'OEooW8, Nio,i .ot,ody

, J . top A

«Exuberant, . . . J playful, full GROUP. . of rapid-fire... I percussiue I, F! energyl" ' I'&;ph!!Aí'ÑöÌ1)pflIy.. i Box Office 773348.4OOO L S - CHICAGO SUN-TIMES V" tickpJmaster 800.982.2787 0 S S ,bRb1LU.lILT: s II I VALIDMONFRI. ONLY I ¡4 s II I .N.tuiidik sq lMedI,c.@ii w IpKi*it , I,, 4 . ,, I : EXPIME,:4,vDa . I 3133 North Haisted I; CATERING & PRIVATE I s s s. i. REGroup Sales 773.348.3300 :' ROOMSIJPTO15O t t -i I S :1 .1 8808 I N. Milwaukee Ave. . s 708-23 5-2222 I NILES,IL.. . thfltitrtjketsnct..-- J The Cent.r s Iocked rnInut, offI-57 '(847)297-5555 i .800..BLUEMAN I BLUEMAN;COM Itth. 5aui 1i11 E,. Parking Avallabi,. -':: I s.www.rosslnlsltailan.00rn, V

'Hto T}U!It 19, J Aìwh hûsíó'ÑS I A Pioneer Press Publication I DLVRSlQV$ I Thursday, March 19, 2009' BU

S.PACÍ., 1245Chlca90 Ave., Evanston, "The Wizard of Oz. T p.m. April 2-3 at le Mason.$72. Montrose Room for an open run. Tick- topez: TaU, Dark & Chicano Tour. Tick- go. (847) 49?8860. Hitch School,5625N. McVicker, ChIcaS Hotel Intercontinental Chicago ets are SIS and can be purchased at ets:$59.50and $67. 'Murderon www.evanstonspace.com. April 19,11 co. Tickets:$8; $5for children.(773) 0'F4ar,5300N. River Road, Rosémont. www.ticketmasler.com or(312)559- Us BeerCompany, 1801 N. Clybourn March21, the Orient Express' script solved Continuedfrom PAGE B9 am.: Justin Roberts.$15n advance. 534-1)89. Through April25: ComedySportz, 8 1212. Aves Chicago.(773) 811-7799. MURDER ON THE "Whoops,That Came OutWrong: The p.m Saturdays In the Montrose Room. Rosomont Theatre,5400N. River 8:30-10 p.m.:Skokle resident Debbie Devonshire Playhouse, By J.T. MORAND Vøflshi)e Playhouse Oil fl was without a script. actors," she said. "Evei.y tab Chronicles,' presented by Mudiark Tickets:$21at www.tickmaster.com or Róad, Rosemont. Tickets are available Sue Goodman presents a comedy per- ORIENT EXPRESS' 4400 Greenwood Ave., mont Theatre,5400N. River Road, COMEDY [email protected] trip bnck in time. She had to develop one's been enjoyingacces- Theater Company at7:30p.m. March by calling (800)7453000; $30at the al www.11cketmaster.com or(312) 559- formance based on her books, SI/JI S/n- 7 p.m. Saturdays, Rosemont, Tickets:$15, $20and$30. 728 and3 Shokie. $8-$10. (847) 6741500, Playhouse actors aiul her own, which she did by sorizing with hats, gloves, p.m. March 29 at McGaw Y Centre East In the North Shore Center door. For information, visit www.corne- 1212: the ticket prices listed below do gle and SIiIDatIng. SS. 3 p.m. Sundays, Ext. 2400. plus $35Gold Circle seats. For tickets, Childcare Center,1410Maple, Evanston. for the Performing Arts,950)Skokie dysportzchlcago,om. Every other Fr1- not Include service fees. For more in The Orient Express is c1.ewLUeputting Uil borrowing from the etc." call(800) 7453000or www,tIcketmas March 21-ApriI 5 at the Tickets:$12: $5for children. www.mud- fllvd., Skokie.(847) 673-6300.www.cen- day,8pm 'lin-lied," lmprov by An formation about the theater, call(841) go., PAGE B12 pulling into Skokic's De- Agatha Christie's "Murder screenplay for the 1974 lt helped that Muzd, (eccola, tarh(heater.org. treeast.org. April2123, 7:30 p.m.:Jack- noyance Theatre. Performances In the 611-5100.June19-20, 8 p.m.:George OUthe Orient Express" filin version and from the on the Orient Express is between March 21 and novel. one ofDastugue's favorite "1 originally thought April 5. The story follows Christie novels. te. detective Hercule Poirot the screenplay was going "There's a wonderfully as he attempts to solve a to be easier because of the q'i touching end to the story, murder on the Orient Ex- dialogue," she said. "But líti t so I think its appeal is L A PtCSS train, which is full ofthe movie uses so many . suspects, traveling flashbacks, it was hard to unique," she said. "The ---FEøflhJAFV , 4 -APRIL 11 2000, , I. through Europe in the eiwision staging it." characters, as in all of 1930s. So, she used the ex- Christie's novels, are rich t pressive language from and animated. They really Missing script the movie, but used infor- come to life.", JiMH3Mj When theater-goers mation from the book to VThile the show willgo come to watch the play, explain the plot. on March 28, the pre-show s, I p :1, ,, they'll be seated by volun- It wasn't perfect, but train porters and singers I i teers portraying train she and the cast continued will get the night off for BI.ACK , porters and treated to to tweak the script ENSEMULE the Devonshire Theatre THEATER some 1930s pre-show en- through rehearsals. Guild Silent Auction, Tickets Include: tertainment, before they "1 give them lots of L. which starts at 6 p.m. Play, 5 course dinner, see a piny thatdidn't have 3roud1y credit for helping shape Robin H. Ledford, cultural rI* beveraqe, a script. tax & Gratuity the final product," she arts facifity manager !LG ' Director Danon said, adding writing the ':rvu: for the Skokie Park Dis- : Show Dates: March 21,28 Dastugue had wanted script made for a lot of ex- , Aprll4,25 trict, said auction items in- s t to put on a stage version tra work. Call for tickets 815-465-2288 cludetickets to local the- of Christie's murder "I love both fiction and ,._ t mystery since 2005, when theatre, so the work tends atre and sporting events, and the she was enrolled in a di- to bring together two hotel stays and gilt certifi- EXTENDED ThROUGH APRIL 26h, -. recting program at Roo- things I enjoy," she said. cates. Boris and Alla Gore- THRU MARCHE ,, e- ; I$ sevelt University. How- "It was worth it." lick will perform violin and Theatre Company i'UitE. ' 'floofltai*lng, M,siica1Iy iJfut(ìt evei she didn't have piano duets of classical c,rniiY Tue . Sun at 7:30, Sat & Sun at 3:00 But, Dastugue didn't 'I,1i\sllcl:'c1r.;,S for - I1JDY SWi enough male actors stop at developing the pieces and Broadway ART :«::' : /t heated debate over noderi: and had to shelve the script. She also took on melodies. .;: -i.. art colors this rich comic project. costume design. "Murderous appetizers study of male friendship SE 1 P But, when the will be served throughout Directed by :LLvE Period pieces Devonshire Theatre the event," Ledford said. Rick Snyder Guild gave her the go- ',It February 5 - June 7, 2009 really fun finding ..hcSiÇlroa ttina I 30Dm ahead in 2007, Dastugue Call 312-335-1650 or 1W period styles for the Comment: ploneeilocal.com www.steppenwolf.org 1 YIIRSUF -,

EXTENDED!rHROUGH ApI 'I ':' ckT$.o&& fi MLv- Th* Fridays ai*i Saturdays at 8O( ! CflPCAGOAPRIL 30- ALSIN AlLEY U ThEATRE MAV3 AMEIL:' M11 UANC TUEATE nday at3:oo . Tkkm .vail.r. 1h. :: P.M:: JUDITH h, ,Mc.. C.II'..7135 Gr..,,. of IO.: Cul Ifl'447-1%49 ft' JAMISON ARTISTIC « DIRECTOR Masazurni Chaya TALKINC13O' ASSOCIATE l'y SI,, tou*,gtloo,1 ARTISTIC

. DIRECTOR Dircctc,I I,y .Rnt,ktò )al,i

January 2Iii,h 22 , tikce 1993/ APRIL THE ST. JAMES INFIRMARY OY ban t,.a,, I FOTk& ' 8 .m'F1ii. Sat 2009 bisi w*tflCW,,W taJ3 t3 OO OW 3 &7p.m: Sundays, __.n____, ,,,1T3g6 , TICKETS: , SQ" AR1 800982.ARTS(2781) Aven,ic 78S. : PIPESALLEY3RD LEVEL23O W. North t'.vL. .S , Ttcketmaster.com Cufl now for Ehowlirne2 & ptic5I 7737'955 ÄUD1TRIUM T-IEM'RE ,. , 312-664-0773 GROUPS 154. : I- :' , ww:e(a'ativcath.urg ,, Mhi-* ''' '312-664-8844 BOX OFFICE auditoriumtheatre.org s '1ComEd,, , .T1CZET*A$TI.CON '.: .. I ' , Ciieck out www.tonyntin.com ,. forspo'ial deals & promotIon ùDnHjAMtsQ« PtroICjEk MÌtth.11 -1916 fl3.S5 GM HcCorry (second from _1 I e. right) rehearses with MarionMleinman (far left), Dorann Sireikis (sec- and from left) and Ieri Lang(far right) for the play, "Murder on the Orleñt Ejñss." McCorry Is 0 r O p pIainq Agatha Christie creation L I s p, s I Hercule Poirot. (Buzz Orr/PloneerPress) s I II , s. , .z ._r Lrt A?fZ..tJ p,

ma'ThUrdny, March'19, 2009 A Pionéer Vress Pub(icnj r TI1ttrí«1nS' M(rch 19, 2(YOfl IDIVERSIONS A.Pi(),iéeI P1'EE PUt3liQn!t DwdtrnN '

for the Performing Arts, 9501 Skokle celebration of Irish muslc, song and Frankhn Park. Mostly swing dancing, fling." April 13: "taxes and Tears." April (Russian, 2000); and "Innocent Voices" Skokie, November through February, Btvd., Skokie, (847) 6736300. www.cen dance. Performances at 7:30 p.m. some ballroom, latin and line dancing. 27: "Sunny Days S Happy Tunes." go. (Spanish, 2004). These films are unrat- and then every one to two weeks until I. P LA treeastorq April18, B p.nì River North Thursday 8 p.m. Friday 2 and 8p.m. Open to ages 21 and older. SS mom- Square dance tessons are held from ed by (he Motion Picture Association of the festival, to be held May 15-16, New Chicago Dance Company. $46. Salurday and 2 p.m. Sunday. Tichet Continued from PAGE 011 bers; $10 nonTfleflibers. Membership 7:30-9:30 p.m. Tuesdays at the Glen America and may be appropriate for members and cultural representatives Rosemont Theatre, 5400 N. River $32S69. 1cc $25. Upcoming dates are March28 Park Center, Room 201, 2400 Chestnut mature audiences only. For details, vis- a1eweitOfle. For Information, call Road, Rosemont. Tickets are available and April25. Ave., Glenview. First lesson Is free, It www.oakton.edu/cultures. (6471 6741500, ext. 2715, or visit at www.ticketmaster.com or (312) 559 . GPOUPS&LESSO,IS Chicago's WIndy City Jitterbug Club DANCE Morton Grove Public Library, 6140 LIn- www.SkokleCultureFest.org. 1212; the ticket prices listed below do Chicago Dance Club, (047) 6224466, holds dances to the music of the 50s, coIn Ave. (041) 965-4220. March19, 2 Skokie Photograptdc Society meets at DINING pi I lib not includo service foes. For more 1n Dance to Di musIc from the 50s to to 60s and more. Proper attire required; and i p.m.: "Nights In Rodanthe," rated 7:3Op,mthe third Thursday of each L I $, i' PRIORMANCES formation about the theater, call (847) day from 7:30-11:30 poi. Saturdays at no jeans or shorts allowed. Must be 21 Schaefers, 9965 Gross Point Road, P013. March 24, 11:30 am.: "Hawaiian monttçat Skokie Village Hall, 5127 W, Centre East In the North Shore Center 6715l00. March 1922 "Rivordance," a American Legion Halt, 9757 Pacific Ave., or older. Call (773) 46701fl or visit Skokie. (847) 6?3-57t1. March 21, lI am.- Paradise, Part 1." March27, 2 p.m.: "Mil- Oakton St. All tevels of photographers www.jittetbugchicago.com. March 21: 5 p.m.: Free wine tasting. dred Pierce' starring Joan Crawford, welcome. Call (847) 677-8324, I, Chevy Chase Country Club March28, 2 p.m "The Shawshank Re- i a a dinner/dance. Advance tIckets re- demption," rated R, March 31, 11:30 am.: I s FAIRS & FESTIVALS OP" kA' L r ¡.1.. quired: call the holline. Dance lessons "Hawaiian Paradise, Part 2." & CLASSES . a available include Jitterbug Il and Night Polish Easter Cultural Day, 10 a.m.-2 I S I t . s Club ?Slep call (630) 231-7644. p.m. March 28 in the Polish Roman LECTURES Kristine's Dance Party, 7:30-Il p.r. CathOlic Union of America Social Hall, AS k I Thursdays at the Park Ridge VFW, 10 W. 984 N. MIlwaukee Ave,, Chicago. The Chicago PublIc Library, Boden Branch, Brâdway1eausFndation"s Triple iliqqins Road, Park Ridge. Open lo sin- event Includes folk art projects and 6083 N. Northwest Highway, Chicago, Threat Extreme, acting/vocal perform- qeS and couples. Nightclub, swing, (it- Polish cuisine. $20; $15 for children (312) 744-1478. AprIl 15, 7 p.m.: "Images ance/ttìeatre dance workshops for terbiig, salsa, hustle, cha cha, fox trot agesl-15. (713) 782-2600 or of Honest Abe," presented by art histo- ages B-adult, 9:30 a.m.5:15 p.m. March I and and other music provided by aDJ. www.prcua.org, nao Jeff Mishur, The slide lecture ex- 29 at GusGiordano Dance School, 614 L. $5 cover; cash bar. (773) 482-0642 or Irish Earth Day restival, 10 a.m.-4 p.m. amines paintings, photographs, sculp Davis St.; Evanston. Three classesfor I, www kristinesdanceparty.com. April 18 at the Irish American Heritage tures and material culture relating to $225or $95 perclass. To reglstef,è- -k teikarringen "Helmhug" dancers wel- Center, 4626 N. Knox, Chicago. Vendors Lincoln and their historical context, mail come those age 16 and older Interest- wilt display Earth-friendly products, Annette®mybmadwaydreams.com; for cd n Scandinavian folk dance to join conservation, recycling, sustainable ORGANIZATIONS irstormation, call (84?) 9101946, , them troni 8-9:30 p.m. Wednesdays at agriculture and alternative energy. ' MISCELLANEOUS the First United Methodist Church of There will also be children's activities, Des Plaines Art Guild meets at 7 p.m. Des Plaines, 666 Gracelnd Ave. No pri- ive music and food for purchase. Free on the second Tuesday of the month Irish American Heritage Center, 4626 or dance experience or partner noces- admission. For Information, call (773) at the Prairie Lakes Community Center, N. Knox Ave., Chicago. (773) 282-7035. sary. Call (847) 823-7596 or(847) 692- 282-7035 or visit www.irish- 515 Thacker St. Des Plaines. New mem- www.lrishamhc.com. April25 9 a.m.-4 . 6616. american.org. bers are welcome, For information, call p.m.: In celebration of National Library Prairie lakes SenlorCenter, 515E. Margaret Newman, (847) 924-8952, or Week, the Irish American Heritage Cen- s Thacker, Des Plaines. For information, FILM visit www.dpag.org. April14: Wayne ter Library wilt host the International call (847) 825-2901 or (847) 8256637. Atkinson wilt present a watercolor Women's Writing Guild for a day-tong March20. 8-10:30 p.m.: Alice lowy will Modem language Film Festival, demonstration, women1s writing workshop, "A Writing host ballroom dancing to live music. March 3Aprii 2. with free screenings Park Ridge Art League meets at 7:30 Life/A Creative Life: The Importance of $25 per couple at the door. March 28. at both Oakton Community College p.m. the third Friday of the month in Words7 taught by Susan M. Tiberghien. 8-10:30 p.m.: Alice Lowy will host ball- campuses,1600 E. Golf Road, Des the South Park Fieldhouse, 833 Talcott Fee is $80 for International Women1s I l'i ' I' II' Plaines, and 7701 N. Lincoln Ave., Skok- Road, Park Ridge. Guest fee Is $3. Call Writing Guild members; S95 for non- room dancing to taped music. $15 per t s s couple at the door. io. Eleven international films will be Dorothy OuSotd, (847) 825-3505. members. A $25 nonrefundabte de-r L Square Spares Fi Pairs Square Dance presented with English subtitles. Selec- Skokie Art Guild meets at the Skokie posit is required. To register, call (773) 4 Club, a club for couples and singles, tiens include The Counterfeiters" Public Library, 5215 Oakton St. Visitors I,' dances the second and fourth Mon- (German, 2007); "Marathon" (Korean, welcome. For information, e-mail Ina- ga, PAGE 015 days of the month all year tong at the 2005); "Fearless" (Chinese, 2006); 'The [email protected]. March 24, 7 p.m Park Ridge Senior Center, 100 S. West- Yacoubian Building" (Arabic, 2006); Jessica Fine, pastel from a photo. orn Ave., Park Ridge. Rounds start at "Beaufort" (Hebrew. 2007); '100 Steps" Skokie Festival of Cultures organizing 7:30 p.m. with squares from 810 p.m. (Italian, 2000); Always: Sunset on committee meets at 7 p.m. the second For information, call (773)775947 or Third Street" (Japanese, 2005); "Ha- Monday or the month at the Oakton (708) 442-8646. March 23: "Spring nia" (Polish, 2001); "The Wedding" Community Center, 4701 Cakton St.,

MONDAY, MARCH 23 thru SUNDAY, MARCH 29 ïAN TUCI4ER

B', L PRIME TOP SIRLOIN STEAK

0 and Tlcketí oate N BROILED LOBSTER TAIL 57th Sireet and take Shore Drwe, Chca9o, ft -,"- Worldpremlre ',, WWwnkbca9oorg'CgnvernentIndoor Parking TI-(ST. JAMES INFIRMARY. By Sran 1bcI I ' Ok.ctad by HwryLvnnL z: ,' MARCH 20-APRIL 1 2, 2009 ) Pvi : ! -, Welcome o the St Jomes Infirmary a nightclub rk ¿npAbItod oam&rs prize fighters and femmo talaba. The mustela hot; tdnC4d,:pr1 (t' &RRY-,Q'UT$PEC1ALS ..,.:..t.., stako aro tiigti, And when a mysterious srannot comaalsnJat,l botBOrq 911...... Sarrin: Tony-nominalednctCMthOflY Chtsholrnand0BEPAfifì0 . ,, . . actor Edwin t.o Gbuon, and featurmO Cno Square.Theatreqnetflbiu. i 8OO745.3QQø rni'nìbe, Tanon Pitloiì .....', For TckotE visit wchoatound corn or caD 312.733.60b0.... .' . I-, . . w Th bit pc hdl4GJ k .. ...,.: n5 mq*, a oMpi h wwtìcketmaster.do Group SaIes n,oups(ó)cOnnOsqUnittleafc'iqr cad 77.2ß,1 1O8 .' Carry-out Only - 4pm till close I ( n flsU) c*nd L4 K ch& Pgyit wm*tc DOWNSTMRS . 1 : , - . Grniinc.-.-..,-. r r r:U ' 0 ìfI t77e _, d77s -r i i . i7tÁp All pçrqrrnriçeatcÑchicago Center løfOFrIçîTnAs 717 N. GTeaSta1 Fa1tUtJ flt CcuiuM'eiiuO) Tlìuhtcr Pirkkiçi . F& 1740 Milwaukee Avenue (at hake Ave) Glenview(847)699999' i 75 North State St wwwthequoetrnantaies corn Il b'* * t Ä'Piöz' Pts ?ubliaI0 '.Thursdy,Mareh .19, 2009 j 15 I4I' Thüñday, March i9; 2009 I OIYERSIOS I 1ionur JrspblieJitk)tI i MR5tWIS I .

9888, press 3, March30, 7-8:30 p.m.: www.oaklon.edu/emerilus. Sirens: The 11:30 am. Mondays, starting March 23. selections by Rossini, Bizet and Mozart. ET CETERA FAM(LY FRIENDLY Ravinia: Where Music Spends the Sum- Great Temptresses ol Opera (MUS C04 Course tee is $77. Mysterious Travel VI Four-week course meets from 1011:30 go. nier (MUS FOI-01) examines the history it) features video and audio excerpts. (HUM 829-71) explores the popularity nl am. Wednesdays. startIng Aprili. Hollywood Celebrities G Memorabilia Continued from PAGE 813 and lore of the North Shore music as well as biographical details about the mystery novel and the use ol lic- Course fee is $70. Our Town by Thorn- Show, 10 am-S p.m. Marth 21 and 10 park. Class meets at Evanston Town- tion to better understand other cul- Singer tells Lincoln's history through songs from his time the cómposers. Eiqht-week course ton Wilder (HUM 652-71) discusses the an-4 p.m. March22 at the Chicago ship Hiqh School. Course tee is $20. meets l-2:30 p.m. Fridays, starting lures. Eight-week course meets 11am.- themes in this classic play and how Oliare Marriott Hotel, 8535 W. Hiqins 28Z1035 ext. 19. Oakton CoinmunityCollege Emeritus March 20. Fee is S1CO. The New Yorker 12:30 p.m. Fridays, starting March 2?. 8y MYRNA PEILICIII that Lincoln knew ¿o tall Dog of storybook faineat they still relate in this age of instant Road, Chicago. General admission $15 Oalcton Community College otters A1 Program offers courses at its Skokie (HUM E9372) (acuses on selections Course fee is $100. The Violin Goes to Contributor Meet Clifford, i p.m. Sat- communication. Four-week course daily: free for children under 14 accora- his life story. "These old Oance br Lifelong Learning classes. campus, 7101 H. Uncoin Ave. Skokie. (rom the magazine, which was estab- the Opera (MUS 863-71) examines the panied by an adult. www.hollywoodcol songs are wonderful win- urday, March 21, at For information or regIstration, visit For inlormation about the Emeritus lished in 1925. A subscription is re use of virtuoso violin arrangements in meets from 2:30-4 p.m. Wednesdays, Iec(orshow.com. As a former archaeolo- dows into the pasts" he ex- Baines & Noble Book- www.oakton.edUIaII or call (847) 982- Program, call (847) 635-1414 or visit quired. Six-week course meets9:30- popular operas. Hear performances of starting April 1. Course lee is S60. gist, Chris Vallillo is fasci- plained. "They're written sellers, 55 Old Orchard natid by the past. He is in the words of people that Center, Skokie. They can also an award-winning folk experienced the events even get their photo singer who combines his and they give you insight taken with Clifford, the two passions in 'abraham into history that no boòk star of Norman Bridwell' Go in GrSce' Lincoln in Song" 2-3:30 can ever give you' bookseries, which has Suite Otis p.m. Sunday, March 22, at The show is particu- enchanted kids since Morton Grove Public Li- larly timely because 1963. Reve'ations bnir 6140 Lincoln Ave. "clearly J3arack Obama is For details, call (847) 'Ii "I've been involved col- a man who is iooking to 676-2230. I Anniversary lecting and performing Lincoln as a guide and in- roots music in illinois - spiration." A day to play Highlights the music that people For details, call (847) Start spring in a fun (includes RevtÓns came with and lived by be- 965-4220. way with Come Out and I E J fore television and radio," Play! A Fatnily Plúy Day, i JUDITh JAMISON Masazumi Chaya Vallillo said. also per- Spring for tea p.m. SaturdaMarch 21, ASSOCIATE ARTISTIC DIRECTOR formed at many of the Lin- RTISTIC DIRECTOR Treat yourlittle girl Filk du.i Ckfs ViNillo wINve a conced, "Abraham Lincoln in Song," March 22 In Morton Grove. at Emily Oa1thNathre coin sites over the years. and her favorite doll to a Center, 4650 Brummel St., The more I leanied about "Spring Tea Party" i p.m. couple for residents, $30 come with secret codes ners and older. Registra- Skokie: Your family will Lincoln, the more fascinat- Saturday, March 21, at for nonresidents, $15 per will be the center of aLten- tion is required. enjoy nature-based aetivi- ing I found him. He was a Skokie Heritage Museum extra participant. Reser- tion at Webkinz Party, 1-2 For details, call (847) ties, of interest to all ages, man ofgreat depth and and Log Cabin, 8031 Plo- vations are requìred. p.m. and 3-4 p.m. Tuesday, 825-3123. using found objects. Cost led a most remarkable life. rai Ave. You'll enjoy re- For details, call (847) March 24, at I'ark Ridge is $10 per family for resi- Dog day In many ways, his life par- freshments, work on craft 674-1500, ext. 3000. Public Library, 20 S. dents, $12.50 for nonrcsi- alleled the development of projects and make a pie- Prospect AVe. The event Your young kids will dents. Secret celebration our country." ture frame for a souvenir will include games, fun get a kick out of being For details, call (847) Vallillo uses the music photo. Cost is $20 PCI. Those plush pets that and PIiZCS for kindcrgart- greeted by the Big Red 674-1500, ext. 2500. THEY SHARE II-JE SAME ROOTS MAKE YOUR EASTER RESERVATIONS I EVERY FRIDAY ALL YOU CAN EAT FISH FRY IS BACK! IHT NLY DAILY BANQUET ROOM & AUTHENTIC GERMAN CATERING MENU Live performance by AVAILABLE FOR ALL YOUR BUSINESS AND FAMILY EVENTS FRESH ' Great Food, Great Service, Great People.., ;ç Sweet Honey In The Rock! 4New-Productian I ** Chicago Premiere FISH Cb e Uii e i (1'r,,,,ITl \iurrkin FRIDAYS, SATURDAYS & SUNDAYS SPECIALS Live Entertainment AurnRruM THEATRE 7650 W. Ir'ìng Park Rd. . of ROOSEVELT UNI?ERSITY OPEN 7 DAYS A WEEK Norridge ror Lunch, Dinner, OPEN FOR LUNCH . And Loto Night Funi SOUP SALADS SANDWICHES 7O8-4526O4O auditoriumtheatre.org CHASE tiow THROUGH : i. r. APRIL 19t WORLD PREMIERE ARTS(2

50 CKòtmästeC YEARS CULTURAl. AM BASSA DO R To III! WORLD

T H E A T R E Goodmanlheatre.org * Private Party Room * Private Bar* CustomIzed r- , GOODMAN312.44338OO rAorre rAIMERtIOUSE J.PMorgan ILIbl JI

I OFFICIAI. Hallt PARThER Sp.caI groUp 'avings ! 44 or 10 or inors!C r i8 NATiONAL ARroptEARrnNGsPolt5O s.t = sal 5 5 ; s t: s :- r

'l'hvrndOyrim400Cft 15, lORS 646 'Clrutrvrlvy, Muunvh fil, tItOlI A t'irrrtvnv t'ocre l'irl,tir'ul, A frole)!tccgt Pvohliccf(otn )SC) tv'un'antpioororlovcLeoer I Bu I IQIVERS1ONS DELAYED REACTION Destaons Ins & Resors Super Crossword Funeral Directors 00 Local eCt A CH O S S 51 Connevlwol07 tillInor 01 7 PIOlO und 43 aornbios I Writer town bord Suole 45 flolitsnrua & GreO and Associated 54 Sonnten 98 000ttvh t" 6,noky 05 500mln' leath Notices 7AAA 05 Live old gernbvlcr tincO 470Ier Ihn Ryn f-2-3-f l'o TirolPosy! ';1EûLY 1N hundoot brnethO 100 5e, top? ('02 htIl 48 NASA lap 86 HotI-beked? Services Ir Ropinrer 55 Mtghty reite loi Dr. Svhclt't O Prlrr0000 40 Eqothe 60 Moos ii,,,otr lluvIa 58 SoasaSe concern bru,ter sqoarid Death Nòtices' - .,fl Iu 710. l,uooq pr, I tos,,, loo 14 Checker negrnertt 902 SOuroo 00 Onhodorr. 62 Sktrr thoo 90 t-fnavenfy ooIIoiIro,000,,le Ott st. loll i-Coli. lulls' cru. sight ur050r. SieWOntt 59 Long IsterIA 153 Cord,val S3 COrredS Shirley erosh, 05e 02, nr Domec OoaOh, FL 10,00. I-tOy o Ib, 0,0 Vo 101,0 IO Corry fon lt With 44 You Of ay send a death notice to retort lOS 'lynn 01 Aiphebet ornent nr Pork 6150e, cassod owoyMeroh You may send fIdiee. Ill C.sorair, i, 02101 Aviv Sotie Avrete, attraction cc. 205E. Ssonfod wifu Of Ihnfare Edwardl dctothueticcs@piemierf ocal .c000i 205 Winter reacher 107 RIO. tra'n'ng tried 5e goiter's 82 Ns°iwyorrr 000-2 55:7745 ovinI mnorherofEdward(Chrisfinni, or calf (847) 486-7479 a death notice to heererd 0400f of the oIr, veggro Telloh let 90 Try far obiS Clillord aed LowrOnoo,'oheniofred nroe.Ooridafefsure.com 21 Crerore - wey 115 AfrIcan 12 °SilOa 59 Actress el Proosked erendmOlhsrcfDenny,Ci., Orlaren, cleat heooti cro 66000k capitol Marrtnr Stevens 98 SIbliest Conner octGroVenn. VIsitationFrIday, 22 konto - 670es way to 013 End of euothor 60 5oct05 cIty March eu, t-0 n.m. of NeitOe Ponerot Home, RYAN-PARKE 18f pionsrerlecsal.com A115{- II[R[I (°Rootc Orb romerA *5 Endora problem 99 PlonIst 005 TalOOltwo. far Combortardf, Park nharaolor( 68 Trerqotll 116 Joeenran 14 Weg clot 81 Destiny Wono nidoe. Ponenet enrobe Salurdav 10 am. or Foneral Heme Timeshare Resoles 23 Starte! e TOPada of Chick 15

2111Ie IOia1B0 El&trical Services TO PLACE AN AD -225- Handyman FOREROS, CALL PIONEER PRESS Hotina'2 MOI05N le'- l-888-228-9060 TO LISTEN MIO kight Hauling RESPOND CALL -352- I-900-226-1096 QUER Cdl, 000SIIyfnon P1,0, 5, Ito. Fencing 'OORUSPOND USING mr. anwno9 %ruysnur iYOURCRUDn'COJRD, CALL Computers. A-1 FENCE INC. THE WORLD Eleclmenc Services ill-888-491-5625 moo 0000m,,oa -220- Ynon'° tnr2t.n722 Concrete, Brick Work F tx-A. FE NC E - 31V- SWOMEN3EEKING MESI AtES SEEKING WOMEN 1 272 047 .720-3673 START WITH YOUR HOMETOWN. Sto- Mopkcn. WantrnJ Floors D474Q9-4E6n Monster and Pioneer Press have joined forces so you -337- 773-350-5200 can discover a job chat will let yoa rise to the top in the Movers suburban Chicago area. Your calling is calling. O,,.njnt,'nt Servir.,, Buying or -356- Selling, MONSTER AND PIONEER PRESS NOW WORK TOGETHER. A FIaoBy Torn Homo Pioneer 041.376-0212 847-25(1- 6000 Improvement Classified 200n PIONEER PRESS monsler isjhe place IIie OIoN5O Classified for youl tcnnrntc Work PIONEER PRESS MOOn SOIIFONE YOU CLICK WITH AT Avenue pion on ria ca I. ca rn/rn on sto r (847) (..nmn.wa....n.nnwnonnronaornorno.nnn.o7nn.nno.m.onn.nrnro:nnnnomnnu:onno'\L ng02202y3ti1° 998-3400 I

i A Pioneer PressPublication (Dc) Thursday, March 19, 2009 21 Mah * 2O9 wiöttter1oca1,crn A Pioné&'Pé ?Ublitioti '(f)c) wwwpioneerlocal,com '

535- Houses 570-Slot-es & Offices 432- Business 440. Help Wanted 440- Help Wanted 505- Apartments, 505-Apartments, 505- Apartments, 506- Apartflt!, 626- Cemetery Iots Tuckpointing CondominIums- CondomInIums Painfing, Opportunities, Concicominiums Condominiums- N0RRIDOE ,autituI Houe. DrIver - COL-A Suburban Suburban Chicago GLENVIEW Stone/Office Papering -380- Franchises Secretary Suburban ThR, 3RA. C/AC, lFg yrd tin 1,400 eq. ft on Woukoggri Rd. Ridgowood Cemeteray DEDICATED Teams Evanston Township Isimt, 2 cr ori.. (718)25-1445 Across from Vbllago Hall, s Plato In sed. 8, eaCh pfet $200 Foreclosure Sales - 358- 5CIIILLER PARK )BR Apt, EDISON PARK Rufh (847) 124-5533 less then cemetery prIce, call Needodil CHICAGO-8711 Went Bryn SKOKIE.4,), ENFIELO 719429-23O0 - BIL ConstructIon Inc Pursuant to the Business On- H.S., District 202 Mawr, iuxury 2130 2BA w/appl, heat, gas, wafer -f 1641 W.tbsan. tot tIr. $838. SKOKIE 9629 N Karlav 3R Tuckpointtnq Masonry Run trono Chicago - MD/MA 1BR'sfnom$gß5AvaiI New& Spec,, 1 BR, HWF, by tranep portunity Sales Law of 1995, Included. $6310/mo plus sec May ist. Well-landscaped i SeA, LR, FR, fin bnsmnt, - 1-841- 299-DO5 1447- 222-0589 (713)501-6000 Average 5000 mIles/week Exciting opp'ty at Evanston condo, heated in-uni! indry, re#. Llncolnwood-Skokie-N lles Réai Estaté" Al FRITZ 8. SON PAINTING every buSIness opportunItyRun Tuesday thru SaturdayTwp NS for a 12-mo Secretary gorage, $1550. 773.704-4104. dep. 847-455-1177 Properly. Hoot 8, Waler in- CAC HT, close te Schools 114-51,000 SF Top Notch Int/ExtFroe Est. Wallpaper must be registered with the in Otc of Asst Superintendent cluded, CIesa ho traniporfa. $1450 + utile, Avail Now, Ottico SuItes 639-Real Estate COAST TO COAST CO. IllInoIsSecuritIesDepart- for Instruction & Curriculum.CHICAGO -uptown aroa.Lr SKOKIE 8551 KiMBALL tien, parks, and Shopping, Heut. For rent or Sate, Imperial 773-736-4100 ment. Protect yourSelf and Call Nick 708/738.333) mrying/Kimil, ht & range 541-275.8176 er 847-487-4322 Aucons 1447479-1534 CALL MARC TuckpointingBrickwork ERfrI 2BR. Hdwd firs, Hf mcl. Av TopblrofVlnt, 3fiat, residen- Chimneys Glass Block Windget the facts before yea hand mdiv musi have al least Sirs Now. Studie & I BR Also hoi area, 2ER iBA, nowl gas md. Lndry tacll, STARVING PAINTER Ali Types of Masonry Work oven your hard earned money exp as an Eeoc Secretory er decorated, $1100/mo, ht Inc SKOKIE: 4937 CHURCH $797/mo. Mr LuIs 708-366-5602 Northbrook -Luxurious Sulle 20 Yrs ExD lnt/E'I P&nllng by contacting the Illinois Sec- XPRESSI Avail 3(1 047-361-3456 o, 50 otllces end 3G work sta- 695- JudIcial Sales 895- JudIcial Sales 695- JudIcial Sales 695- JudIcial Sales Spcclallzlnçj In: Painting Kit Free EstfLic/ins 847-438-9163 Admin AssI In Education on 847-486-9)56 Agent Owned. Lru. lBdrm, Centralc, 545- Industrial/ HOME AUCT ON rotary elState's SecurItiesCall Ednatodayl 866-563-4112public org onvlronment.Qual: heat md, prkg. avaIl. Next to fions has space avaIl, great Cabinets & Old Wood Trim, Deportment at ($00) 628-7937 DESPLAINES1BR lstftn, LowreflCe/CUmria tbr networkIng opportunIty ldeit- B.Commonly known as 8915 N. Free Estimate Easter Saiflt Tuckpolnting Strong interpersonal & organ-SUPER LOC nr tm, grocery Skeh,ini, 2, 380, Studio. 5240 W park, close to Old Orchord, conde with garage, Includes Commercial tHy proerams also avaIl, colt375Illinios Homestile number PAOSO9IO8. THEon January 5, 2009, gallen Re-BEHNAM. EDWARD Caulking & Brickwork Izational 8, communication Goijix Eton, sIr5, pkg, ne ht. MustCall Barbara B47-673-i3iler With 330 In the Chicago orna JUDICIAL SALES CORPO-ally ServIces, Inc., ae SellingKAI(A, UNKNOWN OWN-CENTRAL AVENUE, Morton Hoalthcore skills beth oral & written. 13e 8, shops, $630/mo. 047-340-4464 hoot, HIN tirs, 5 closetS. Shutly at 547497-510 Grove, IL 60053 Property In- Free Est. 708452-1783 liegI crdt. ne pet 847-679-3224 Hoiimork&Jehflsenl73.545.61 60 Avail April 1. (155)453.7801 Selling Fr1, Sat, 6 Sun RATION One South WackerOfficIal will at 12:30 p.m. enERS, GENERALLY, AND l# AMERICAN PAINTING Evergreen Heallhcare Coolerproficient in using Microsoft Mar.27,20&29at1 pmdatlyDrive, 24th Floor, Chicago, ILAørll1,2009,at 205 W.NON-RECORD CLAIM-dex No. 10-16-311-049 The real Father & Søfl Team (I1 !Qitø Io a premier leader in long- Oic Ste be precise, officient DES PLAINES Dawntown OftIceWçirehouse/Qarage The Westin Lombond 60606-4650 (312) 236-SALE Randolph Street, SuIte 1020,ANTS, Defendants, esfole Is Impreved wIth a sin- Skokici, 2, 300, SludIo. 52.40 W SKOKIE 4930 old Orchard 841-401-840 torno/subacuto Rehab tacilily& self-dIrected in tuttilling ali 2BR $1025. Eloy bldg C/A & LOYOLA AREA Spoce. GlenvieW Area, O'Hare Aree: Rosenoont Yorktown Center 1165991 Chicago, Illinois, sell at pub- NCH 8741 gtefamIlyresIdence, The ElnpIoynuJll I In the SW Suburbs et Chicago. resoonsibiiifins. Assist in hi. Avail mm. Gar ph avl. Gslitz. Elm, strg, pi,g, no hI. MusiRd, Jumbo super dstux 2 fiat, 1300 2000, 2600 & 4000 SqFt. NOTICE OF SAI.fi Iudgrnenb amount Was liv gd colt, ne pot 847.679-32242nd tIr, largo 3 OR, 2 DA unIt, .1 BR & .5TUDIOS Des PIalnesMf Prospect Check out these hornee: Published In Pioneer Prese lic auction tn the hIghest bld- ALL PAINTING tNT/EXT PLONEERrRESS UNIT MANAGER . RN monitoring program budoets. GRE 847-297-1500 w/iokO view. t4ont o Kaiz Mgioot 147411-1707 schlll.r Pork - Airport 24062 N OverbID Dr, 3119, 3/26, 4,zgV (1677502) C der ter cash, as set forth be-PUBLIC NOTICE IS HERE-$385,450.51. Sale termO: 25% - Tue - Carpentry volle focAL 0000CC Oversee daIly tunctlons of lho Maintain contidentioiity In across from Old Orchard Prvt 8, Corporate Suites oY GIVEN that pursuant teadown of floe hIghest bld by Drywall ShoppIng Center, wm frisk, 8, up - inclds beat W er. Lake Zurich few the followIng described 841-680-0302 or 224-392.8233 nursing unit to ensure the matters relating to students, SKOKIE tOR Laundry an prom. No pets. . 200-30 000+SF Available 313R, 2DA, 1300SF Homo Judgment of Foreclosure andcertltied funda at the Close of Edison Park Area c/a, Indoor prkg, $1600/mo, SKOKIIZI000-600sqfb, Lt NCOLN WOOD real property: the auction; the balance, in The Delngo and highest degree at quality faculty, parents 8, staff, tell OimstecVOverltill 8560 NUes Center Rd. Celi Pelero 713.386.7)10 commercial space in a now Katt tAmt 141411-1717 AgonI: Marc BUiandr Commonly known as1235Sale entered In the above entI- PROFESSIONAL PAiNTING Pioneer Press Newspapers curo. Long term ihr ibaih no pets cocar metro $1165/me. Newly remod. bd. 773-71V-2588 Itose Mgml. 047-410-0077 www,Oh,ars0tflc.R.r,faI,com Socle Hemos FN THE CIRCUIT COUR'! North Kildere Avenue,lIed cause en January 16, 2009certifIed funds, IS due within cars/subacute exp. Prot'd. Wo Interested candidates must heal, cooking gas, conde buildIng. (847)411-1261 0F COOK COUNTY, JudIcIalSaiestwenfy-tour t24) hours, The & Docorotlnçj. Handy Work, 8, shoppIng $870 mo - 866-736-3670 ILLINOIS Llncoinwood, IL 60112 Per-Infencounty Free Estins. 847809-6810 often a competitive salary, apply at : www.eths,k12.ii.usMcLennan 847-825-001 1 AP prkg. No Pets. SKOKIE-8042 N. Knox-lA 403 Croekslde Dr Potatine manent Index No, : 10-27-.426-CorporatIon will on FrIdaysublecl property Is sublect to 401K, foulon reimb'grsemoni, Seo Phiobos et Apto. ob: Deluxe 2 BR apt. w/AC. cab NARRAGANSETT! 2BR, 2BA, 1028F Homo COUNTY DEPARTMENT-045 The mortgaged real es-April 1 7, 2009 at the hour et i fgeneral real estate taxes, epe- rt'4. newer IRVING PARK. 560- Rooms CHANCERY DIVISION dal assessments, or speclat ¿t'1'. torn $2,500 WEEKLY proc-medicai/ctentai/vislen. PleaseStat 1st icion www.nickbuyschlcago.com kit, appic,prkinn, Agent: Joseph Mueller talo Is Improved wIth a dwell-am. intheir oftice at 120 niaii/fax resumo to: EVANSTON: ApI People, no841-6748150 KALE REALTYbund taclilty, near lrensp, MR, 2nd FIr, Appts Lodry, RealEstatefor Sale TANIS Group LLC Us BANK NATIONAL ASSO-Ing. The property wIll NOT beWest Madison Street, Suitetaxes levIed ogalnst sold neat ZIGGY PAINTING essing ond mailing our tiyers,Evergreen Heaithcare Medpocus, LLC, a Division of appt needed, walk in, we HdW6 FIrs SP5OMo+0C Dep. CIATION, AS TRUSTEE estate and Is offered for sale brochures. PAID DAiLY. inVentiv Health seeks parks, and shopping, Avoil EVANSTON Room for reritl 84 1-59.4-42 t 5 open ton InspectIon. The Iudg-lisA ChIcago, IlIlneis, sell at int/E,t Decorativo Pointiiig 18124 5. Kedolo Ave. drive, 8, it's FREE I 5/01/29 $1015 coil ill md. AvI Newt 173-7714323 FOR CMLII 2007-ARS Plain- public auction to the highestwithout any representation as lOOs Great Opportuniiyi Postage, SAS Programmers 619 Grove, 847-7330t00. SKOKIE 2.Sbr, walk-in ci000t, Jerry KIt + lndry fach. Carpet, 552 Arbor Gate Lane, tuft,-V.. JOHNNY LE NK/Ament amount was $363,114.41. Quolity Work 8, supplies turnished. Process-Evergreenì'aric, IL 60885 for assignments lhroueto the irin kit, newly remodeled, DR,Etlinger 312-608-1234 Buttato Grove Salo terms: 10% of successfulbIdder ter cash, as sel torthto qualIty ei quantify of title Aftordoble Price 708-907.7003 www.apartmontpeopie.com. e t t i n g e r @ ho o I i m a r k - NORRIDGE4rm5, 1BR, kit oc + utllslncl, $549/mo. JOHNNY HOANG LE, et al below, the following descrl-and withoutrecourse to ors nCeded HOWl FREE in- U.S. Mosler's -f2 yrs. exp 1W fis. W/D tnkup. StilS bd Mr. Luis 708-366-5602 3BR, 20f,, 1644SF Homo Defendant bld Immediately ah conclu- Service you can rely on fonmotionl ColiHowl EOE/Drug Free Workplace req'd. Send resume to: heat/gos/water, (847)329-9330 ahnsen.cem disipo area, LR. Ht netindo1. Agent: Rozanne Kurman sian et auction, balance bybed mortgaged real Ostale;Plalntlft and In 'AS IS' condl- Free Estimates bou ievardhealt hcaro.cono FOREST PARK Deluxe. 8-41-577-9669 e. CH 34515 noon the next busIness day,P.l.N. 10-34-226-037 and 030.flon. The sale Is further sub- 410- Seeking i 800-395-5972 Attn: Leticia Gualardo pit prkg. 708-457-8141 NOTICEOF SALE 10cl to confIrmation by the 16225 Ten Place, Suite 200 1BR, nowwlndowx, kitchn SKOKIE, 2BR, 1BA,lst fIr. SKOK1EB2O1 N. Krise 712 HIllsIde Ci, AlgonquIn both by cashIer'schedks; andCommonly known es 6800 N. 773-317-51 i cabinets, tue, crIsta, Indry 28ff, Avatl now. $800 + utllo 565- Storage Space 3BR, 3BA, 1736SF Home PUBLIC NOTICE IS HERE-no refunds. The saie shalt beKeeber Ave, LlncoinwOod ILcourt. if the sato is set anide Employment- Hoalihcare Houston Tx 7108-1, indI. W/D, AC, rear prkg, Nr NORW000 PARK Harlem' BY GIVEN that pursuant too for any reason, the Punchasen Looking for moms 8, others.Evor9reen 1-tealilicare Conter facll, AC, md tt & tos. Swift. Col OK. 847-982-9208 410-747-1613-H 443-928-1574-c Agent: Laura Grasemonn subiect te general real esfole612712. The mortgaged real es- Discover ChIld Care $739/mo Mr Luis 708-366-5602 NW HWY STOOd 1 and 2br, OR, FRANKLIN PARK - Wrhse Prudential First Realty Judgment et Foreclosure andtaxes, special taxes, specIaltate Is Improved with o singleat the sale shall be entitled The Differencet Learn to Earn 2-5K per mo a leader In long- oak tirs heat, AC, pkng, pets Sale entered inthe above tamily resIdence. Sale forms:only to a return of the deposit torno/subacuto Rehab facIli- 445- Help Wanted - SKOKIE 8250-60 NILES CON- 3000 sq ti, apexy tin, eec, 847-414-5050 assessments,specialtaxes Any person regularly provld- FT/PT.Bet%y 847-251-8915 FOSTER 8, CUMBERLANO SKOKIE IBR 4- htdenclsd ok, 5850 and $965. 847-338-8983 3241 MIlwaukee Ave #lC, causo on January 20, 2009, anlevied, and superior lleno.If10% down by certltled funds,paId. The Purchaser shall ties In the SW Suburbs of Chi- percho, near swift, oat in kitch-TER RD. Lovely 1ER trom ovrhd dr,$i500mo 847-678-9543 600s agent of The Judicial Soles havenoturtherrecourse ing chlici care.for more than cago, socking experienced: Part lime Spac lbr, Pets okay, Oak tirs, $820. Avaii41 &5/0i. Loreer, Nsrthbrook any. The property Is offeredbalance, by certified funds, three unrelated children un- heat, AC SlSS010. 847.330-8983 en wIth pornlry, formai DR 213R, 1.5BA, 12215F Home CorporatIon will at 10:30 AM-as ls, wIth no express or im-wIthin 24 hours. No refunds,against the Mortgagor, Ihe Plastering Truck Drivers Wonted-BestRN RESTORATIVE focal md. 847-677-5996 modern huchons 8- bollos, on AprIi 22, 2009, at the offIce TIne property will NOT beMortgagee or the Mortgagee's der age 12 Is subject to licens- NURSE NC,storage, laundry & pork- 525- Garages, Stores & Offices Agent: Patil Furman piled warrantIes and wIthout ing by the IllinoIs Depart-Pay and Home Timei Apply FRANKLIN PARK2BR, 570- Coidweil Banker of The JudIcIal Saies Corpo-any nepresontahlon as ta Ihnopen for Inspection. For intor-attorney. Upon payment in ,. With certiticotion. We otter a ing. Heat mcl. ration, One South Wacker 360 - tnent of of Children and Fam-Online Today aver 750 Corn- GENERAL OFFICE 6900,/mo, utli mcl. Studio Opt, SKOKtE 2 Large ERs, New Parking Spaces 605- ApartmentBldgs, 8.47-729-1261 qualIfy of litio or recourse tomotIon callMr. David C.fullof the amount bid, the ilyServices. The numberpaniesi Ono Application,competitive salary, 401K, Wilmetle Medical Office. kitch & bath, todwd fIrs $1100.Tony (708) 417-5897 OPEN NOUSE: DrIve - 24th Floor, CHICAGO,PlaintIff. Prospective bld-lçluevor at Plalntitf's Atfor-purchaser will receive a Cor- Hundreds e? Olferst tuilion Scheduling, Customer Srvc, $530/mo, uhu md. 847-455-7888 CHICAGO-515) N. Harlem IL, 60606, nell at public ouc- tlflcale ot Sale that wIll enIl- Drywall, Plaster, Water counted includos the family's reimbursement, April ist. Call 847-361-3456 OffIce. 600-1200 Sq.Ft. On-Site Flats (all sizes) Sat 8. Sun, Mor 21 622 dors aro admonIshed to ne-nei, Kluever & Platt, L.L.C., own children Under ago 12. Ifhttp:f/tiammorianelobs.com Misc. 12 - 15 Hours/Week. SKOKIE Large 2BR iSBA 1 ta3PM lIon io the hIghest bIdder, asvIew the daunt tile to verity65 East Wacker Place,Ile the purchaser le a deed to and Mold Repairs, Ins. medical/dental/vIsion. PleaseFax Resume To: 847-256-4437 Store Your Speclat Car ParkIng. Some ubiI. md. oet forth below, the following Chicago, IllinoIs 60601. 13t2)the real estale after contir- 00u9: 708-453-5921 you are unsure whothor any lax resume to: Glenviow SKOKIE mr iSba, updated Separute DR. $lO9Wmo., heat Bruce 773-49)-419) FREE BROCHURE: ali Information. For iortorma- person listed bere Is sublect Or Email: dr®welitoot.coni incld, parking. Avail Mor). 4,00,6, secure. Monili or Annual described real estabe: tian:Sale Clerk, Fisher and236-0077. motIon of the sale. The prop- 188-901-7003 LUXURY RESIDENCES windows. hdwd fInn. AvI now Alls Storage 773-605-1454 866-516-4078 Commonly known os 7050 N to licensing, please contact $1225/ma-f ht (847)826-6311 Call Greg 847-214-6)90 , lltlneisHouseAuctlon,com Shapiro, 4201 Lake Cook Rd., INTERCOUNTY JUDICIALerty wIll NOT be open for in- JAKE THE WALL DOCTOR 440- Help Wanted Evergreen Heaithcare EVANSTON- Adlacent Stores AdVertise KILPATRICK AVE,ist 110er, Nerthbrook, illinois SALES CORPORATION spectlon and plaIntiff makes your local DCFS office. 10124 S. Kedole Ave. Health Core ibslrms. 2 8, 3 bdrms, w/2 Hudson & Marshall LINCOLNW000,IL 60712 RepairsSkim Coating MEDICAl. ASST full baths and Indoor park- SKOKIE OFCIWHSE 609 Dempofar St, 763 StiFt. In coniundflon wIth 60062, (847) 498-9990, betweenSeillngOtficer, 1312) 444-1122no representoflon as to the DrywallPlaster Evergreen Park, IL 60855 SKOKIE 3BR, Clean and 535- Houses 611 DempsterSt. 911 SqFt. Property Index Ne, 10-34-107-1:00 p.m. and 3:00 p.m. week- 1)64201 conditIonoftheproperty. BOB/Drug Free Workplace Internai Medicine practice in Ing.Large baicony, eat-In Spacious. FREE HEAT I 1200-45005F UNITS Luke Loe Cou io 038.0000 The real entole is Im' Proopectivo bIdders ore od- Free Estimate 713-398-7430 BOOKKEEPER Highland Pk seeks Oxp'd Medkitchen, in.unilw/d. Lrgeuh- REACommerclai PJE aChIcago Ave. Rent sepa- RE#76.0134489; daysenly. 1151147 Pubilshied In PIoneer Press boulevardhealthcare.cem remod. kIt, 1g LR, p1-vt prkg, ratoty oras one. 2 parkIng 24/7 proved wIth a sIngle family PublIshed In Pioneer Press 3/12, 3/19, 3/26/09 (1675994) C monlshed le check the court te ixq Experienced for Long Term AssI w/good phioboboony, doorpool,tennis,club- Great Locatlont 1847)494-0483 841-676.0030 EVANSTON . 3BR/2BA AU#040000677 residencio. Theiudgmonf file to verIfy all information, Carecompany.Computer EKG & computersklils/ Fax house. Hi Speed internet. hesse. New finIshes. AvI W) spaces each store, and full Cell :v5,W)2, W)9/29 (1674084) C res to: 847-681-1384 or email fo bsmnL 141415-1616 amount was $435,205.34. Sale it thIs property Is a cande- knowledge necessary. MustHeaithcare On-site mgmt, 24 hr. emer- 51750. Lng Yrd 847461-3456 . (8471 998-3400 termo: 25% down of the hIgh Plumbing be experienced In QuickBooksFT PHYSICAL THERAPIST robingneenbergeratt.net gency maint. Dog or cat 0k.SKOKIE: 4602-22 Grove LINCOLN WOOD minium uniI, the purchaser at P1ONEERfR1SS Outstanding Building WHEELING I BR, Hlntz& 695- JudIcIal SaIes est bld by certifIed funds at IN THE CIRCUIT COURT the unit at the foreclosure YOUR LOCAL $000CCand Long Term Caro BillingLTC facility In Butte, MT. At- . Near Metro, I-94 8, I-294. 83, ist fIr. lux apt, $130/mo, Email the clone ot the auction; theLINCOLN WOOD sale, ether than a mortgagee for Medicare and Medicaid.tractive Sai. & ben Rachel Starting ah IBR 51215, Spacious5 Room-2 Bedroom. OF COOK COUNTY, (Licensed) KENNEL LIght, airy/remodeled, ceiling prkg, pool/i-ct. 847.340-4464 classltleds@ balance, in cerlitlod funds, Is IN THE CIRCUITCOURT ILLINOIS shall pay the assessments The Doings and M-F, 9.5 in Llncoinwood Cade, The Crest: 406-494. General cleaning for animai 2BR $2030, 3BR $2260 fans, garage avail. Heat In- pioneerlocal.cem due within twenty-four (24) OF COOK COUNTY, and the legal feos requIred by 361 - Pioneer Press Newspapers Fax resume to: 847-67457947035; [email protected]; hospitalInFranklin Park. Volley Lo Towers li [ii; HARW000 HEIGHTS COUNTY DEPARTMENT- ciuded. Joniforon Premises, WILMETTE 1119 Groonleaf hours. The subloct properly Is ILLINOIS CHANCERY DIVISION The CondomInium Property Fax resume 406-494-7065 Must be avail. on wknds. Call 1910 Chestnut Ave, Ost InG 1H THE CIRCUIT COURT COUNTY DEPARTMENT, woik lo Dovonshlre Park. East at Greenbay, walk to 375ILLN0ISr" s I OF COOK COUNTY, subiecs to general real estate CHASE HOME FINANCEAct, 765 ILCS 60S'9(g)(1) and JP.G. PLUMBING Janet or Sarena 847-455-4922 Cali (847) 998-1800 x280 Call Gabby 847-933-0721 on train, I BR $890/mo Includes FRI, SAT & SUN https:\'oordsrs. taxes, special assessments, CHANCERY DIVISION LLC F/K/A CHASE MAN-(g)(4). IF YOU ARE THE Mon-Fri9:35-5 Bank-Owned pioneeriocai.com ILLINOIS an special taxes leviedJPMORGAN CHASE BANK, ALL PLUMBING REPAIRSEXPERIENCED Care GIven Heailhcare PIcture en apart ments.com Huilrne,k&iohnienl73-S45-61 60 heat & parking.Call Joe COUNTY DEPARTMENT - HATTAN MORTGAGE COR-MORTGAGOR fHOMEOWN- BJGorsmaiJ Reasonable babysitter, Seeks tuti time or Construction MEDICAL ASSISTANT Cert, 847-328-3354AnnoI, inc. MARCH27,28&29'PM against saId real estate and IsNATIONAL ASSOCIATION,PORATION;Flalntift,vs.ER), YOU HAVE THE part time 773.494-1269 Fax CHANCERY DIVISION offered for sale wIthout anyPlaintIff V. JUNG S.IM; RIGHT TO REMAIN IN POS- Free Est- Lic #PL15497174332 ASSISTANT Manager, Contrat Scheduling Dermatology office, Skokis/ SKONtE -4615 DavIs iRR $990 - TheWe5tIn Lombard COUNTRYWIDE HOME MORRIS E. HIRSCH) Ml-528-0390 ENGINEER B Northbrook, 847-675-9711 HOMES (847) 486-7497 represenbotion as ta qualityCITIBANK (SOUTHBETTY J. HIRSCH;SESSION FOR 30 DAYS AP- Harwood Heights 3BR /1 BA& 2BR ton 51200. Avail Now 8, 506- Apartments, Yorktown Ctr LOANS SERVICING LPor quantity of title and with-DAKOTAI, N.A.; UN- TER ENTRY OF AN ORDER Skokio. Experienced In this full-time positional apt, newlydeconated, 2nd tIrMay loi. Madero courtyard -o.- PIOTR JPMORGAN CHASE BANK, 41 - Seeking candidate needed to Plaintiff, Out recourse te Plainllft andKNOWN OWNERS AND OF POSSESSION,IN AC- Lake Forest Hospital you Call 708-867-5080 building. Well-landscaped Condominiums- VieIl tine home I NOWICK1, et ai Defendant NON-RECORD CLAIM-N.A., AS SUCCESSOR BY Employment- maintain, operato 8, will manage all services RETAIL property. Central airS, heat. 498Clavey Ln, in 'AS IS conditIon. The sale MERGER TO BANK ONE,CORDANCE WITH SECTION Remodeling service facility, grounds, Chicago 300 elkem is the PIoNEER1PREss 08 CH 17202 Is further sublect te confIrma-ANTS, Oetendanis N.A.; UNKNOWN OWNERS15-1701(C) OFTHE ILLINOIS Elder Carel under Cenlral Creation House In GlenviewHARW000 HTS. flOR ist fir,Parking 8, laundry. Close to CHICAGO ai.. Yaus LOCAL SIDUCC5 NOTiCE OF SALE 08 CH 10261 equipment, 8, machInery. Scheduling ta includo arder seeksadesignassistant, schach & parks. Call Valentin Highland Park PUBLIC NOTICE IS HERE-tian by the court. Upon pay- AND NON RECORDMORTGAGE FORECLO- - Companion Requires 2 yrs exp with heat incid. w/prkng space. durine mont In lull of the amount bld, NOTICE OF CLAIMANTS; Detendonts, SURE LAW. Fon intormaf Ion, 364 - management, erden Flex. tirs. 847-724-5533, Ruth. No pets, $754'mo. 708/243-1140 CHICAGO 5348 BY GIVEN that pursuont toothe purchaser will receive a FORECLOSURE SALE paintIng, carpentry, processing and appointment CUMBERLAND and F05- OPEN Judgment of Foreclosure and 07 CH 3062 contact Plaintitt's attorney: plumbing, & mechanical 847-318-9272 or 847-650-4483 Certlticale of 3abo that wIll FIsher and Shapiro PUBLIC NOTICE Is herebyThe Sale Clerk, CODILIS & Home Guard- Flood and FIreA+ Caregiv.rs Come & Go or scheduling for TELEMARKETING SKOKIE-4901 CramLoveiyl i TER lbr condo, close to Blue Sale enteredinthe above a fIle 0 08.3/30 24/7 live-in. 8, good oroi/wnitlen ambulatory care HOUSE EI1 Lthtø enllfbethe purchaser to gIven that pursuant te a Judg-ASSOCIATES, P.C. , 15W030 Recovery ServIces: Dry and esl pnce, Ali communication skills. Call From home for Ansvets.LIBERTYVILLE LUXURY2ER trono $990. Avail Now or line, prkng, gar, swimming couse on January iS, 2009, andeed to the real estate after(lt is advised that Interested NORTH FRONTAGE ROAO, clean, damage analysis, Localione No Feen. Eng.Spkng departments. Collaborate Na ceiling. Calling far May 1st, Cboseto transporta- pool, $875. Mary 8-Il-650-2997 SAT & SUM agent of The Judicial SalesconfIrmation at Ihn sale. Theparties consult wIth theIr ownment of Foreclosure entered Bonded/Insur 708-692-2580 All apoilconts sublect to with hospital departments to Dowrifown Condo. Avouable CorporatIon will at 10:30 AM In the above entItled couse onSUITE 100, BURR RIDGE, structural engineering IDPH requirements donations. Cali 815-728-9226 NOW. 2bed/Obalh. Waik fotien. Heat, wolerand parking MARCH 216 22 properly will NOT be open forattorneys before biddIng at9/25/2008, lnterceunly JudicialIL 60527,(630) 794-9876 be- reports,and construction. continually improve order included. Storage room and CHICAGO Edison Pork 2BR, en Aprii 17, 2009, at the ottico and plainflttmortgage foreclosure sales.i including background 8, processing and scheduling. train. $1800 rent includes ca- i to 3 PM of The Judidial Safes Corpo-Inspection SalesCorporatIonwillontween the hours of 1 and 3 PM 847-323-3902 * COMFORT KEEPERS * reterence checks. bio, heat, waler, gas, gar-laundry. must seel IIb To see S.S nos, exC. loe. No smk. 615- Houses- Suburban makes no represenlafion as toPUBLIC NOTICE is herebyMonday, AprII 20, 2009, at theonly and ask for the sales de- Exp. Canegivers, CNAs call Tony /0t/4l75897 Leave message, 1734314123 rollan, One South Wackerthe conditIon of the property.gIven that pursuant te a Jude- partment. please refer to tile Fax resume 773-5084766, Bachelor's degree or equiv. Rentals baae,washer and dryer. 5 BR/4 BA, 4681 SF DrIvo-24th Floor, CHICAGO, hour of 11 am. In theIr offIce Live in, come 8, email Jobs@CJEnel. Heated indoor parking & stor- l_ou Prospective bIdders are ad-ment of Foreclosure enteredof 120 West Modison Street,number 14.08-11189. THE JU- Screened bonded insured experience rood. lei- years IL, 60606, seIl at public auc-monlshed to check the courton January 14, 2009, Kalten DICIAL SALES CORPORA- CJE SenlorLlfe at experience in centrai age. No pelo/No smokers 047- Local Agenti Marc Bulandr fIen to the highest bIdder, as Suite lisA, Chicago, Illinois, Roofing (non.protlt, eco, no/i/VAI) 844-1950 HUDSON & tile te verity all Information.Realty Services, Inc., as Seil-sell to the higiest bidder for'lION OneSouthWacker (847)215-8550 scheduline'order Socio Homes866-736-3678 set forth below, the toliowingIf this property Is a condo-Ing Oltidlal will at 12:30 p.m. DrIve, 24th Floor, ChIcago, IL - management pret'd. Must described real esbale: cash, floe following descrIbed 365 - or employment coil have knowledge of LINCOLNW000 3BR, 1.SBA. MARSHALL minium unit, the purchaser ofon April 15, 2009, at 205 W.property: P.I.N. 10-27-416-026.60606.4650 (312) 236-SALE 047-229-11 Commonly known as4328the unIt at the foreclosureRandolph Street, Suite 1020, NOTE: Pursuant to the FaIr COrner/EPIC appiictions, newly renovated, new carpet, 51 1Ridge Rd, Wilmette NORTH NEWCASTLE AVE- ChIcago, Illinois, sell at pub-Commonly known as7343 Experience with Soldent $1300/mo. BIll 1224)588-681) saie, other Ihan a monleagee NORTH KOSTNER AVE-Debt CollectIonPractices DENTAL AS5ISTANT NUE, HARW000 HEIGHTS,shallpay the assesnmenbslIc auction to the highest bld-NUE, LINCOLNWOOD,ILActyou are advIsed that Dynamic Exteriors415- Seeking Full Timo. Experienced. benchmark data is a plus. -ri.n.ni 2 BR LoaM. HOUsING IL 60706 Property Index No.and Ilse legal foes required byder fer cash, as set forth be- Plaintiff'sattonnev Is deemed Call 713-239-1238 Lincolnwood - mR, 2BA, 607)2. The Improvement on RootingSidIng . Gutters Employment- oPPoRTuNITY 13-18-306030-0000 The real es-The Condominium Propertylow the following describedthe property consists ofsin-to be a debt collector attempt- Lic/Banded/insurod Wo otter an excellent benefit newly-nemocleied, garage, 1.5 BA All neat estate advertising Intote Is improved with a singleAct, 165 ILCS 6058/(g)(1) andreal property: Ing to collect a debt and any Household package and salary $1600/month. 650-709-3800 elefamIlyresIdencewIth Wo Uso RubborWheei Troilers 952 SF this newspaper is sublect tofamily resIdence. The lude'(g)(4).IF YOU ARE THECommonly known as 6712gorge. Sale terms: 25% downintermalion obtaIned wilt be 847833J271 Dental commensurate w/ 500s tIre FaIr Housing Act, whichmont amount was $422,673.21.MORTGAGOR (H0MEOWN-North Hamlin Avenue, experience. Please 375 ILLINOIS HOMES Sale terms: 25% down of the by certIfied funds, balanceused tar that purpose. BEST European NannIes OFFICE MANGER-FT apply online at MELROSEPARK IER/IBA. makes it illegal te advertise ER), YOU HAVE THELinceinwood, IL 60712 Por-within 24 hours, by certltied 1162651 Cleaning iodles, Care givers, Ceramic , new paInt, Local Agenti any preference, limItation orhighest bld by certified fundsRIGHT TO REMAIN 119 POS-manenl index No. :10-35-303-funds. No retundo. The prep- Published In Pioneer press Mitch, 047.844-8404 No fee. Inci. reception work. tracking www.ifh.org/caneers $750/mo d-soc dep. Gos, ht & Including 360 In the Chicago area discrImination based en age,at the close of the auction) theSESSION FOR 30 DAYS AF-034 The mortgaged neal os- Ins, recare oppis. Musi have on cali Cindy Bail at Patti Furman balance, In certIfied tundo, Is erty wIll NOT be open fon In- Z'5, 3/12, W)9/09 (1674284) C Apartments, wtn Incld. On site Indny, resvd race,color,religion,sex, TER ENTRY OF AN ORDERtate is Improved with a dwell-specfbon, Upan payment in Tile working dentalknowledge. (041) 535-d44lwIth any 505- prkng, (312)932.6506 handIcap, tamnilial status ordue within twenty-tour (24)OF POSSESSION,INAC-Ing. The property will NOT be Submit letter at Introduction questions. EOE ColdweH Banker547-729-7261 . heurs. The subiect property is full of the amount bid, theMORTON GROVE . Condominiums- Friday, Saturday & Sunday national origin, or intention fo CORDANCE WITH SECTIONopen for inspectIon, The lude-purchaser will receive a Cor- IN ThE CIRCUIT COURT 375 - JENNY'S AGENCY & complole resume Inci. nei. MORTON GROVE make any such preferences,sublect to general real estofe15-1701 (C) OF THE iLLINOISment amount was $303,400.61.tlticate ot Saie which wIll en- OF COOK COUNTY, Babysitters, to: 708-771-8)75er Suburban 50 N Plum Grove Rd Unit 202, Palatine limitations er discrlminot ion.taxes, special assessmnenfn,MORTGAGE FORECLO-Sate terms: 10% et successful monicaddsc5iool.com Immed. 0cc, 2BR, 213A, 01ev, special taxes levIed title the purchaser fo a Deed ILLINOIS MR. GROUT 041-359-4136 Careglvers, Hsekpens 110 bed nursing homo in bide. 1 heated lndr. prkg. sp. -t-'-MARCH27th,- 28th&:2$ - or SURE LAw. For Inferma-bld ImmedIately at condlU-to the premises atler conf Ir-COUNTY DEPARTMENT - REPAIR CAULK Live 11V Out. Skokie arca is seeking a All apptcs. bd. w/d In unit. 2 BR The IllIneis Human RightsagaInst sold real enfote and islIon:VisIt our website atsien of auctIon, balance bymotion of the sale. For lnfor- CHANCERY DIVISION CertifIed and Bonded No pots allowed. Near train 1:00PM'Each'Day- -' Act prohibits discriminationoffered ton sale without any \ C O r y I C O a t t y -noon the next busIness day, BATHROOM REMODELS social worker- B.S.W. or - Advertie 2 BA representation as to qualifyh t t p : motIon: Visit our wobslfo atGMAC MORTGAGE, LLC TILE/MARBLE INSTALLS 841.53748491847-459.0565 degree in related field, fon station, 2 yr.lease. $1450-$155g in the saio, rental or advontis- pmerce.comn. between thebollo by coshler'schecks, andh t t P : 1/ s o n y I C O . a t t y -Plalntift, -V.- JERZY DIRECTOR OF 047-470-8100 Yorktown Cfr' Ing of real estate based on facor quantity et title and with-heurs of 3 and 5 pm. PIERCEno refunds. The soie shall be EUROPEAN CRAFTSMAN interview Please ax -rhe Wéstlñ Lombard 1285 SF eut recourse fe PlaintIff and piorco.cem. Between 3 p.m.POLECHONSKI, et al HEALTH SERVICES ifesun vlo. $41-6760432 tors in addItion to those pro- & ASSOCIATES,Plaintif f'ssubbect to general real estateand 5 p.m. only. PIerce & An-Defendants Lleborrnan Center ton in AS 1S condItion. The saleAttorneys, One North Dear-taxes, specIal taxes, specIal POLISH CoregiverAvail tar NlLES6tlat, 1BR gardon, Get your next home at the price you sot fected under federal law, is further sublect to confirma- taxessociates, Pialntltf'sAltar-os CH 29664 CONSOLIDATED come-and-goon live In, good Health & Reliablfliation, 24/7 ND fis, new paint, heat mcl, LouaI Agenti born Street Sulle 1300,assessments,special neys, I North Dearborn WITH 08 CH 9594 Skokio IL LANDSCAPE MAiNT with NO STAITTING BIDS. It you re buying tlon by the court. Upon pay-CHICAGO, IL 60602. Tel No.levied, and superIor lleno, If Tree Trimming ref's. own car, Call Hanno Call $695 + sec. AvaIl Immed. Dennis Rusin This newspaper willnobmont In full 01 the amount bid, any. Ttoo property Is of tenedStreet, ChIcago, IllInoIs 60602. NOTICE OF SALE (708)7854032 er (703)456-5206 Responsible for the Exp. Driver $13/hr. Worker 847-384-1940 or 847-962-8437 your.first home or your 10th, today's knowingly accept any udver- (312) 476-5500. Please refer fo TeI.No. (312) 476-5580,ReferPUBLIC NOTICE IS HERE- planning, development, $12/ion. Eves 847-128-00M Andy (841) 998-3400 the purchaser will receIve afIle number PAOO)9600. THEas Is,- with no express or Im- & Care housing market and low interest rates Cornerstone Realty847-398-3900 tislng for real estate which isCenllticrote ob Sale that will plIed warranties and wilhoulle File Number 0700307. BY GIVEN that pursuant to a management 8 evaluatIon NILES Close to MIlwaukee In vbolallon of the law. Ali JUDICIAL SALES CORPO- INTERCOUNTY JUDICIALJudgment of Foreclosure and of skilled nursing care Email make this an ideal time for you to buyt entibio the purchaser te aRATION One South Wackerany representatIon as to Ihn SALES CORPORATION Sale onfered inthe above 376 - 428- Help Wanted - sorvices fon our 240-bed class if iednigi and Dempsten, Newly remod. persons are hereby informeddeed to the real estate atlerDrive, 24th Floor, Chicago, iLqualIty of tltte or recourse fo 2eR, HW tirs, ht, gas 8, water 9 Wright Ct, Lake in The HIlls that ali dwellings advertIsedconfirmation of the sale. The PialnIltI. Prospective bld-Selling Officer, (3121444-1122cause on January 14, 2009, an Home Medkd Care tacility. Will work with a pionoerlocal.com are avaIlable on an equal op 60606-4650 1312) 236-SALE 1166041 agenf Of The Judicial Sales supportive Administra- MAINTENANCE md, $8&i'mO, also newly Get All The Details At property will NOT be open ter 1166848 dors are admonished le re- Chris Tree Removal remad 2ER bsmt apt, $830. 4BR portunity basis, and plalntitt Published in PIoneer Press Carliorallon will ai 10:30 AM Trimming - Ctsi Downs tivo team. Requires BSN Online Inspection PublIshed In Pioneer Press view the court file to verity w19, 3126, 'OVO? (16774-40) C on April t6, 2009, at the affido Arivaie Duly tt'omecorc with current IL ilcen5e & MECHANIC hftps :\',orders. 108-701-2343 makes no represenlalion as to 3/19, 3/26, 412/59 (1677476) C all Information. Fer Informa- StumO RemovalFirewood Nues Township High 3BA Te complain of discrimina-the condition 01 the property. et The Judicial Sales Corpo- Free EstimatePully insured Recei,l len i st min 5 yns managerial exp. pioneerlocai.cam IlhñóiöHoUáöAúCtIoflm lien, dall HUD tell free at: 1- tien:Saio Clerk, FIsher and ratIon, One South Wacker raw ng company oo ng Must have exp in either School District 219 seeks a NILES - Dem0stor & 2753SF ProspectIvo bidders are ad' ShapIro, 4201 Lake Cook Rd., Chris 773-216-0013 full time individual with 800-669-9777. LIN COLN WOOD MORTON GROVE Drive - 24It Floor, CHICAGO, tor health care receptIonIst. long-term care tacility or Fax Cumberland, i BR, 3.5 ros, OR CALL FOR A FREE BROCHURE monlxhed to check the court ist floor, Northbrook, Illinois IN THE CIRCUIT COURT IL, 60606, soll al public auc- Fax Resumes 547-266-3707 o hospital environment. experience and proficien- (847) 486-7497 ist tIr, avail W1, 847-963-2)78 file to verIty all intormallon. IN THE CIRCUIT COURT 60062, (547) 498-9990, between CHRIS TREE SERVICE cy In the trades of HVAC, Local Agenti It thIs property is a condo- OF COOK COUNTY, i :00 p.m. and 3:00 p.m.eek- OF COOK COUNTY, lion to the highest bIdden, as Treo Removals, TrImmIng, Musi be experienced w! Electrical, Plumbing and ILLINOIS ILLItlOIS set torth below, the following Medicare, Medicaid & la- NItos/bes Plaines-Golf MIII 866.516-4078 Laura Grasemann 1:1ie ixt mInium unit, the purchaser of daysonly. 1156385 COUNTY DEPARTMENT-described real estofe: Cut Downs, Stump Removal Refrigerant. Competency the unitat the toreclosureCOUNTY DEPARTMENT, Published in Pioneer Press cal licensure require- Location 2BR 1.SBA Condo, CHANCERY DIVISION CHANCERY DIVISION Commonly known as 9404 Senior DIscounts, Free Est. Buying or Selling, monts. We otter a competi- preferred in at least (2) of PIONEERÎRESS Immect pass. reserved park, Prudential First Realty847-414-5050 sale, ether than a mortgagee S, W12, 3f19/09 (16742601 C NATCHEZ AVENUE, Morton Putty Ins. Chris' 312,611-5535 the trades, Houriy rate of vous LOCAL 5005CC shall PaytireoisessmentsJPMORGAN CHASE BANK, U.S. BANK NATIONAL AS- live salary & excellent $34.tlwifh excellent bene- CNHeat$1l0ß + elec. cali ! l\i NATIONAL ASSOCIATION, SOCIATION AS TRUSTEE.Grove, IL 60053 Property In- benefits pkg. Submit cvr Greg 047-214-6190 t)Ji TO PIONEER,PRESSand the legal fees requIred byPlelntlffV. B U D I M I R POOLING #40513 01STdox No, 10-18-217-006 The neat ilr, resume, 8, salary re- fils package. Apply online 613Case PI, Evanston cove LOCAL 5000CC The CondomInium Property Plaintiff, of www.niies-hs,k12,ii.us, HUDSON & Act, 765 ILCS 605/9(g)(1) andSAJIC MORTGAGE ELEC-LINCOLN WOOD #2007K53 -V.-estafe is Improved with a sin- Pioneer Classified quiremonts: Jobs@CJE N1LES- Newly Renovated The DeInes and REGISTRATION INTIIE CIRCUIT COURT MDHAMMAD A. MALIKgb familyresIdence. The Tuckpointing net or Fax 847-929-3338. 4 BR (91(1). IF YOU ARE THETRONIC ttecixtz 3br, 1.5ba , ail oppl. pioneer Press NewspapersMORTGAGOR (HOMEOWN-SYSTEMS, INC., AS NOMI- OF COOK COUNTY, P1K/A MOHAMMAD MALIK,ludament amount was $1300 md HEAT. 041-635-0982 MARSHALL 3%' 2 BA HAVE THENEO FOR AEGIS WHOLE- ILLINOIS el al Detondonts $660,015.68. Sole terms: 25% -380- ER) YOU OSCH 15612 cjeSeniorLife Salesperson TO - SALE CORPORATION) COUNTY DEPARTMENT- down of the hIghest bid by 2375 SF RIGIT TO REMAIN IN POS- NOTICE OF SALE certified funds at the close of is the place (non-profit, eoe, ns/f/v/d) Avenue Fashions in Beautiful View 01 Lake NOR RIOG SESSION FOR 30 DAYS AF-CITIBANK, N.A.. SUCCES- CHANCERY DIVISION Lincolnwood socking OPEN HOUSE: SOR MERGER TOOLi MORTGAGE CAPITAL.PUBL1C NOTICE IS HERE-the auction; the balance, In i -773-282-2332 1051-1055 W. PRATT La tOR $685+util, prkgincl. BUYER Local Agent: Norwood Park Area TER ENTRY OF AN ORDER BY INC. Plalntltt, vs. ATHEERBY GIVEN that pursuant to acertitiod funds, Is duo within salesperson. Must have exp. EXTRA SPECIAL LOCA- Ask about Move-tn SpecIalI t Saturday & Sunday OF POSSESSION,IN AC-CITIBANK. FEDERAL SAV- Gralak Cencrel. 3 1uckpoinhing in women's clothing. Newly dec & crptd, oppio, Anthony Nasca Open Sunday )-Apm CORDANCE WITH SECTIONINGS BANK. Detendants BEHNAM, FERYALJudgment of Foreclosure andtwenty-tour (24) hours. The Waterproofing SIepsChimneys No eve's/Sundays. lION. FIRST BLDG OFF March21 &22 AGENTS! 6300 W Huntington, 4 BR 213A OS CH 21 652 SHEENA, CURRENTSmile entered Inthe abovesublect property Is sublect to for you! Driver- COL-A THE LAKE 8 BEACH. NEW-A/C. Lndry avl.(173l63i-4991 Bungalow, Spacious Kitchen,15-1701(C) OFTHE ILLINOIS ANY, OFcause on August 2.5, 2008, angeneral real estate taxes, spa- Cati (8471676-3368 LY DECORATED, HEATED, i :00 to 3:00 PM 847-384-7538 MORTGAGE FORECLO- NOTICE OF SPOUSE IF CRST MALONE Rec area In basement, FloodSURE LAW. For Informa- FORECLOSURE SALE ATHEER BEHNAM. CUR-agent of The JudicIal Salesclot assessments, or specIal Now Facility HWD FLRS. IMMCDiATE OAK PARK 2 BR Apt. ist tir Coidwell Banker Residential Brokerage Control $390K MIke SI angel Fisher and ShapIro RENT SPOUSE, IF ANY. OFCorporallon wilt at 10:30 AMtaxes levIed against sold real I-847-724-5600 ' Hammond, IN OCCUPANCY. oh 2 Flat. WIr & indry md. $2,500 down in a cashiers check for each Keller Williams 773-203-1559 lIon: VIsIt our websile at EDMAR, INC. Saies h t t P : \\s o r V 1 cc . a f t y - file V 08-7528 FERYAL SHEENA, CUR-on March 26, 2009, at the of-estate and Is offered for sole Owner Operator Positions IBR $1,055.00 Na smkg. gar spoce indi. In conj. w! Luke Lee Gaule RE I 76.0134489; A1J040000677 RENT SPOUSE, IF ANY OFtice of The Judicial Soles Cor-without any representatIon as Tuckpointing.Mason-y Avouable for Regional RADIO TELESALES To view apt. coil Zialko 1.5 mo rent + sec dep property. S% premium on each sate. plerco.cOmfl. between the(It Is advised that Interested (847) , parties consult wiltt their ownNATHER BEHNAM. CUR-parution, Ono South Weckerto quality or quantify of title 8, Lonehaul Soll t'SAnto businesses. 713-4)5-0035 $1050/mo Mary 108-386-1 969 All sales sublect to seller's approval. 626- Cemetery lots hours of 3 mid 5 pm. PIERCEattorneys botero bIdding atRENT SPOUSE, IF ANY, OFDnive-24th Floor, CHICAGO,and wIthoutrecourseta Lease Purchase HaIin,ork&Jol,00n773-545.6i 60 aASSOCIATES,Plaintif f's Strong phone closerswith , Call 866-5399549 mortgage foreclosure sales.)CARLOS BEHNAM. CUR-IL, 60606, seIt al public ouc-Plalntltf ond in 'AS 15' candI- Also Avaitgbte. sales exp. pret'd. In conj. w, Luke Lee Gaule Attorneys, Oio North Dear- Will train RIVER GROVE 8600 W. -OrGo ONLINE to View A,IL ILLINOIS HOMES Street SuIte 1300,PUBLIC NOTICE Is herebyRENT SPOUSE, IF ANY, OFtIen te the highest bIdder, asBon. The saie Is further sub- Tuckpointiflg/ßrick/Masonry CRST MALONE hose w! exc phone voice!Berwyij/Oek Park Beauf.Grand. spac. I & 2 BD pets 0k, RE # 76,0134489; A1J040000677 MemorIal Pork 2 premIer born glven that pursuant lo o Judg-EDWARD B. KAKA,set torih below, the followIng 998-3400 817-271-8208 CHICAGO, IL 60602. Tel Na, 847-965-2146 skills, Exceileni income 2&3BR, newly remod., todwdht. 1Vc, pnkng. $750 and $915. tots in Lakeside sectIon. (312) 416-5500, pieose.rotor toment et Foreclosure çnteredNATHER BEIINAM, CARLOdescribed real ostato: 800-366-6361 potential. Skokio. 847679-766etim, $900-$1380, 700-663-4491 ...847-338.8983 _____ www.11linoisHouseAuctiOfl.com $6,000 ea. 000 7834434345. I

ThursdayMarth 15,2009 - APioneer Press Pub[ieui)05 oc ssicipidie5torsLC5t6- B- I weAlcpiosccr!ocideorn (Dc) pioñceri4esPubhca0)

Foreclosure-Sales Real Estate

695- JcdlclaI Solee 96- JOdIdOS Sobas 655. JodIclol SOlee 695. Jedlclfll Soles 695. Je,dlelol Soles 695. JudIcial Sales 695- JudicIal Salas 696. JudIcIal Solos 696- J6d19101 Sobo 695. Jodielol SOlOS 695. JudIclol Solas 695. JudIcIal Solos 695- JodidOs Solos 695- S9d16101 Soleo 695- JudicIal Solos se- JudicialSolos

r - 1)1 Press Publication (Do) ThuidayÇ-Márth 1D 2009- 'tfl APiofleC1' wwwpionoerloeal.cGm I ThuLkyÇMáì& 19, 2t109 A P1oh&PrtPúbIÏtibh'bá) rec1osure Sales Real -Estate

695- JudIcial Safes 695-JudicIal Sales 695- JudIci&Sales 695- JudicIal Sales 695- JudicIal Sales 695. JudIcial Sales 695- JudIcial Sales 695- JudIcial Sales perlor llene, If any. The prop- AND general real estate laxes, SPO-ILCS 605191g)(1) and lg)l4).SKOKIE dence. The iudgmenl amounlILCS 60S/9(gI(1) and (g)(4).KNOWN OWNERS SKOKIE orlv Is offered 'an Is, wIIh no specialIF YOU ARE THE MORTGA- won $295,639.94, Sole fermo:IF YOU ARE THEMORTGA-NON-RECORD CLAIM- IN THE CIRCUIT COURT express or ImplIed warran- dal 0ssessmeflts, or IN THE CIRCUIT COURT ANTS, Defendants taxes levied aalnSfsOld realGOR (HOMEOWNER), YOU OF COOK COUNTY, 25% down of the highesl bldGOR (HOMEOWNER), YOU OF COOK COUNTY, lles and without any repro- is ollered for saleHAVE THE RIGHT TO RE- by cerlilled Iundh of lIre closeHAVE THE RIGHT TORE- «CH 15564 ILLINOIS sentahlon as to the qualify of estole MAIN IN POSSESSION FOR ILLINOIS of the cruchon; Ihe balance, InMAIN IN POSSESSION FOR NOTICE OF COUNTY DEPrRTMENT, tIllo or recourse la PlaIntiff. wihoUt OflY repressntatlon as30 DAYS AFTER ENTRY 01'COUNTY DEPARTMENT -cerllfled lunds, Is oltre within30 DAYS AFTER ENTRY OF FORECLOSURE SALE CHANCERY DIVISION prospectivo bidders aro ad- o qtiaIIlY etquanllly of lilie CHANCERY DIVISION recourse toAN ORDER OF POSSES- Iwenly-tour (24) hours, TheAN ORDER OF POSSES- Fisher and ShapIro THE BANK OF NEW YORKmonished to revIew the court and wiih0 CITIMORTGAGE, INC., lIla 008-4760 fIantIf OPtI in AS lS condl-SION, IN ACCORDANCEPlaInlItt,-V.. MOHAMMEDsublecl property in subloel toSION, IN ACCORDANCE AS TRUSTEE FOR THE111e to verily ail Inlormatlon. sub-WITH SECTION 15-1701(C) general real enlato toses, spo-WITH SECTION 15-1701(C)Ill Is advIsed lIraI InleresledCERTIFICATE HOLDERSFor InformallonSale Clerk. tiOfl. the salO Is further HUSSAIN, el al Dolendontn OF THE ILLINOIS MORT-partIes consult wllh their own ALTERNA-FIsher and ShapIro, 4201 Lake by theOF THE ILLINOIS MORT- OB CH 12972 dai assesnmenls, or special CWALT, INC. jeCt IO conlirmatbonsull ofGAGE FORECLOSURE lasos levied arlainsl said realGAGE FORECLOSUREallorneys beloro bIdding alTIVE LOAN TRUST 2006-Cook Rd., 1st floor, court. UP° payment In NOTICE OF SALE LAW. For irrlormolion: VisItmortgage foreclosure salent PASS- 60062, thOOflOUflt bici, the purchosOrLAw. For Informallon: VisitPUBLIC NOTICE IS HERE-eslale and is ollered for noie 4ST1, MORTGAGE Northbrook, IllinoiS ofour webslle cr1 wilhsul any reprerenlallon osour webstls atPUBLIC NOTICE Is herebyTHROUGH CERTIFICATES,(847) 498-9990, between I 00 will rocoivO O Certilicate h t I p : \\s o r y I c e . a t I y -BY GIVEN lIraI pursuanl loaIo qualIty or quanllty al tilleh I t P : \\ s O r V I C O , a I t y -gIven that pursuant to a Judg-SERIES 2006-SOTS,Plainflftp.m. and 3:00 p.m. weokdays Sale that will enhile the pur- IheJudgment et Foreclosure andandwithout recourse loplerce.com. between Ihnmont of Foreclosure enlered KNADIJA AHMED; 3151137 chaser to o deed to therealpierce.cOm. belwoen Saie enteredInIhe above V. only. ofhours of 3 and 5 pm. PIERCE Plainlifl and In AS 1S condi-hours of 3 and S pm. PIERCEen January 6, 2009, Kollen Re-MOHAMMED A. AHMED Published In pioneer Press estate utter confirmationwilt8. ASSOCIATES, Piainlif l'scause on January 6, 2009, anlIon. The sale is furllrer sub-8. ASSOCiATES, PIalnlltf'rally Services, Inc., as SellingP1K/A MOHAMMED 3/5, 3112, 3/19/09 (1674061) C lico SO The property agent of The Judicial Satesledto confirmalion by theAtlornoya, One Norfts Door-Dllicial will at 12:30 p.m. onAHMED; MORTGAGE NOT be OPCC forinspectionAttorneys, One Norlh Dear-Corporation wIll at 50:30 AM at205 W. born. Slreet Suite 5300, courl. Upon naymenl In full ofborn Street Sullo 1300,April 7. 2009, ELECTRONIC REGISTRA-SKOKIE onci plaintiff makes no repro- on April 8, 2009aI the office CHICAGO, IL 60602. Tel No.Randolph SIred, Sullo 1020, SYSTEMS, INC., flt(1iIOfl CS lo tIte conditionCHICAGO, IL 60602. ToI No. the amount bid, Ihe purchaser TION IN THE CIRCUIT COURT (312) 476-5500. Please refer Ioof Tire JudicIal Sales Corpo-will receive a Certificate of(312) 476-5500. PleaSe refer loChlcoge, IllinoIs, sell al pub-Defendant) OF COOK COUNTY, ol the properlY. ProspecliVO ratIon, One Soulh WackerSate thaI wIll antille the pur-file number PAOB1167O. THElIc auction lo the hlgheel bld- 0t CH 35219 ILLINOIS b3ddcrs aro admonishedtotile number PA0819021. THEDrivo-24tti Floor, CHICAGO, JUDICIAL SALES CORPO-der ter caSh as Set forth be- NOTICE OF ChCCk the court file lo verifyJUDICIAL -SALES CORPO- chaser to a deed lo the real COUNTY DEPARTMENT, RATION One Soulh WackerIL, 60606, sell at publIc auc-esfole alter confirmalion ofRATION One Soulh Wacherlow, lIre followIng descrIbed FORECLOSURE SALE CHANCERY DIVISION all lnlorfl1nu10', if this prop- lion to Ilse hIghest bidder, asthe sale. The properly willDrIve, 24th Floor, Chicago, ILreal property; FIr,Irer and ShapIro LASALLE BANK NA AS £3 condominium uniteDrive, 24th Floor, Chicago, ILset torIls below, the following Commonly known as3300 env ¡$ 60606-4650 (312) 236-SALE NOT be open tor inspeclion60606-4600 13121 236-SALE filo I 08-10691 TRUSTEE FOR tuo purchoser of theunit at described real estafe: 1162096 CapItolSlreet,Skoklo,IL(Il In advised 11101 Interested other . 11d6007 and plaInIlIf makes na repro- WASHINGTON MUTUAL theiorecl000resale, Commonly known as8628sentalion as Io Ihn condillen Published in PIoneer Press 60076 Permanent Index No.;parties consult with theIr ownASSET-BACKED CERTIC-l- uTon a rnortgoCoe shall pay Published In Pioneer Press NILES CENTER ROAD, 10-23-211-056 The mortgagedallorneyS before bidding al and Iho legal 319, 3f26, V2iT39 (16776161 C of tIre properly. Prospeclive 3/5, 3/12, 3/19/09 (1674014) C CATES WMABS SERIES the UNIT 213, Skokle, IL 60011bidders are admonished to real Ostalo Is Improved wIth amortgage foreclosure salpo.)2006-HE4 TRUST, Plalnflff V. tocs required by The Coñdo- Property Index No. 10-16-430-check the court file to verify dwellIng. The properly willPUBLIC NOTICE Is herebySAMINA A. PAREKH NK/A niiniumProperly Act,165 023-1061 The real esfole Is im- S KO K lE NOT be opon for InspectIon.given lIraI pursuant ta a Judy- all Information. il 1h15 prep- IN THE CIRCUIT COURT The ludgrnont amount was SAMINA PAREKH; AFZAL ILCS 605/919th) and (ci)(4).SKOKIE proved with a condominIum.erly is a condominium uniI, ment of Foreclosure enteredPAREKH; MORTGAGE IF YOU ARE THE MORTGA- IN THE CIRCUIT COURT The ludoment amounl wasIho purchaser of Ihe unit al OF COOK COUNTY, $3S3,378.19.Sale terms; 10%on January 23, 2009, KallerrELECTRONIC REGISTRA- GOR 1HOMEOWNER), YOU OF COOK COUNTY, $467,992.66. Salo lerms: 25%Ihe foreclosure sale,ollrer ILLINOIS of successful bld immodlalel Really Services, Inc., os Seil-TION SYSTEMS, INC., AS TAC HAVE TI-tE RIGHT TO RE- ILLINOIS down of the hIghest bld by COUN1Y DEPARTMENT, al conclusion of aucliors ba -Ing OfficIal will al 12:30 p.m. CIT than a morlgagee sIrall pay NOMINEE FOR MAIN IN POSSESSION FOR COUNTY DEPARTMENT -certified lunds at Ihe close ofIhe assessmenls and the legal CHANCERY DIVISION once by noon the next busl-on AprIl 28, 2009, at 205 W. 30 DAYS AFTER ENTRY OF CHANCERY DIVISION the aucllorr; the balance, In U.S. BANK, NATIONAL AS-ness day, bolli by cashier'sRandolph SIred, Sulle 1020,G R O U P/CO N S U M E R fees required by The Condo-SOCIATION, AS . TRUSTEEchecks; and no refunds. The FINANCE, INC.: Defendants AN ORDER OF POSSES-U.S. BANK NATIONAL AS-certified tunds, is duo wllhmnminium Properly Act, 765 Chicago, IllinoIs, sell at pub- 08 CH 27231 IN ACCORDANOESOCIATION. AS TRUSTEEIwonly-four (24) hours. The ON BEHALF OF THE HOLD-sale shall be sublect lo rjensr-lic auctIon lo the highosl bid- SION. 1LCS 605/9Ig)I1) and (g)(4I. OF NOTICE OF WI tu SECTION 15-1701 IC)FOR FIRST FRANKLINsubiect property is xublect loIF YOU ARE THE MORTGA-ERS OF BANC al real colale laxes, specialder for casti, as sel forth be- FORECLOSURE S.",LE Or THE ILLINOIS MORT-MORTGAGE LOAN TRUST,general real esfole laxes, ope- AMERICA FUNDING COR-laxes, special assessmerrls.low the following described GOR (HOMEOWNER), YOU MORTGAGEspecIal laxes levIed, and su- Fisher and Shapiro GAGE FORECLOSUREMORTGAGE PASS-dal assesomenls, or specIalHAVE THE RIGHT TO RE-PORATION reaiproperty:C/K/A 8137 file O DB-008950 LAW For InlormallOfl, con-THROUGH CERTIFICATES,laxes levied against said realMAIN IN POSSESSION FORPASS-THROUGH CERTIFI-perler liens, Il env. The prop-LARAMIE AVENUE,lIt Is advIsed that Inleresled oct iiaintill'sOltornoy LAWSERIES 2005-FF1O PlaInlifI, -estafe and is otfered for sate35 DAYS AFTER ENTRY OFCATES, SERIES 2006-H,erly Is offered as ln, wilh naSKOK1E, IL 60077. TAX IDparties consult wIlli Iheir own OFFICESOF RAT. NEVEL SVETLANAwilhout any represenlallon as Plaintilt V.express or Implied warran-NO. 10-21-400-041 The mort- V.- AN ORDER OF POSSES- SYED ollorneys before bidding at . 115 N. FranklinSIred, SullaSTOJANOVIC, el allo quailly or quantity et lilIeSION, IN ACCORDANCEEHTESHAMUDDIN ties and wtthoul any repro-gaged real estate is improvedmorlgoIlO foreclosure sales,) 201, CHICAGO IL 60606 i312)Defendant andwithoutrecourse toWITH SECTION 15-1701(C)NK/A EHTESHAMUDDsenlalion as Io the qualIty ofwith a dwelling. The properlyPUBLIC NOTICE Is hereby 7.ii25 Please refer catis lo _00 CH 52M plainlill and in AS 15 condi- SYEDlNATIONAL CITYlilie or recourse Io plainlift.will NOT be open for Inspec-gIven 1h01 pursuanl to a Judy- . OF THE ILLINOIS MORT- Prospecllve bidders are ad- the coles deparlmefll. TI-tE NOTICEOFSALE lion. The sale is furlher sub-GAGE FORECLOSUREBANK; VILLAGE CONDO- lIon. The ludemonl aniounlmont of Foreclosure entered jUDICIAL SALES CORPO-PUBLIC NOTICE IS HERE- lo confirmatIon by the MINIUM ASSOCIATION,monished lo review the courtwas $697,755.71.Sale terms: led LAW. For Information: VIsitUNKNOWN OWNERS AND on January 7, 2009, KoIlen Re- RATION One South WackerBY GIVEN thaI pursuant to court. Upon payment in lull ofour websile al tito to verify all Informallon.10% of successful bld immedt-ally ServIces, Inc., as SellIng Drive, 24th Floor. Chicago ILJudgment of Foreclosure andlIre arneunl bid, the purchaser NON-RECORD CLAIM-For Informalion: Sale Clerk,ably al conclusion of aachen, ti I t P : \,s e r V i c o . a I I y.ANTS, Defendants FIsher and ShapIro, 4201 Lake OffIcIai will at 12:30 p.m. on vvORi WEEK. 64)606-4650 1312) 235-SALESate enlered Inthe abovewill receive a Cerlilicale of bolween Ihn balance by 12:30 p.m. the 2009,al 205 W. pierCe.cOrfl. April8, NOTE: Pursueflf to the Faircauso on Juno 24, 2008, anSaie thaI wIll enhIlo lIre pur- 08CH 31921 Cook Rd., 1sf floor,next business day, bolli by Irours of 3 and 5 pm. PIERCE NOTICE OF NorllrbrOok, Illinois 60062, Randolph SIred, Suife 1020, Debt CollodionPracticesagent of The JudicIal Saleschaser io a deed to lIre real8. ASSOCIATES, PlainIIlf'r cashier's checks; and no re-Chlcaeo, IllInoIs, sell bi pub- you are advised hintCorporalion will al 10:30 AMoslalo aller confirmation of FORECLOSURE SALE - (847) 490-9990. belWeen 1:00funds. The sale shall be sub- Act, Atlorneys, One No, Ib Dear- CONDOMINIUM p.m. and 3:00 p.m. weekdays lic auclion to the hIghest bid- I'IartItt'sallorney i5 deemedan April 8, 2009aI the of licethe sale. The properly willborn SIred Sullo 1300, 10cl lo general real eslalo lax-der for cash, as set forth be- NOT be open for inspection Fisher and Shapiro only. 1152849 es, spe,.lol taxes, special as- Io be a debt collector atlerTipt-of The Judicial Sales Corpo- CHICAGO. IL 60652. Tel No. Published Irr Pioneer Press low, the followino described iivj IO collect a debt and anyrallan, One South Wackerand plaintif1 makes no repro-(352) 476-5500. Please refer lo file W 08-9416 sossmenls, special laxes lev-real property: iolorrncrtiøfl obtained wilt beDrlvo-241h Floor, CHICAGD,senlation as lo the condillonfile number PA0816537. THE(il is advised thaI interosled 3/5, h'l2, 3/19/09 (16740001 C led, and superior liens, If any.Commonly known as 9151 usciI tor thai purpose. IL, 60606, sell al public auc-of the property. ProspecliVoJUDICIAL SALES CORPO-parties consult wilh theIr own TIre properly is altered .5 is,Kolmar Avenue, Skokie,IL 1165913 bidders are admonished lo atlorneys aclare bidding al wIlli no express or implIed lion to tho hlghesl bidder, as RATION One South Wackermortgage toreclosure sates.) SKOKIE warranlies and wilhoul any60076. Pormanefll Index No.; Published In Pioneer Press sot forth below, the followIngcheck the court tile to verIlyDrivO, 241h Floor, Chicaeo, ILPUBLIC NOTICE Is hereby IN THE CIRCUIT COURT 15.15-305-001 and 15-15-305-002 5, 3/12 3f59/09 (1674065) C described real estafo: ali information. If Ibis prop-00606-4650 (352) 230-SALE OF COOK COU NTY, represenlofion as la lire quail-The mortgaged real estafe Is given that pursuant ta a Judy- . Commonly known as7415env Is a condominium uniI, 1161255 ILLINOIS lv el 1111e or recourse la Plain-Improved with a dwelling. AVENUE,the purchaser of lire unit cr1 meni of Foreclosure onleredCOUNTY DEPARTMENT.litt.ProspectIve bIdders areThe property wilt NOT be KILDARE Published in PIoncer Presson January 8, 2009, KaIlen Ro- Ioreviewthe PAT IT QN SKOKIE, IL 60076 ProperlyIhe foreclosuresaie,allier 3/19, 3126, 417/09 11671433) C CHANCERY DIVISION admonished opon for inspeclion. The lucig- 5-E CIRCUIT COURT THE BACK. than a mortgagee shall pay ally ServIces, Inc., as SellIng BANK, NA-court tile Io verity all Infer-meni amounl was $446,708.08. Index Na. 10.27.410-056-0000, WACHOVIA OF COOK COUNTY, the assessments and Ihe logorI OfficIal will at 12:30 pen. on ASSOCIATION,mallan. Forinformallon: 5027.4)O-017-QQOO The real es- S KO KlO 205 W.TIONAL andSalo terms: 10'/. of successful ILLINOIS talo is Improved with a singlefees required by The Condo- Aprii 9,2009,al Plainlill V. ROLANDOSale Clerk, Fisher bid Immedialely al conclu- COUNTY DEPARTMENT-family residence. The lude-minium Property Ad, 765 IN THE CIRCUIT COURT Randolph Street, Sulle 1020,ARRELLANO; LUNAShapIro, 4201 Lake Cook Rd.,slon ot auction, balance by CHANCERY DIVISION ILCS 60519(gl(ll and (gIl4). OF COOK COUNTY, Chicago, IllinoIs, soil al pub- BANK OFIst Iioor, NorthbreOk. Illinoisnoon Ihn next business day, NSBC BANK USA, NATION-ment amount was $844667.71. ILLINOIS tic auclion lo the highest bld-RASHO; 60062, (847) 498-9990, between ASSOCIATION, ASSale terns: 25'/. down of theIF YOU ARE THE MORTGA-COUNTYDEPARTMENT- LI NCOLNWOOD; both by cashlor'schocks and AL highe5t bld by certified fundsGOR IHOMEOWNER), YOU der tor cash, as sol forlh be-JPMORGAN CHASE BANK,1 :00 p.m. and 3:00 p.m. week-no refunds. The sate shall be TRUSTEE UNDER THE HAVE THE RIGHT TO RE- CHANCERY DIVISION low, the followIng describedNATIONAL ASSOCIATION,days only. subiecl to general real estala FOOLING AND SERVICINGal the close of the auction; the INDYMAC BANK. F.S.B.real property: 1165031 balance, In certilied funds, IsMAIN IN POSSESSION FOR SHERON SUCCESSOR BY MERGER taxes, soeclal taxes, special Now Monster works with Pioneer Press,so you can warmly AGREEMENT DATED AS PlainliIf, -V.- C/K/A 8203 Nues Confer Road, PublIshed In PIoneer Press specIaltaxes due wilhmn lwenly-fOur 124)30 DAYS AFTER ENTRY OFPILL/sI NK/A S. PILLAI, elUnit 39, Skokie, IL 60017 Per-TO BANK ONE, NA, assessments, OF JULY I, 2005, FREMONThours. The subject property isAN ORDER OF POSSES- Defendants WI?, 3126, 4/2(09 (16774791 C levied, and suororior liens, if HOME LOAN TRUST 2005-C ACCORDANCEal Del endanls manenl Index No.: 10-21.406- 08 CH 32544 any. The property IS offered PloinIlIf,-V.-JESSIE DEsubiect ta general real estateSION, IN sa CH 19635 035-1010 The mortgaged real embrace the work week in the suburban Chicago ti/K/A JESSIEtaxes,special assessments,WITH SECTION 15-1701(C) NOTICE OF SALE improved wIlls a NOTICE OF SKOKIE as Is, with no express or Im- area. JESUS taxes loviodOF THE ILLINOIS MORT- esfoleIs FORECLOSURESALE- IN THE CIRCUIT COURT pIled warranlles and without DEJESUS, el ai Defendant or special PUBLIC NOTICE IS HERE-dwelling. The properlY will OP COOK COUNTY, against said real estate and IsGAGE FORECLOSUREBY GIVEN thaI pursuant loa CONDOMINIUM any representation as to 1fb 0f CH 33390 LAW. For Information, con- NOT be open for Inspection. Fisher and Shapiro ILLINOIS quality of tIlle or recourse to NOTICE OF SALE offered for sale wIthout any judgment of Foreclosure andThe purchaser o? the uniI olh- COUNTY DEPARTMENT, ProspectIve bld- Your calling ¡s calling-find it at pioneerlocaLcom/monster. PUBLIC NOTICE IS HERE-representation as ta qualllytacI Piainlifl's altornev:Saie enteredInthe aboveer than a mortgagee shall pay file 0 08-9732 Plalnlltf. or quai,IlIv of title and with-HAUSELMAN, RAPPIN 8. (lt Is advIsed that Intorenled CHANCERY DIVISION dors aro admonIshed to re- By GIVEN that pursuant toO cause on Januory 5, 2009, anthe assessments and the legalparties consult with their ownTHE BANK OF NEW YORKvIew the court fIle la verify Judgnoenl of Foreclosure andout recourse to PlaintIff andOLSWANG, LTD. , 39 SouthagonI of The JudicIal Salesfees required by 765 11_CS LaSallo Street-Sulle 1565, altorneys before blddlnu alAS TRUSTEE FOR THEall Information. For Informa- Sole enleredIn The aboveIn AS 15 condllion. The saie CorporatIon wIll al 10:30 AM605/9(01(1) and (g)l4). Themortgage foreclosure sales.)CERTIFICATE HOLDERS Salo Clerk. FIsher and couse on Junuory 9, 2009, OnIs further subiecl to conf irma-CHICAGO, 1L60603, (312) 372-on April 1. 2009al the 0111cciudgment amount Was lIon: tIan by the court. Upon pay-2020. Please refer to file num- PUBLIC NOTICE is herebyCWALT,INC. ALTERNAShapIro, 4201 Lake Cook Rd., agent of The Judicial Sates et The JudicIal Saies Corpo-$226,635.01. Sale fermo: 10%given that pursuant la a Judy-TIVE LOAN TRUST 2006-lot floor, Norfhbraok, IllinoIs Corporation will at 10:30 AMment In full of the amounf hid,ber 00-2222-6770. THE JUDI-rallon,One Soulh Wacker01 successtul bld Immediately PASS- the purchaser will receive aCIAL SALESCORPORA-DrIVe-24lh Floor, CHICAGO,at conclusion of auction, bal-ment of Foreclosure entered2005 MORTGAGE 60062, (847) 498-9990, betWeen on Aprii 11, 2009, of the officeCertIfIcate of Sale that wIllTION OneSouthWacher on January 7, 2009, Kallen Re-THROUGH CERTIFICATES,i :00 p.m. and 3:00 p.m. week- st Tire Judicial Sales Corpo- IL, 60606, sell af public asic-once by noon the nest burl-ally ServIces, Inc., as SellIngSERIES 2006-2CC B, 1154149 rotio, One South WackerentitleIhe purchaser ta aDrive, 24Ih Floor, ChIcago, ILlIon lo the highest bidder, asness day, both by cashIer's PIaintlffV- R E V E C Adaysonly. deed ta the real estate aller60606-4650 1312) 236-SALEset forlh below, the lolloWingchecks; and no refunds. TheOfficIal will al 12:30 p.m. 00 Published In PIoneer Press Drive-241h Floor, CHICAGO, NOTE: Pursuanl to the FaIr April0,2009,at205 W.COPIL; MORTGAGE ELEC- :5'5,V12,V19/09(1674067) C MONSTER AND PIONEER PRESS NOW WORK TOGETHER. IL, 60606, seIl al public auc-confirmation of the sale. The described real eslalrr: saio shall be sublect to goner-Randolph Street, Sullo 1020, REGISTRATION properly wIll NOT be open forDebtCollection ProclicesCommonly known as8820al real eslale taxes, specIal TRONIC lion to lIre highest bidder, as 1h01 ChIcago, IllinoIs. sell at pub-SYSTEMS, INC., Defeirdanls SKOKI E set IortIl below, the followingInspection and pialnlif tAct, you are advIsed NILESCENTER ROAD 0200,tacos, special assessmenls, 08 CH 32367 makes no represonlatlon as taPlaIntllI'sallornev Is deemedSKOKIE. IL 60077 Properlyspecial taxes levIed, and su-lIc auctIon Ici the highesl bld- IN THE CIRCUIT COURT described real estate: der fer cash, as sot forth be- NOTICE OF OF COOK COUNTY, Commonly known as9424the condllion of the properly.lo be a debt collector attempt-IndexNo. 10.16430-e23-1036perlar liens, If any. The prop-low, the lollowing described FORECLOSURE SALE STREET.ProspectIve bidders are ad-Ing ta collect a debt and anyThe reol estate is Improvederty Is altered 05 ls, wIth no ILLINOIS LEAMINGTON monished Io check the courtInformation obtained wIll be real property: Floherand Shapiro COUNTY DEPARTMENT - SKOKIE, IL 60077 Property wilh a condominIum. Theexpress or Implied warran-CIK/A 4909 WEST CAROL file O 08-9994 CHANCERY DIVISION Index No. 10-16-208-025TIrOflic to verify ail Information.used lar that purpose. iudgmenl arnounl wastIes and withoul any repre-STREET, UNIT D, SKOKIE,(lt Is advised that Inldrested If Ihmproperty Is a condo- 1161991 $407,647.68. Sale lerms: 25%senlallon as lo Iho quality ol WELLS FARGO BANK, N.A. real osIate Is 1mm avod with a PublIshed in PIoneer Press IL 60077. TAX ID NO. 10-21-portion consull wIlli theIr ownPlaIntiff, VS. PAWEL dnçjle family residence. TheminIum unIt, Iho purchaser of down of the highest bld byfille or recourse ta Plainllff.207-049 TIrO mortgaged realattorneys before bidding atBARTOSINSKU ANNA F. iudtrmenl amount wasthe unitat the foreclosure 5, 3/12. 3(19/09 (1674018) C certIfIed Iunds al lIre close ofprospectIve bidders aro ad- Improved wilfl amortgage loreclosure sales.) saie, other Ilion o morløaee0 the balance, Inmonished Io review the courtestafeIs FILEWICZ NI(/A ANNA 5330,009.31. Soie terms: 25% Ilse oucflon dwelling. The properly wIllPUBLIC NOTICE is herebyFILEWICZ; MADISON down of the hIghest bid byshall paY the assessments corlllied funds, Is due wIthinfile lo verifY all Informallon,NOT be open for Inspection.gIven Ihat pursuant ta a Judy- and the legal tees required bySKOKI E twenty-four 124) hours. TheFor lnlormallonSale Clerk. POINTE CONDOMINIUM certified funds of Ihe close of IN THE CIRCUIT COURT 5u1,iecl property is subiecl to lIre purchaser of the unII olh-ment of Foreclosure enleredASSOCIATION; UNKNOWN the ouclion; lIre balance, InThe CondomInIum Properly Flsherand 5hapirO, 4201 Lakeer than a mortgagee shall payon January5, 2009, Kalten Re-HEIRS AND LEGATEES OF Ad, 765 ILCS 605/9(9)(1) and OF COOK COUNTY, general real esIale taxes, spe-Cook Rd., Ist 110er, certitied funds, Is due within ILLINOIS 60062,floe assessments and the legalally Services, Inc., as SellingANNA K.FILEWICZ,IF lwenly-lour 124) hours The(g)(4)_ IF YOU ARE THECOUNTY DEPARTMENT -dai assessments, or specialNorlhbrOOk, Illinois lees required by 765 ILCSOfficIal will at 12:30 p.m. onANY; UNKNOWN OWNERS sublecl properly Is sublect toMORTGAGOR (t-IOMEOWN- laxes levIed againsI said real1847) 498-9990, belweon 1:00605/9(91(1) and (u)(4), The 7, 2009,al205 W. YOU HAVE THE CHANCERY DIVISION estate and Is offered for saiep.m. and 3:00 p.m. weekdays Aprii AND NON RECORD CLAIM- seserol real eslolo laxes, spe-ER). FEDERAL ludgment amount wasRandolph Street, Suite 1020,ANTSl Detendanls, dal assessments, or specIalRIGHTTOREMAIN IN POS-INDYMAC wIthoUt any represenlallsn asonly. 1156259 $293,651.54. Sale lerms: 10%Chicago, IllInoIs, sell ai pub- SESSION FOR 30 DAYS AF-BANK, F58 F/K/Alo qualIty or quonlIly of title published In PIoneer Press OB CH 10550 toses levied against saId real BANK, F55 et successful bld Immedlalel lic auction lo the hrighesI bld- NOTICE OF SALE TER ENTRY OF AN ORDERINDYMAC andwithout recourselo 5, 3/12. 3/19/09 (1674068) C t auclien, bader tar cash, as sol forth be- erbte and Is offered for sale AC-Plainttft, -V.- TENZINPlaInlilt and In AS lS candi- al conclusIon PURSUANT TO JUDGMENT PIONEER PRESS without any representatIon OsOF POSSESSION, IN LAVER .IAMYANG AIK/A once by noon the next busi-low the following describedOF FORECLOSURE UNDER CORDANCE WITH SECTION lion. The salo is furlher sub- monster® to qualIty or quanfily at tille TENZIN JAMYANG, elal SKOKIE ness day, both by cashIer'sreal properly; ILLINOIS MORTGAGE 15-1701(C) OF THE ILLINOIS lo contlrmalion by the ansi wilhout recourseta led IN THE CIRCUIT COURT checks; and no refunds. TheCommonly known as 7448 FORECLOSURE LAW MORTGAGE FORECLO-Defendant court. Upon paymanl in lull al salo shall be sublect to goner-North Keystone, Skoklo, IL Plaintiff and In A5 iS candi- 08 CH 26350 the ornounl bld, the purchaser OF COOK COUNTY. PUBLIC NOTICE Is hereby lion, The salo is further sub-SURE LAW. For Informa- NOTICE OF SALE ILLINOIS al real osIate taxes, special60076 Permanent index No.;given Ihal pursuanl lo a JudO- lucI lion:Visil our webslte at will receIve a Cerliticale el special assessments,10.27.414-021-0000 10-27-.414- to conllrmatlon by the PUBLIC NOTICE IS HERE-Sale 1h01 will enhIle lire pur-COUNTY DEPARTMENT, taxes, ment of Foreclosure entered court. upon payment in full ofh t t P : \\ s e r y I c e . a I t y -BY GIVEN tIraI purouanl to a CHANCERY DIVISION specIal laxes lovied, and su-022-0000 (UNDERLYING) 10-in the above enlltled causean the amounl bid, the purchaserpierce.cerfl. belween Ihe chaser Io a deed ta the real perlor liens, If any. The prop-27-.414-056 (Now) The marl- hours of 3 and S pm. PIERCEJudonrent Ql Foreclosure andestate aller confirmation ofTHE BANK OF NEW YORK 9/16/2008, Intercounty Judicial wilt receive a Corlilicalo of Piainlilt'sSale enteredInIhe aboVe AS TRUSTEE FOR THEert'i Is altered 'as Is, with nogaged real eslale is improvedSalesCorporationwIllon Sote tIraI will entitle the pur-& ASSOCIATES, causo un January 21, 2009, anthe sole. The properly wIll HOLDERSexpress or Implied warran-wilh a dwellIng. TIro propertyMonday, AprIl 6, 2009, at tho chaser lo a deed la the realAtlorneys, One North Dear- NOT bis open for inspectionCERTIFICATE lles and wilhoul any repro-will NOT be open for Inspec- Sulle 1300,agonI al TIre Judicial Solesand plalntrll makes no repro-CWALT, IN ALTERNATIVE heur el 11 am. In theIr of lico estate aller confIrmatIon ofborn SIrcol Corporallon will al 10:30 AM TRUST 2006-OCBsentatlon as fo tIre qualily oflion. The Iudgment amountal 125 West Madison Slreol, thy sale. TIrO properly wilCHICAGO, IL 60602. Tel No. offIcescntallan as lo Ihn condtllOnLOAN tIlle or re'ourso ta PlalnlItf.was $362,190.74.Sale lernis: (352) 476-5500. Please roter Ioon AprIl 23, 2009, aI tIro of lire properly- ProspectivaMORTGAGE PASS- 5uite iSBA, Chicago, Illinois, NOT be open for Inspection of The Judicial Sales CorPo-bidders are admonished laTHROUGH CERTIFICATE,Praspeclive bidders uro od-10% el successful bld Immecli-sell lo the highest bidder for xliii plaintIff makes no repre-file number PA080I1SS. THE PlaintlItmanishod Io bYlaw the courtotely al conclusion of auctIon,cash, Ihe lollowlng doscribnd JUDICIAL SALES CORPO-rallan,One South Wackerdreck lIre caurI tIle Io verifySERIES 2006-OCO, balance by noon lIre noxl bust- io n e e r t o C a I. C O mI m o n s t e r Setitoliorr as lo lIre condition Drive - 24115 Floor, CHICAGO,all intorreallOn. If this prop-V. PALLAGE ROHANAfile la verify all Inlormalion. property: ?.I.N. 10-25-405-078- p ut tire Properly. ProspectiveRATION One SouEs WackerIL, 60606. sell al public auc- JAVATILAKE NKJAFor information; Sale Clerk,ness day. bohh by cashier'i1009. Commonly known as bidders aro admonished laDrive, 24th Floor, Chicago, IL erty Is a condominium uniI, FIsher arid Shapiro, 4201 Lakecherks; arid Iru refunds. The lion Io lire Irlgtiesl bidder, as111e purchaser elItre unit atPALLAGE ROHONA 5001 MadIson 51ro-rl, UnIt 2-F, choclo tIre court filo la verily60606-4650 (312) 236-SALE JAYATILAKE; MARLENACook Rd., Ist lIcor,sale shall be sublecl lo oener-Skokle,IL60077.TIraIns- 1165410 sel torIlS below, lIre followinglIretoroclesuro sale,oIlier Illinois 60062.al real estate laxes, special cul Irrtormolian.I f this prop- described real estate: P. MARSHALL; MORT-Norltibrook, provonreril on the properly erty is o condominium unit, Published Irr PIoneer press 8535tIran a morlliaoee shall pay (64?) 490-9990, betWeen 1:00laxes,specialassessrr.enls, r) C CommOfliC known 05 the assessmerrls and lIre legalGAGE ELECTRONIC REG- specIal taxes levIed, and su-consists cf a condominIum lire purchoser al lIre unII at3/12, W19, 2MW (14750 CRAWFORD AVENUE, ISTRATION SYSTEMS,p.m. and 3:00 p.m. weekdays resldenco. TIse purchaser at w. T,,wro.urO saie,orner fees reaulr' by The Condo. only. 1154499 SKOKIE, IL 60076 ProperlrrrinlUmProperlyAct, 765INC., AS NOMINEE FOR Ihe unit other than a morlga- Ilion a mortgaçreo shall pay indesNO.i022.212-055000 GREENPOINT MORTGAGE Published In PIoneer Press c_leo shall pay the assessmenls Iliv assessments and Iho legai 6n ai INC.; liN- ;w5, 31t2. 3/19/09 (1674076) C Ices required by The Condo- Tire real eslato is improved FUNDING, Pioneer CIosoied isiht psce Ioyou wills a singlo familyrosi- rrrrirlumProperly Act,765 Thur80d,Wd1A5E891911It± iUoUAo,blbti'ENOIWSI.UERS OUbnOaÙ006(r3 ucoumS Homo A15iooeeoPrPosublieolipol,Qst) EPIOT (i000. o0PO ThuiodaySlSono)oj0 200911 wolIo)011eUrI500I,0000 u000niod Repon gogo.H000mod 0001e Sold by loe Solo Legol ORoliodo SOSA AoOOIOOd Nomo MorkoT;oI000 735. Genoge, Pord pioneer 695.200410001 50100 570700Mori Reggo Soleo classified GREAI DEALS o 0'," l,,ogll1010100 ON WHEELS loin 50,000 lIcolWog Mna0Sll010 er OSo,,...... 00000 1000e Co pOCEIr Cono ogu0 ou000a pIbe 7000 0000 30 VOAOOT 'Terge ooIIO1r'0010007140g' 0 p{eoIopoy 9058- 6080moa 540000 705- PoPo ond c9',!3rrih7 o iQ n000ee A1o0ko0 O,en 111,10 00000 00h1d10° 10002, 11.006 Cl 10051'Eeo, AdveRtise 00k11100 Moo ti IO O - - VloiOO loIrA-S'ocre 24/7 U000 24/7 O 11101 10°!TTT.L°TOI0rEn 1,010100V! Srcolloor0 5l,00kroO Sm01nIl,0Coot 755- Mieonlloneogo gooll o op Copeo/o 1101 sol0000g 1nS°.lo,IooToiO 001100 Eon, l,o,oroloon WIoit010l,dlOhir1000lndtOl SloT .I1I07 (8 IO. 0110ynrP10000 PIONEEJLFRESS li3OOIkOlIiI0 0?001t00b00P05 P10NEERf lISIO 110001W

8111go Basiito 0000 Soo,o10100l000 8111go On bobo1 0,10 o Iv 000 Eolio Loli Too: 0100000 o Ile poe b yo.! 000010CC 8on Ian Sole co I 100011,0 CrIollo Woe PoPOI 000 olio Clogloiol000000 TO&Il0bU5005000 ILLINOIS CLASSIFIED ADVERTISiNG NETWORK log T001100500 ,.000.00lOyIlOk00000 0.0011,5000 IOEODPIIEON CLASSIC/ HELP URANIAS tIpo ollo C000P0110I0P0 ANTIQUE COINS 8oO lOE 0000 noh0P 000, 000o 0)1 Ii locO Str00000S 'Fp000IO 000e LiOn pTog.oriOle 0000 TO000Pgo ollO.0000. X0' NIPONA OPIO OURS I000001F.iI.lIOI100 loll, 0000000E 001 Gp010ol A VE ATO 15 110 WE 0500IODDOnCE 708 Uooliq000& I 00P000P014 n NELA WASTED Coogliolo 000000l01000 ArI 110000 Our KNIFE E 0W DRIVERS S loo/ollO

r0000LL So.EO. fi,utomotive .....0.000kT 00,10000 ¿00 0000000. A'e.U/. 00001 11' 00 000010100 Braco o00og,00570fb.0001bM01b00 Sechon hasthe 0n8'IO 001011000)1 O'ooIloOOlOO 707. Aoolion Soleo °4°o°° 000 T POOP' 8(000 I gV Il L ALT IOU ES lE VEN T S ANTIQUE 00, 011 00, o.,.onlol.ogoT FIT ER lIlA L 11000001 Mollo0 TAU RELIEF AU CT IO 141 Cor you oie poOloCodIr ClorO1 PIO_o 0ol0Gl0dI0booO°'ptIo00PbO POOIlt000lO p100000 P1000 APIOlO_O NUOTI £i11Lii rzroLtTin!lbTbObOIL..." 00000100 00,100 7010,0100 looking for. 0010E 01110000' 0,000 000,lO,0f o00p0go0l0oçu .000 01000 001' llo,00000o'Foobolo 1 001111 000',, 0,000000000 700-WClodNOOp lOO

Buying or o Sooglo0000l Looe00Pt 'TITLU.UiIilTii.R,O.UillD Goy 111000 010000 AUTO 01 TEILES WORN I EU Selling, 01,1100 Soro CoIIon00000 001 LOIS ron IDol r FI00100Cl0000bOl rolo 50.1.11 00

Pioneer p11001000 0.lbpoolY'boNI.

Cl000IOlolO T.1010005000010 Buying or 734 Haien Soleo, Classified TIoil00011000100 OOrt8 1119 BACO TUOENI Ceroleo000l Selling, 5050 De0p0bmnSP is the place Skokie, IL (047) We TI1SCE LLANEO T S Pioneer 673.7601 SU SIN E T T FOR SALA or Deliver 0PI'ORI USIUbS king or Selling P Il O II O Alo E.0 L75n1008 Classified foc you) PioneerCloesified (2) Results! 947. AUGe Wo PioneerClaee11ied is the place is the plo ce (847) Buying or Selling 4i\ 847-9983400 ethe place folyoUl for yool for youl PioneerCloosif ed (8471 998.3400 p theploce (847) SorineCISsIliTe, (847( The Cools CIa000LoO 0000000g NoyOlohoIlcCCI PIPAdOS P00001 F1000 0110 The Doings All CÔCOTAPO PI Ofloli010l OPPiO 998.3400 Oa of led for youl 10 00001100 In Ills 0001ES. plion, oeIl 100W 011001100112171 247.0700. 9983488 POIS Ponce, PICCO 011/Ui 04:100 10001011000 01001011CC 10110, 1000000IflO Ploano retel TU0000fl0 AIA 0001C000 01100110101000. 998-3400 io Ihn ploon (01youl I II f II 'IIll ° ' - Thurday,mMffl'c.hJlP,2OD' .'1.løo A PioneerPressPub1iCatiOI (»c) wwwpionepr,iocai.cQn) øj î urd,'Mfth'th,'2OO9 twiiórrkctbcÓth A: Pibñêer-PMs.PubilcatiÒñ , (ñc 1053- Neme Change lolo- Auctions 1013- BIcI Notices 1013- Bld Notices I 031 - Foreclosures 1046- Liens job- AUCtIOnS lolo. Auctions lolo- Auctlon8 lolo- Auctions lolo,- Auctions lolo- Auctions Bide taken only for each unitUltra Enterpriues tien we obtain will be used for PUBLIC LIEN SALE Sto000t Illinois Buying or Selling, Buying or Selling, Buying or Selling, Buying or Selling, uoTiCn 0F PUBLICSALEin ifs entirety, Payment mustFull of personal items NOTICETO BIDDERS PARK RIDGE that purpose, lt you prevIous- County of Cook be modo by certIfied check, RECREATION AND PARKlv received a discharge in aThat on 4120f2009, o sale will AT: cash or money order only. NoSpace p63-u Skokie/Marton Grove DISTRICT chapter 7 bonkruptCy caso,be held at 3:110 p.m. at: Grand In theCircull Court for Bng or Buying or Selling, TO 110 HELD School District 69 Cook County, Illinois Buying or Selling, Buying or Selling, Pioneer Classified Pioneer Classified Pioneer Classified Pioneer Classified Storage Centerspersonalchecksaccepted.HadlIeld Sam this should not be canot ruodAuto 8 TrUck Center, 2427 W, PiDneef Coied s theplace foyou! The Lock UP personat items (hereinatler referred to as LEGAL NOTICE os an attempt to hold you per- ChIcago,IL Pioneer Classified 1930 N. Clybeurn ALL aods rnusf be removed the Owner) will receive bids GrandAve., In Ilse Matter of the Pofitlon Pioneer Classified Pioneer Classified from the unIt within 24 hours. sonally liable for the debt, 60612.AIt bide to be in writ- Cl,Icse°' IL 60614 for Paved Ploy Area Expon-Sealed bIds will be receivedPublished In Pioneer Press of is the place ¡s the place 773.755.1900 Payment due Immediately Publiohod in Pioneer Press ing. to sell the following artI- s Ihe place for youl is the place is the place slop tor Madison School untilby the Park RIdge Recreation 3/12, 3/19, 3126.t39(1615t77) C2 KAITLIN MARIE TEKLICS, is the place for youl is the place for youl upon acceptance of bid. UpIt :vt9, 3t269(16761S1)C 10:00 AM local time, on theand Park District, 2701 SIbley cies to enforce a tien exIstIngFor ChanO' at Name DATE: APrii 3rd, 2009 availability subiect to prier under tIne laws at the Stat8 of Bng or 14th, day of April, 2009 at theAvenue, Park RIdge, lIlInoin, Illinois againSt such articles for you! for you! for you! AT: tO:00A.M. settlement of account, telephone 041,692.3482 for sup- Casa Ne. sM3 ISO. Pioneer CJosoed is 3ro poceforyoui for you! District Ottico, 5050 MadIson 1034- FoundatIon for labor, servicesskills or Street, Skokio, IL 60077. ply and installatIon of re- material expended upon or Notice Of PublIcatiOn Bng oc IIïng, Bu1ng orSeing, CONDITIONS: All units willUnit2404 1013- BId Notices placement windows and doors Public Notice is herebY given . highest bidder- Notices storage furnIshed for such or- be ssid to the toll Burrell Bidswillbepubliclyat tue MaIne Park Leisure that on April 30, 2009, being Piopevi Qssiediilhe piste for you1 ceor OsssfedIhe piace for ysul eOth unitFurniture tides al the request of tIse foi- the NOTICE OF PUBLIC SALE (847) (847) Bid, taken only Serpaymenti opened. Center until Monday, Aprii 6, one of the return days In Buying or Selling, Buying or Selling, ils0ntlrety. towing desiUflated person(s).CircuIt Court of tisi countY of . in 2009 at 11:00 am. at whIch PRIVATE FOUNDATION -.--. .rn-h nrttdIS are ri- OF PERSONAL PROPERTY . made by certifiedUnit 2403 LEGAL NOTICE tIme such bIds wIll be public- ANNUAL NOTICE Cook, I will fil. mo' petItion In most or caShJoli Surrell The Bidding Requirements d..n,.d withinthirty(30) Notice Is heroby given thct pursuant to Sctlon 4 of the NOTICEÒF PUBLIC SALE Pioneer Classified Pioneer Classified 998-3400 - 998.-3400 check, money ordercheckl oc.- and Contract Documents arely opened and announced In days of The publicatIon of thIssold court praying for the , only. He persOooi Boxes Sealed bids will be re-on lite 01 the office 0f 11*11* Board Room al the Ad- Pursuant to Section 6104(d) change of mv name frani Sofi-Service Storage FoctHty Act, Stato of lIIInotS, the un- OF PERSONAL PROPERTY ceplod. All gOOdS mustbi re- .ceived by Itt. Park Ridge notice, is the place for youl. Owner, minletrative Offices of theof the Internal Revenu' Code, KAhL-IN MARIE TEKLICS dersigned wilt sell at public calo by coniPCtIIve bidding is the place for youl meved freni tIte unitwithili24finit 0123 Recreation and Park Dis- building located al 2101 Sibleynotice is hereby given that the to that of KAiTt,IN MARIE on March 30. 2009 at 10:40 AM., on the premiso where Notice is hereby given lirat pursuant to Section 4 of the lolo- Auctions -. tiesro. payment diseImrn'dl-Walt ToIson fricO,2701SIbleyPark NAME OF PERSON(S) tal- said property has been stored and which is located at Pub- AUctlon* Contract Documents mayAvenue, Park RIdge, Illinois.annual return for fis. fiscal TODO, pursuant to 11* Self-ServIce Storage Fdciltty Act, State of IllInois, the un- stelY upon occePtaflCOf bid.Boxes, duffel iag$, TV, misc. Ride., IllInois, telephone The successful bidder shotyear ending Octebir 31 201* ut, in sudi ca made and lic Storage, PS Orange Co., 5ß38 N. Pulaski Chicago, liii- dersigned will seit at public sale by competitive bidding sublect to 847492.3482 tor Swimming be obtained only by Bidding gyd'-gt & Investment . 1)011 OV0lI0 Contractors at tise office ofand all subcontractors sisalof the LOUISE CATHEkINE provIded. nois 6O6t6 the personal property described below, in the on March1, 2009, at 11:00.M., on the premiso whore NOTICEOFPUBLICSALEOF . NOTICE OF PUBLIC SALE account. Pool Chal.. Lounge Corp IJnit4Ol . prior settlement of Publishid In PIo.r Pmi the Owner after 10:00 AM onbe required to pay the generalSCHUCHENMA1ER AND matters of: said property has been Stored, and which are located at PERSONAL PROPERTY 12, icm (1675262)C Chairs itt Park Ridge, liti- PublIc Slorage, 947 W. Van Euren St,, Chicago, IL 68607, BE HELD AT: Ryszard ZbawlonV March 24, 2OO, by a nao,-prevatllng rats of wog.s InOTIION HENRY OCHSNER iDESCRIPTION OF Dotld 0$ RollinS MiOdOW -ro Space heaters, Unit 2213 poli untIl Monday, April 6,refundabledepositinthethe locality for each craft orFOUNDATION, a privat. IllInois, MardI 10, 2009. Space IOccupant Contents Phone 3tZr42i.0049, fax i2-563.1Q65. . Notice in hereby given that purSUant to Section 1 ortho THE LOCK UP STORAGE tabl sow 2009 at 2:00 OJos., al which ARTICLE A79 Hector Cortex Boxes, bags, toles ecatotding,laddqra,small Deanna BOnOS forni of a check or cash in oc-tipe of worker or mechanicfoundatIon, is available al Th.210e ToyotO Scion 'VC Self-Service Storage Facility Act, Stato of lilinols, thof PS 3366r, KEDZIE stsepvac Choir, nulfc°°°, boxes.disk NOTICE OF time auch bids will be pub-cordance witt, the followingneeded to execut. the con-foundations principal offkl Keith, Marie Teklice A298 Steve Eautlto Bags, dressers toys SPACE OCCUPANT ' CONTENTS OrangeCo, will conduct said,) bI' competitive biddlnb On CHICAGO, iL6O618. PUBLIC SALE OF Dcivopened andon- tract or pertorm the woric. for inspection during regularJTK0E1113400S461# signature of petitioner B005 Paul Orlando Toys tools, books, 0663 ' John Padmerò , Boxes March 31 2009 al 10:30 am, On tho premisos where said DATE: March 26, 2009 PERSONAL PROPERTY nounc.din tIle Board of Sp.citicatiofsl ore available bikes. 0018 'Vincent Yarbóugh BoxeO, ciolhes property Itas boon oteros!, and which are located et Public BEG1NSAT; 10:00A.M. Unit 405 Unit #3025 s1 for each set so oö' business haut-s by any citizenAMOUNT: *1O1I1.1S PatrIcIo Higueras Lone BeI50fl t,,.Main. Park Leisure tain.d up to 2 eels. at tisi above address, who requests lt wlttin 110 pubilsMd In PIoneer Prise O17 Patria Adora Cando Totes, lays bed 0504 Dentro Newngn . Electronics Storage ¡05223, at 945 Rohlwing Read, Rol ng Meadowo, lamps, C,nt.r, 2701 Sibley Av.- night stand 0667 Paul Norris Boxes Chairs, lots of plastic totes, Leather turnifl', N0UC. Is hereby given tttaf clays after lb. date of ThIs PublIshed in pioneer Press ai9, 356. 4f2109 (1671634) C . Illinois 60008, the personal property descr bed below. In CONDITIONS: All units will hutch, bakers rack, oreo rue,puriuont to Section 4 of The nu., Park Ridge, Illingls . . E, Additional ests of ContractBoard of Park publication. Thi foundation's 0431 . Daniel Thomas Bedding themattersof: . TV 12. , :vm, (161590')C2 be eld to.lho hghvstbidde, solo table 5.11-Service Starai. Facility SpecificatIons are avallo- Documents may b. obtainedCommissIoners prIncipal office i, located al Purchases Musi Be Mode With Cash Only And Paid For 0551 Vsnkeshct Brown Boxas, bags Bids token only fo,' each Uttit of Ilitnois, IM un- bi. al 119 aboys address. MarquardtDrive, Al The Time Of Sale All Goods Aro Sold As lo And Must Unit Naine Contents O#liroly.' Payment mustUnit 2354 Act, $tOt al a cost of $2000 per set, notDick Barton, President 246 E. Commission In ll Orlando Juan Carleo Unit #3224 d.rsienid will sell at o public however such Wheeling, IL O1*O. 'The prisi' PUBLIC LIEN SAL-E loso- Plan Be Removed Al The Time Of Purchase. Salo is Subleci To Purchaseú must be modO wHir cash only and paid foral 1021 MacMechanical Toots be modo by certified check or retundabtei is Adiouroment. the timo olsaio. Ait goods are sold as Is and must be ro- Cherrydrosser,smellair Jay Bredon iakt by competitive biddIng Board Of Park sets must be returned to thePublished In Pioneer Press dentofthe foundation . a zonlngHisdngs 4046 Magnty Cortes Hernandez Crib, totes, & toy money order only. No ttprsen- CisItles LUgUO09. printer. on: 43l2O0at 4:00 p.m. On Commissioners 'l99fl678353)C Ottcon Henry OChSI*r II, Tel.-'-I'-.. ¿rnn. a saI. wIll moved at the tIme of he purchase. Salo is subioct to 6036 CDC Nome Improvement Dresser & doors ai checks or costi accept ed,conditioner, two TV's, small Dick Barton, President Owner. ci:a Pouls Published In Pioneer Press adiournmnt, , radio plastic lime tile premie' wiser. said prop- No. B47-465-e2l' 7054 Scott Mills Golf clubs & boxes All goods must be removed et-IV liai be*n stored, and F, Deposit checks shall be Priclelon Aut6 sody. 35)1 N LEGAL NOTICE OF a,12. V19109 (1676515)C from fho unit wIthin 24 hourd, Published in Pioneer Cbicogo,It, Publishird in Pioneer Press Purchases must be modo with cash or credit card only U nit 21 63 pubtishOd In Pioneer press which are located at Public made payable to /s/Othon H. ocissner Il Harlem Av.., PUBLIC NEARING Payment due imniedlotoly 2/12,3/19/09 (1614940) C FOSTER- Press SkoklWMortofl Grove School1031- ForeclosUres ¿0634. AIl bids to bi In wrIt- 2/12, 3/19/129 (1675651)C and paid for al the timo of solo. Ail goode are sold os Is upon acceptance of bid. UnItAlisto Weed Flooring Storoee Ing. to sell 11* follawine orti' and must be removed at the time et purchase. Soie is sub- Table saw, a box and mIsc, RAVENSW000 SELF- District 69 published In Pionier PreSs Skokie Temporary lonino ava lability subiect to priorlimos STORAGE LLC, 100 W.L__ 3/l910J9 (1678311) C dei to enforce a lien .xlstlngCommission, Thursday, NOTICE OF PÚBLIC SALE led to adlournmont. self ement of accounl. NOTICE OF PUBLIC SALE CHICAGO u:ider its' laws of the Statt ofMarch 26, 2009, Village 01 OF PERSONAL PROPERTY FOSTER AVE., CHICAGO, All bids must be accampo- Illinois against such articles NOTICE OF PUBLIC SALE OF PERSONAL PublIshed in Pioneer Press PLACE: The Lock UP SelfIL 60640.773-561-5003. The nied by a Bid Security in the STATE OF WISCONSIN PUBLIC NOTICE Skokie, 5127 Qatotosi Street UnIf43P Published In Pioneer Prose personal property la descri- form of Certitled Check or CIRCUIT COURT for labor, serViCil skills or0-kohle, Illinois filou. at 1:30 Notice io hereby given that pursuant to Sectlo4 of the PROPERTY 3112, 3/19/09 (1674515) C NormO Royos Storoge Costero WALWORTH COUNTY material expended upon or consider the Self-Service Slorage Facility Act, State of Illinois, the un- ., 3/12,V19109 (1676500) C bed beioW, in the matters of: Bld Bond In the amount of Tise annual report of The P.M., fo Wooden chairs,fabIo,coy- 2525 W. Armilage 10% of the Bid modo payebloPUBLICATION SUMMONS storage furnished for such ar-following: dersiçsned will sell at public sate by competItive bidding Notice is hereby given that pursuant lo Section 4 of the cred furniture, dinIng tablo Chicago, IL 60Ml Cats NO, Se-CV4Ie9 Thomas A. Keoyumiian Pam-fictos at the request of Ilse fol- NEW on March 30, 2OO, al fl:OO AM., on the premise where Soll-Service Storage Facility Act, Stato of Illinois, the un- DATE : March 31, 2009 Space #840 to the Owner. ily Foundation is available forlowIng designated person(s), said property has been stored, and which aro located at dersigned will sell at pubiic soie by competitive bidding NOTICE OF PUBLIC SALE OF PERSONAL Bennett Jackson Buying or Tise Honorable at the address 2159-ST - New ResIdinlIal TIME: 10:00a.m. The Owner reserves the Robert J. Kennedy inspection unless such articles are re- Zoninf DIstrIct Public Storage/PS Orange Co., 916 N Elston, Chicago I L on: March 30, 2009 at 12:00 p.m. On Iho promise where PROPERTY Lot ot containers CaseCode3OO4 noltt below during normaldeemed withinthirty(30) 60642. Phone 773-227-3114, forc 773-227-3253. sold property has been stored and which are iocotod at CONDITIONS: All units wilt right to relect any and ail business hours by any citizen The Temporary Zoning Corn- bids, to waive any informali- (Foreclosure of Mortgage) days Of the publicatiefl of thismission requests a revioW of Public Storage, Property # 09067, 1711 W Fullerton, Chi. Notice Is hereby given that pursuant to Section 4 of the NOTICE OF PUBLIC SALE be sold to the highest bidder.Spaco#1008 Book of America, National who so requests within180notice. SPACE 'OCCUPANT CONTENTS cago, IL 60614, Phone: 773-525-5518, Fax: 773-248-3702, The Self-Service Storage FacilIty Act, State of illinois, the un- OF PERSONAL PROPERTY fies in bIdding, or accept the ofthis draft ordinance amendments bld that, In his opinion, willAsociatIofl as successor by days after pubIicolion creating a new resIdential A188 Constance Caror Sofa, bicycle person property described below, in the matter of: dersigned will sell at public sole by competitive bidding Selling, merger to LaSaile Bank Na- notIce at ifsavailability. NAME OF PERSON(S) zoning district from the R4 A454 Jason Mozydla Boxes 20, sofa on March 31, 2009 at 10:20 am. on the premie where sold NotIce Is hereby given that purcuant to Section 4 of NOTICE OF PUBLIC SALE OF serve his best interacts, The Thomas A. Kooyumiian tlonal AssocIation, 05 Trustee 44 ParkFred G. Habib General and R5 Elderly and A487 Chris Weller Computer, TV SpacO Name Contents property has been stored, and which are iocatod at Public the Self.Servlco Storage FacIlIty Act, Stato of Illinois, the PERSONAL PROPERTY for Cerlilicatehoiders of Beer FamilY Foundation, Lisa D. Reed Disabled Housing rosidential portable 1007 Toyno Hunter Boxes, drums Storago,PS Orange Co. 5733 North Broadway St., Chica- undersigned will sell at publIc salo by competitIva bidding 1. This notice is written in the Ridge, IL nomo of the Owner. Steqrns Asset Backed Socuri- Lone, #325, Park DC Fin Svcs Amer LLC dietricts In Sector A and relat- A504 RooKeidro Wright Mattress 2085 Robyn Audla Computer, sewing go, IL 60660-4301, the personal property described below. en March 30, 2009 et 10:00 orn. on the promise Whore said Notice is hereby given that pursuant te Section4 of the lles i LLC, Asset-Backed Cer- 60068. Nick Wonko ed chanQes to other resIden- Co&4 Janet Cavallero Mattress, kitchen machino in the matters et: property has been stored, and which are located at PublIc Soit-ServIce Storage Facility Act, Stato of Illinois, the un- tlttcatos, Serios 2007-HE2, 800 TIse Princlpai Manager is liai districts or other sectIons table 2163 Elizabeth Nowtsoil Boxes, microwave, bidding Pioneer By: Dr. Crystal LeRoy BypaSs, Tony T. Kooyunhilofl, Presi- Storage 4072 N. Broadway, Chicogo, Illinois 60613, the per- dorelened will soll at public sale by competitive Business Manager Stale HIghway 121 DESCRIPTION OF of Chapter 118, ZonIng, of the C143 Rachel Sierra Bags ro, toys vacuum SPACE OCCUPANT CONTENTS sanaI property descrIbed below. In the matters of: en Morch 31, 2009,at 10:30 am. on the promise where 75062-4180, dent. The Secretary's tele-ARTICLE 0639 Giancaria Scalzittl-Acovedo 3162 John Carcorano 0019 Bags, totes, located at Skokie/Morton Grove SchoolLowlsviliO, TX 823,3225. Village Code, consistent with Carpet cleaning, StrIckland Jeffrey said prspertv has boon stored, and which ara Plaintiff VS. Rachel Roca and phono number is 641. 21106 Chrysler Sebringthe ComPrehensive Plan of Boxes 5, bags 5 supplies suitcase Space Occupant Cent ents Chicago, IL DistrIct 69 Public Storage/ PS Orange Ca., 1129 N. Wells, 5050 Madison Street John Doe RocO, 1922 Howe Touring Skoicie,Illinois with special 0642 Matthew Calvin Boxes 5, computer 4067 Stephen Josephson Ladder, boxes, 0059 Vanteur Phlllip Stoat, boxes A060 VIctoria McCarthy Boxes, totes, sofa 60610 Ilse personal property describedbelow, in the mal- Street, Unit 2-F, Chicago, iL I'ubllshOd in Pioneer Press 1C3EL.56R96N158983 emphasis an the 2020 Plan tor 0778 Samanlha McCoy Mattress, clothes cabinet 0264 Larooso Lozoro Computer, tisti 0040 Eric Cerbott Bags, boxes Skokle, IL 60077 3/19/09 (1611161) C tors of: Classified 847-67-7666x1035 60614, Defendants. Sector A: Downtown- 4122 Evelyn Grlffiths Boxes, clothes tank, totes 0044 Richard Johnson Totos, vacuum THE STATE OP WISCONSIN AMOUNT: $10459.41 FOR YOUR INFoRMA' Purchases must be made wIth cash oniy and paid forai 0276 Jackson, MIchael Boxes, bogs 0086 Kenneth Jomes Boxes, mattress, OCCUPANT CONTENTS To cods person named above Pionsandrelated the time at saie. Ali goods are sold as is and must bo re- Purchases must be made with cash enly and paid for al 0299 Kirkenclatl Kenny Chairoffice, totes drosser SPACE PublIshed InPloneer Press Published In Pionoor Pross T1ON: A022 UnIted Kenyans of Chgo NFP 2/t9/s9 (16784251 C as a defendant: You are here-1046- Liens documents are avaIlable at moved at the time et the purchase. Sale is sublect to the limo of sote. Alt goods aro sold os is and must be re 0370 Jones, Perklor Books, suitcase, Bill Vernia telfersen Bags, toles, 0v Shelves, boxas, totos by nolilled that the plaIntiff 3/19, 3/26, 4Th09 (l677090)C2 tho Village's Conimuflify De- adIoornmenl, moved at the timo el purchase, Soteissubiectto toles CO52 Timothy Brugeer Toles, albums Boxes, mIrror, odlournmont. A529 Andrea M. MIller-Finch is the place named aboco has flied o law- velopment Deportment' Plan- 0080 Remilokin Bologun Boxes, bago, couch suiterotherlegalaction PUBLIC LIEN SALE PUBLIC LIEN SALE nine Division, (847) 933-8447 Published in Pioneer Press Purchases must be made with cash only and pold forai computer Boxes, bIcycle agaInst you, Within 40 dos's Friday, 12, 19/O9 (1675631)C Pubiisheri In Pioneer Press tt,o timo at sale. Ail goads oro sold os is and must be re- 0056 Jaquoline Carter Monday through E053 Ralph VIsto Bags, boxes Jason Dowdy Mattress, table, Buying or Selling, aller March 12.2009, youThat on 4,'2012009, a sale wIllThat en 4127/2009, 0 sale wIllfrom 6:30 AM ta 5:00 PM. 3/i2, 3/19/09 (1675611IC moved at the time ofpurchase. Sale Issubiect to Bono lamp must respond wIlts a wrItten at: adiournmant. be held of 3:00 p.m. be held at 3:00 p.m.al: SPECIAL AID: AvaIlable Purchases must be made s'lIti cash only and paId for Rich Costa Boxes, shelving, demand far a copy of the corn-Grand Auto 8, Truck Center,Champion Cycle Center, 3625upen request for the disabled. at the time et sale. All goods are sold as is and must be re- C277 bed frame for you! plaInt. The demand rnust be2427 W. Grand Ave. Chicago, 673-0500 or TOD NOTICE OF PUBLIC SALE OF Published in Pioneer Press Pioneer Classified N Western Ave., Chicago, ILCoilf847) moved at Ihe fimo of purchase. SateIssubloct to Vlcki Woiklns Drosser, clothIng, sent or delIvered lo tho court,IL 60612. AIl bIds to lie In writ-60618. AlI bids to be In writ-(847) 933-8455. PERSONAL PROPERTY NOTICE OF PUBLIC SALE OF 3/12, 3/19/09 1167559t)C adleurnment. osov suitcase . Whose address 15 Walworthing. to seil the toiiowlng arti-Ing, to sell the followIng orti- Interested parties are InviI- PERSONAL PROPERTY Recorde, clothes E625 Wesley Losan is the place County Judicial Center 1800clos to enforce a lIen existingcIes to eniorce a lien exIstingod to attend this meeting. Notice Is hereby given that pursuost to Section 4 at the PublIshed by Pioneer Prose County Hwy NU, Elkhorn, WIunder the laws of Ihe State 01undOr fha lows el the Stole ofThis notice Is far informatIon Seit-Service Storage Facility Act Stateot illinois, that the NotIce lo hereby given that pursuant to Section 4 of the 3(12,3119Ñ9/O?li676l62)C Purchases Must Be Modo With Cash Only AndPaid For 53121, and to GRAY S, ASSO-IllInois agaInst such articlesIllinois against such articlespurposes only. undersigned will sell at public saio by competitive biddiop Self-Service Storage Facility Act, Stato of Illinois, the un- NOTICE OF PUBLIC SALE M The TImO Of Sale. All Goods Are Sold Asis And Must dATES, L.L.t'., plalntIff'sat-for tabor, services, shills orfor labor, services, skills or on March 30, 2009 at 10:30 am. On the premises where dorsigned will sell at public sale by competitive bidding OF PERSONAL PROPERTY BoRemoved At The Time Of Purchase, Sole Is Subiect To for you! tornes', whose address is 600materIal expended upon ormaterial expended upon orPoter NIcholas, Chairman said property has been stated, and which are tocaled al on March 30, 2009 at I :00 P.M. en the premiso whore said (847) storage furnished for ouch or- Adiournmenl, North BrootWay. Suite 300, storage furnlehed for such or- Public Storage/PS OrgangCa, 2213 N. Rond Rd., Paia- property has been Stored, and which Is located at Public Notice is herebygiven that pursuant fo Section 4 of the NOTICE OF PUBLIC SALE MIlwaukee, WI 53202. Youtides at the request al the fol-tIdes at the request al the fol- Published in PIoneer Press line, IL 60074, the persoriai property described below. In Storage, 4430 N. Clark. ChIcago, IL, the personal proper- SeIfService Slorage Facility Act, State of I lilnsis, the un- OF PERSONAL PROPERTY may have an attorney help ortowIng designated peroonlo), the matters of: ty described below. In the matters of: PublIshed In PIoneer Press lowing designated person(s), :V)9/09 H678389)C dorsigned, PS Orange Co.,will sell al public sale an 3/12, 3119/09 (l675630)C (847) represent you. lt you do notunless such adictos aro re-unless such articles are re- MarcI, 30, 2009 at 10:30 AM. on the premIse where sold Notice is hereby gIven that pursuant to Section 4 of the demand a copy of the corn-deemed withinthirtY(30)doomed withinthirty(30) Space Occupant Contents SPACE NAME CONTENTS property has been stored, and whIch are located at Public Self-Service Storage Facility Act, Stole of IllInois, the un- 998-3400 plaint withIn40 days, thedays 01 the publicatIon of thIsdays of the publication al thIs LEGAL NOTICE OF 1127 Christy Jenoby Totos, toys Ae67 Lisa Wollenstein Boxes, toles Storage/PS Orange Co., 6460 N. Lincoln Ave., LIncoln- dersigned will sell at public sale by competitive bidding 998-3400 court may grant ludementnotIce. PUBLIC MEETING 1134 Bryan Kuika Cabinets, bike, A032 Andrew Oront Clothing, wood, IL 60712 the personol properly described below, In on March 31, 2009,at 10:00 AM., on the premise where agalnsf you tar tile award at notice. furniture electronics the matters of: said property has boon stored, and which are located at NOTICEOF PUBLIC SALE money or other legal actionNAME OF PERSON(S) The Village of Skokie Sus- t 336 Scolt Mason Ao61 Tanya Wosby NAME OF PERSON(S) Kitchen chair, Boxee, bogs Public Storage/PS Orango Co., 362 W. Chicago Ave., ChI- OF PERSONAL PROPERTY requested In the complaint,Gustavo Lapez Berta A Aldana tamable Environmental Advl- shelving, toys Cova Karen Ixtiibashi Suitcase, lolos S2aco I Occupant Contents cago, t L 60054, Phono 312-266-0174, tax 312-266-0179. and you may lone your rIghtOverland Bond 8 Investment san' Commission will hold a 3035 Bernie O'NoiI Couch, mattress, Ct33 Rosie Jones Bags, boxes 1075 Sauganash Health Nolice Is hereby given that pursuant to Section 4 of the ConOSco Finance Servlclng to obloct to anythIng that is orCorp Dean Rivas meeting on Tuesday, March furniture Ci40 Carmen Heiazt Cloting, radio Associates Boxes, totes SPACE OCCUPANT CONTENTS Soit-Service Storage Facility Act, Sfolo of Illinois, the Un- NOTICEOF PUBLICSALEOF PERSONAL may be incorrect In the cam- 24, 2009, at the Villogo of 3068 Terry Terrez Normsn Blanket, bags, 0001 Evelyn Coldwoit Boxes, furniture 2079 Shown Cosmen Boxes, furnIture, 21101 Evan Lewis Boxes, prinler dorsiened will sell at public soie by competitive bidding PROPERTY plaInt. A iudgment may beDESCRIPTION OF DESCRIPTION OF Skolvie, 5127 Qaklon Street, magazInes 0033 Stephanie Aiwan Totes, electronics lays 2031 Boss ProductIons BIke, shelving, en March 30, 2009 at 12:30 P.NL On the premisowherO said Council Chambers, Skokie, Il- Public 4 of the enforced as provided by law.ARTICLE ARTICI-E 3079 MPhohlele Moruthane Trophies, taddor, D034 William J. Debeoubarnais 3020 Joseph Jockson Boxes. furniture file prsperty has been stored, and which are located at Notice is hereby given that pursuant to Section A ludgmont awarding money2006 Toyota Scion IC linols 600T/, at 7:30 P.M. mattress Bedding, boxes 4039 James Cabio Boxes IL tho un- 2000 Honda 2046 David Barklow Boxes, bags Slorsgo/PS OrangeCo., 2835 N. Western Ave,, ChIcago, Self-ServIce Storage FacIlity Act, Stato o? Illinois, may become a lIen againstJTKDE171560086676 JH2RC4.408YM200085 4017 Leslie Nuslodl Furniture, mattress, 0038 Kathleen Cashmon Table, motlress 4062 EdIth Ccilamarca Boxes, furniture, 2056 Symantho Lancaster Clothing, suitcase, 60618 the personal property described below, in the mol- derslgned will sell at public salo bycoroipetitive bidding any real estate you own now NEW lamps D077 Shohon Seboggala beddina bags, boxes vacuum lors ot: en March 30, 2009 at 10:20 g.m.On the promise where said or In the future. and may alsoAMOUNT: $10481.18 AMOUNT: $2987.68 The Village of Skokio Sus- 0170 Enri Sell TV, bags 4173 Asim All Boxes 30es Cassi Olson Boses, beddIng, property has been stored, and which arelocated at Public be enforced by garnishment tamable EnvIronmental Advi- Purchases must be made with cah only and paid for at 5005 NIna Scott Boses, furniture furniture Unit Name Contents #08062, 3501 W.Touhy Ave., or seizure el property, Published in Pioneer Press sory Commission appoInted the Ilmo of sale. All goods are sold as Is and must be re- Purchoses must be made with cash only and poid for al 5050 Daniel Godinez Boxes, lolos Storage, property Published in PIoneer Press 4137 Mildred Pheoton Bags, clothing, oeM Elsa Jacobson Boxes, pictures LinCoInWOOd, IL 60/12. The personal propertyis descrIbed WillIam N. Fosliog, 5F12, 3/19, 3,026109 (1616321)C2 5'19, 306, 4(2/09 (1671092) CO by the Mayar, will conduct a moved at the limp of purchase. Sale is sublect lo the time of sale, Ali goods are sold as is and must be ro- 6069 Nicole Whorlt Boxes Mattress, boxes suitcase 5550 HarrIson Parham below. In the matters of: Stale Bar No, 1020417 meeting an Tuesday, March acjlournment, moved althe time ofpurchase. Saie is subiect lo 6086 Anlhony Hill Talco 6029 Dennis Ishiboshi Boxes, bags dresxer Altorneys tor Plaintill 24, 2009, In the Council Cham- adiournrnenl. 6080 Carmen Alicia Bags, tetes, 0694 Leticia Diaz Bicycle, dresser, Occupant Contents GRAY & A5,SOCIATES, bereofVIllageHall,5127 Pubtished in Pioneer Press Purchases Must Be Made With Cash Only And Paid For suItcase T.V. Space I Bago, blcyClo,bOxeS, 1O53-NameChSII Published by Pioneer Press At The Timo Of Sale. Ali Goods Are Sold As is And Must 1005 Ixobello Kumon L.L.P. Ookten Street, Skohie, Illinais 3/12,3/19/09 (1674520) C o) t9 Karen Rudolph Boxes, drosser, floor lamp, Dated: March 4, 2009. Pur- 60011. The meeting will cam- 3/12, 3/19/09 i1674541)C Bo Removed Al The Time 01 Purchase. Saio is Subiect To Purchases must be made wilt, cash only and paid for at tofos table lamp, totes mence at 7:30 PM. The Corn- Adiourrlment. suant fa the Fair Debt Coilec- Buying or Staleot IllinoIs tIse Ilmo of sale. All goeds are sold os is and must be re- 0124 Krlstslo Davis Headboard, boxas, Richard Prucnal FilIng cabinets, lIon Practices Act (15 U.S.C. mission wIll discuss a peton- moved at the tImo et the purchase. Sale Is subiect lo couch 1071 ' shelving, totes County of Cook liai prolect for the recycling NOTICE OF PUBLIC SALE OF Published isv Pioneer Press adiournment. SectIon 1692), weare required Pioneer Classified 5136 LewIs Sims Bed frame, head Paul Bablarz Boxes, upholstered to stato that we are attempt- In the CircuIt Court far Cookof electronic products. PERSONAL PROPERTY NOTICE OF PUBLIC SALE OF 3112, 3/19109i1675622>C board, drosser 1075 chair, mirrors, Ing to collect a debt on our cii' Published in PIoneer Press is the place for you1 County, IllInoIs PERSONAL PROPERTY 5143 Piazza Bella Boxes, tales totos ent'sbohOlf and any Inlorma- SPECIALAID:Available Notice Is hereby given that pursuant lo SectIon 4 at lhp 3/t2, 2119/09ll675632iC 0179 MamIe Campbell Bags, boxes Ruthann Grilflth MIsc. goods upon ronuest for Ihn disabled. Self-Service Storage Facility Act, State ot Illinois, 11w un- Notice is hereby given that pursuant lo Section 4 of the Bags, boxes 1138 bags, headboard, In the Matter of the PetitIonCall (841) 673-0500 or TOD dersionoct will seit al pubtic sote by compollllve bidding oleo Brenda Anderson 1)6 Darlene Tucker of Sell Storago Facility Act, Stale et Illinois, lite under- NOTICE OF PUBLIC SALE OF PERSONAL PROPERTY 0201 Kyle Horkrlder ChaIr, tamp mattress, dresser (841) 933-8455. on March 31, 2009 al 12:eO P.M. on the premise Where signed will sell at public sale by competitivo bidding en Boxes, suitcase, Misc. gOOdS GREGG STEPHEN 0214 Jazmin Cassio 2117 Vinefa Borsina WEINSTEIN and GAIL said property has been stored, and which aro located at March 30, 2009 al 10:10 A.M. on hie premises where sold Notice is hereby given that pursuant Io Seclion 4 01 Ilse NOTICEOF PUBLIC SALE totes MatfrosO, tool box, NOTICE OF PUBLIC SALE OF Interested parties are inviI- Public Storage, PS Oronge Co., 1414 S. Wabash, Ctilcago, property has been stored, and which are located at Public 2175 Cristiati lanculoscu LESLIE WEINSTEIN, Seit-Service Storage FacilIty Act State of Illinois, Ilse un- Oto PERSONAL PROPERTY 0249 Carrie Lee Kitchen chaIr, totes PERSONAL PROPERTY ed to attend this meeting- IL 60605 tise personal property described below. In the Slorago'PS OrangoCo8o5ßMcCormick, Skokie, IL 60076, dersigned, PS Orange Co., will soil al public sais by compel- upholstered chair Bogs, boxes, For Change ot Nomo This notice is for information matters Of: tt,e personal property described below. In the matters 01: Itive bIddIng on March 31, 2009, al 10:10 n.m., on Ilse proni- 2111 Carol Ann Crumblin Section 4 of the Notice is hereby given that pursuant fa Sectlon 4 of the 0270 Robert Zavaral Clothing, table suitcase Notice is hereby gIven that pursuant to Cosi No. 09142 01057G purposes only.Published In Iso where said properly hss been obrad, and which are Io- Soif-Service Storage Facility Act, Stale of Illinois, the un- Boxes, suitc050 Bags, boxes, SeIt-Service Storage FacIlIty Act, Stateot IllinoIs,that PS the Skokie RovieW on March 53-48 Joseph Gorskt 2197 Carol Ann Crumblin NoIice of PublIcation SPACE# OCCUPANT CONTENTS Space Occupant Contents caled ut Public Sbraita, PS Orange Co.,1512 W. Jorvls, dersignod will sell at public sale M'competitive blcldlngon Boxes, clothIng, suitcase competitIvo bidding on 19, 2009. E4Cs95 Camille Moitne Boxes 5414 Ractielt Bannister Orangeco, wIll conduct salo(s) by Public Notice is hereby given .4002 bottyej. Palmer Sofa, TV, boxes, ChIcago, IL 60626, the personal properly described below. March 31, 2009 al 10:00 AM., on the promise where said ironing board BIcycle, boxes March 30, 2009 at 1:00 p.tTi. On fhapremises Whore sold that On April 29, 2009 at 9:00 G6091 Stacoy Houghton Boxes, clothing bags, totes in the mailers of: property hQs been stored, and which oro localod ai Public 3066 Mike McCarthy Bags, box-spring, located at PublIc 0415 Ida Hudson-Howard Baby stroller. fool Amanda Aguero property has been stored, and which are A,M,In Room 204 01theScott Berman, Chairman C2020 BarbOra Samuols Pictures, boxes A06i Tanya Hodges Table, choirs Storage 2101 W. Howard, Chicago, IL 60645, The personal box, tot es 31110 mattress, boxes, Stor000, 108 W. Central Rd., Mf.Prospect, IL ¿0056, the H7094 G. Mgrie Leonor Computer, boxes A064 Jalar Kosary Boxes UnitI Name Contents property dnocribed below, in fIjo matters of: the matters of: Courthouse located at 5600 5435 Jerry Marts Exercise equIpment toys personal property descrIbed below. In Old Orchard Rd., Stcokig, lIlI- Published In Pioneer Prose H71t6 Lisa Lockard Chair, boxes Ao66 Joanne Dotson Soto, table Ola MIldred Wilson Bed tramo, maltroos, ladder, totes Bicycle, boxes, noIe pursuant to a Petition q9/o9 (167B304)C F5099 Maria Simmons Boxes AGiS Eric Farmitant Boxes, lotes dresser, chair UnIt Name Contents 10-48 George Whitlield 0556 Edward Wagner RadIo, T,V. totes Name Contents filed in saId Court as Cas #09 03029 Malttrew Wilkins Vacuum, boxes A097 Keith Salmon Boxes 099 Camelot Realty Ca. 0054 Brown SheIla Boxes, toles Boxes Unit Clothing, suticase, 5527 Joseph Burgos Mattress, boxes, Jocy's Movers TIm T. Laderhotf ¡00 570. G6060 Oulcevlta Edrozo Toles, boxes A152 Chantai Wongang Sofa, labie,chairs dO Nyaniucker Bed box spring, 0089 O'ReIlly Erin J Boxeo, bags tofos 1091 00x05 143 bags prays fer the G6026 Donnoll Samuels Boxos 0002 Cheryl Glaus Mumm Boxes, mattresses, 0114 Boxes 1)00 Joey's Meyers Boxes, furniture, SaId petItIon mattress, sofa, Robertson Kenneth 0567 Randy Zelo Boxes, computer, Boxes Rey VoIdri E4045 Prince Riley Boxes safa dresser 1037 1104 Jocy's Movers 115 chango of our names from Buying or Selling, Kelly Terry Furniture, artwork drosser Joey's Movers Boxes tile cabInets GREGG STEPHEN H7026 Chorltse Williams Books, computer 0013 Francine Phillips ficxex, sofa 152 Patty Burns Floor lamp and boxes 1041 Moore Janlne Totes, furniture Bicycle, speakers, 1110 Misc. goods Bags, furniture, GAIL H7004 Charilse Williams Vacuum, boxeo B022 0569 Michael McCoy 2012 Ann Gaivonl 220 MIchael Talo WEINSTEIN and Pomelo While boxos, totes, table, 249 Touba Seipti Bed box sprIng, 1048 Grace Cheryl Boxeo, furniture vacuum Diony Fernandez Boxes, couch, electronIcs LESLIE WEINSTEIN ta that H7059 Carolyn Day Lamp, boxes shelves mattress, boxes, 1058 Smllh Bobby Furniture BIcycle, boxes,tOOi 2113 love seat Suzanne Efeltlneer Floor lamp, Pioneer Classified H7102 Cheryl Fitzpatrick Bike, boxes COlO Tom Keevors 0619 Juilsso Franco 254 at GREGG STEPHEN WAR- Boxes toles 2114 Gules Molih Totos box Jonie Korras Misc. goods furnIture REN and GAIL LESLIE F5129 Thomos Raglin Boxes, bed DUal Jean Siegmon Boxeo 279 Barringlon Brooks Tool box, bans 2141 Williamson Kierrico 2141 Boxes Boxes, bags, tolas 0073 Bogs 0651 Rosa Lopez Boss, suitcase, tetes Joey's Movers 253 Roger Wlshnelf WARREN pursuant to the Brittany Scay Sofa, boxes D015 Michael iooiikuma Boxes, totes, T.V. 254 ErIc Brown Moitress, clothing, 2157 Bermudez Tanya Boxes, electronics Bicycle, chest of 300e Boses Dean S. Ellensan GMC Truck, white is the place 0006 Tracoy Beverly Toys, vacuum 0071 0663 Janolle Debyoie 2025 Jocy's Movers 417 statute In such case made and Harriet Marquez Boxes, chairs, fotos TV portable 2)63 Carrison Redney Boxes, toles drawers, mIcrowave Asi,lq Ali Samani MIsc. goods WillIam SmIth larson boaf, white C2086 Tarro Adams Furniture, totes Dosa Mark Cannon Boxes, bIke, lobte 267 2192 Boxes 3185 426 Dodge dump truck, provided. Jacqueline Forbes Clothing Humes Doivarino 0666 Boxes, shelvIng, toys Beverly Gardner Ref riOeralor, James Cook 06107 Calleen Harper Furni1ure, totes 0101 Cathy Noreos Boxes 291 Carlos Davis Suitcase, boxes 3022 Elizabeth KennebreW 3024 portable TV. totes, 497 whIle G6047 McKlnzy Ges Boxes, electronIcs SMI IddIo Smllh Bags, boses Dated at Skokle, IllInoIs, Feb- for YOU! Jorrad Coatos Boxes, vacuum 0136 Deborah Young Boxes 255 Angela Hood Totes, ironing board, 3036 Go-Kerl C200t Bremer Eric Boxes, tools 5052 Virgie Wsltofl BIcycle, computer, roars' 23, 2009. Orlando SteWart Boxos, dresser Eats Virginia Gavin Boxes, totes, labIos boxes 3198 Worthy Krishauno Boxes, bags credIt cord only microwave Purchases must be made wIth cash goodsor are seid as is purchases MUSI Be Mode WllhCash Only And Paid For and paid tor at the time et sale. Alt /s/Gregg Slephen Welnstlen Purchases must be made with cash only and paid for at Purchases Must Be Made With Casti Only And Paid For Purct,axos must bo made with casti only and paid for at Purchases Must Be Made With Cash Only And Fold For Goods Are Sold As Is And Must Sale Is sub- the time of saie. All goods ore sold as is and must be re- PUrchases ;Aust Be Made With Cash Only And PaId For Al The TImO Of Sale. Ali and must be removed al the Ilma at purchosO. Gall Leslie Weinstein (847) At The Time Of Solo. All Goods Are Sold As Is And Must the Ilmo of sale, All goods are sold -s is ond must be re- At The Timo Of Sale. All Goods Are Sold As Is And Must BO At The Time 01 Solo. Ail Goods Are Sold As Is And Must Of Purchase. Sole Is Sublect To SIgnature et PetitIoners moved at Iho time at purchase. Saleissubioct lo Be Removed At The Time Of Purchase. Soie Is Subiecl To moved at the time of purchose, Sole Is sublecl lo Removed At The Time Of Purchase. Salo Is Sublect To Be Removed At Clic TIme 10cl tO adiournment. adiournment, Adiournment, OoRemoved At The Time Dt Purchase, Saie Is Sublect To adiournmenl, Adiournmunt. Adiournnient. Adlourflment. Published In Pioneer Press Pubilehed in Pioneer Press 998-3400 3/12, 3/19/09 (1674507)C Published In Pioneer Press Published Ir, Pioneer Press PublIshed by PIoneer Press 5, 2/il. 3/19/09 (1673510) Cl . Published in Pioneer Pres6 Published In PIoneer Press PublIshed In Pioneer Preso l2, 3/19/09 (l672575)C 3/12, 3/19/09 (1676163)C W12,W19839(1675645)C 3/12, 3(19/09 (1676240)C 3/12, 3/19/09 (1675359) C W12,3119/09(1674S36) C r

Thurso5uy,Marth 59, 2009 woow.pioeeerjooul.corn APiseeerPresol'ubsieution(VC)

1066- PublIc NolIc66 1066- PublIc N0tIco 1066- PublIc Notioo 062- Peobuto 1066- Public Nctl000 1006- Public Nolicee 1066-Publio Ncticos Sold by DealerDirectory Pioneer PioneerPress Classified Auto Sold by Sold by Classified HYUNDA Pioneer Pioneer 'LOREN HYUPI(00 04)00 beg 00100,00 Buying or Selling leMON'S Buying or Selling, Buying or Selling, ClassifiedClassified ISolo Slooe (Aol W5 iLlS'51NACURA Ail001oep lIase Sleek,,, lioso Olido CesO MosO Srio ko Q5 POLL The new, unmistakable Audi Pioneer Classified Pioneer Classified Pioneer Classified lloeloesi S000Ioe Coco 011,00001 S100ll0001fosO Coyote Foo Coon 50,PO' The Crossover.j»st Rot Intereseirog Auòi OH AR E ION UN D7A4!1570 02 Vsoioly of lsego .1000 1 IL 4 10 Cc,, oo j, Ti goe 410Coos000joTjgoo Obosllloy Tocos is the place is the place is the place 1,olc,o01000 .l,OkcblO SOollloogi0100J00100boe tlt0o'o50 loocolooe JOE niZZAACORO Alseksc Oeoo 011010 for you! for you! 'IlbojOc Il001uo W0,jOo Booboo l'odootol 00001sI000ThS01c for you1 Sieb SisO Clooe000ko, PATROCIL UTUNDAI0 0000700 l',0000e O'loyoo l°joSloV bbekl,,s lIockkjo Qss00001l000c 1011yloekillO Ql00500ll0000 Vj000o T010ge000s tF3OOG00, (841) (847) (847) Viols '000F) 011o 00 ooOt ro Vo so s MuLLVR6W00DI7h0 ooeWrWro4rnnroo,o 0,00,0e XVI Ao.11oIlojlo You are invited to 998-3400 998-3400 (740 7000006o000 1101 SLol0060000 ggUSA 998-3400 S 1010 cl t 700 p11,110 M000ko,O 5000111.0 CobO 1OOlW05100Lfb50 the Audi 05 0(0(10100 Test Drive Event 0000 ilu licou, Wco 0006 Ike Coo1010 Woo 4106F00000'01rIc00 RIZZA HUMMER Ile pos Klug 001001001 liOpoo Kiosclljolocool Soobloog 1750o OtOIlOIl,l0 04OSWOK1lSY5Obl105l SKOKIE PARK DISTRICT Slooiiog Fis000:,00 SIcoliog Ol100loseo 1111100 P005 Lec S pi jote os log Splilo,00 Ilsoc L000boo ALTERNATE BONDS PUBLIC NOTICE O-000c.louysio000ssc E.00Oo.00c)lOjoi0005 t, Whioc Olsebool°0000sool 0.70 lAgoe Lss Vogo ficbOObcbIlcMb,d, I?.20) 0 tdb'P206-bbS20c,,)l0b5c,k0pc,, Siclo F'ocooi, 001lol0000l000 Feooyl, Ccoolclobec Ployoo P1s,00 1000lboy (iI,oco Otoos000cy Ci0000 64)00.000 ),,c,Ì) bOde, 020000 0,500 ci the 0041, PolO SOlO, loi 20)500005 10000ekio Qo,sel,ol00000 000101eliecrO,e,loc iOlPOlOFlllOnTfl2000c000c,coilliiib000O,i, Stso,000 'I'ouok 5 000 00000 Toto oIE pay So Occis ucicl000 0y0?lcOIlIo?0000,ploy000000py,pSm 00 100011100 soc 574 oil Olio 011o Olocoojoy Viajo l°eosboy 0000 I04lcc uir 011.11 5lI000Ir?OhllSiIb,I0o505500lOaI0000I,,ocol, coylI0000000IcooIoolI, FIELDS INFINITI 0750 I,00lioXC 1577 0,01110X11 0501 Slll100bs000 - 410(0cc7 000010 S51ty 010.1001 Oyi000 loI 00007110000 Ub0l EXCHANGE .1 AhE 005 0400 Cs 111010 WoO I 51111101. 004 pl5 Kiog 111100010 FIELDS INFINITIGLENCOE I kv 1411g0 SkFo 1.110k7 11151011 Noohi,loo log .110lli010lo

itlOOIl.10y Cllill.oIjollo 0,1,011000s 101111 WOojOc SO loW Soot) 1.011g SVIlito 11110k 51,101 04016100E 0000000 I000co 101001,1 11011100 Obliai STEVE FOLEY 0001011E! 'ti - IO 0161(0 loi 105 SIa 0101 101, 5)0 lISIO o '1100010k CADIW Wo F15500 600 0.110 000goololo *70 5M-4090 ETÇ0,ESON GBOSSISKE5090500LVI 00 II 0104500 001110 00440 OF 40711 OOFIOIOSIOoIOS o) illE.S00010 Fono Pollaio), Ciolsoot 100,100 CADILLA00BUIC6- VOPO 0K o7o.1Y11 1500 OblIgo PONTIAC'GMC OiS.01,lllolo XV Sconce 0.flSiISIii000000ypoSe 11051101000 lIcO 011ScSOI l0Tl]0 Polk Mseosgo '0,011(0 001)510 lIli 500110050 0(000 0S,5adOl,0o0OG000loal0cOl1OloysFol OUillIons Wo Deliver Results! We Deliver Results! JENNINGS CHEVROLET OlIARE HONDA 057110m OF USW OtIgOloil jobloolojog BMW 000055E DODGE IEOVIOTOI1WOVI VilFOl000lkcOliOyOl0004jOOl00000l705l000I000I50100IOI0000WO 847-998-3400847-998-3400 6ILLJACOBS 0015W 0%00O Wl1'lill0o 1530 251lssoosso Cou 1100l0001110 Koiolo010ige O 000i50000llt 51' I000coS eøpmeoCui cc 001001,5 OoOi OF 4000 000 i060i 516,0015 =110k5 lIloco N00101000 BAY CHEVROLEI 10471 0233005 7 llsl00000000lc050000I0060Iflc004iOSIOlcol.oIooco((oyoIol,SIcISl00000 Oloojuoo Bosos 1066) 670.1664 b000000.1700000FIc,00eoedolooI0040000illc001c0000007cOIoolo4 000111cc ELM006ST BMW leO') 66To3300 OfOEOFUSLE F101001. 110000,110 ISO cool 0f 0, 000 000 SOdo 00151e a010l0000.o 0cc ollO, 10)1101 000000eñy OloiI000iolo I a 111100001 cl coluo 551 0 F00 05000V 00 ñoS) 0 lilo 1,0100 0011Go OBEReN AlOTO CEFO) IO 00 i 207-0555 HERITAGE CADILLAC HOWARD OBLOFF' oofsomool.000ioolob5100156000iu0050l00000000cll000i,ocfooc«000lli,eollsfIIioc Lolle WI,itt M j 0k Sol, et RAYMOND CHEVROLET DOGE 0F 00000,000 JAGUAR F0000lo Logjoo,00l 1066- Public Notices (030) 629'0300 100$) 510.0660 (010,50,01 000lf101c7Il5005cS00000lc000101Iolc00050ll000l0000lilol000000s 10471 3954B01 001lKjloiljo,o Soli00000lO Ksauz BMW (SAUZ 0000JTOP000K FAULT HONDA 0010000(207. IFO, PATRICK CA00LL°44 RIZZA CHEW JAGUAR ELMHURST pI00001lotflo(00011Mp.10Fiooli,opS4olol000 5005l0OlIl000000I5000000000il louai 004.6000 5200451110000 64300 1051looi50400loIoIoflococloollr,001g,0110001,llbcOSlll,OI,loCl0000l .111100 0000icll,010lV 1111,0. fllOf,OlicyIOopopcofll,lIfl, (006) 514-2277 billy lOto', 011011 100.000 PATRICK BMW seEpAolu C(OEVROLET FORD)-" IffUNDA1 BOZZA CADILlAC PATRICIO JAGUAR O425 WESS 1e515 Sto). n.CURY GREGORY HYUNDAO '000m050coo'oollolflorneo,,lsoiSoa,oil5ollllcjtiool,l,,,,g licol Koy 00111g 17111,0 2-0 124 Ns o.OiIIOILICSOC (700) *20.6050 3041 )RoI9 DoOo;3

011o 0111 0 0 G000SSINGER HYUNDAI '0o01ct,IG), 010001101 1.10,01,04 'Fobia. CHE VRO JOE RIZZA FORD CIllo(0oil i.i011bogell101, 555500500100010.16 DOPAGE DODGE LINO N DoPAGE 06412041 BILL STASEKCR0000LFO cHRYSLER JEEP )R66)B4R7442 CHRYSLER JEEP 0100000 lIoso 561,1 000WMilTE00° S 11(0101 5 lIt loo i000i 670-lcS4 lo0300o055l l°0ro0°05S1 6500005.puckotjoo.Ils,olrn007000rlc,cccoociloce-soscicno,r000-,,c,o000110, OURSES HYUNDAI We GBEGORY GREGORY 55(0*51 BUICK BREDEMANN CHRYSLER JEEP CHRYSLER JEEP KS AU Z AUTOPARK CHEVROLET ,OOOoW5ob56400Ao) Deliver ,1041001@RT.?yO, L.01l0 OccOIcploObysIocFo,oclllotoo,lOoglcoic;,(Op.g%o7o,,1,,ju5,sO,,l,,c,ouoc FICO W. 000,505, 10001 7706502 (BODO 704-6SD2 OOjll0000))i555 lOOlS1010400lOI001i0000IUlcool000l010dool,yo 015lolleceFloroso boil. Resultst 10001 234-2000 KNAUZHYUNDAI UBErn'Y AUTO CITY/JEEP CONO GROSSINGEH GMC SguFoOl@F?F.0AO OOSIjc,7, EFbosIi,500 U BERTY AUTO 1i,00lu,olloo cEbil lob, 5(040 hI (05 lObOOclpF011isd 5y loo, 847-998-3400 CHRYSLER (806) 474-4313 nIZZA BUICK CLASSIC CHEVROLEV 1005 0. 700E *110.1 00471 2044805 )B°6 474-4313 3,Twi'c7c,0ic 10051 *25'6e00 11000 0. :' A SPECIAL ADVERTISING 'SECTION MARCH 18-20 W NORTH EDITIOÑ inside Winning Welcome mats aplentyat workouts Home fitness can be more appealing when enjoyed In Northbrook's Meadow Ridge the privacy of a master suite or from penthouse facilites with beautiful views. Ry Kane Angeli Luc SPECIALTO SUN-TIMES NEWS GROUP Page 5 typically lias winter-weary homeowners shaking out their Springwelcome mats. However, at Thinkthe money for a big Meadow Ridge in Northbrook, more down payment is keeping than 50 new homeowners aren't you from owning a home or spring cleaning. They've just moved .,- condo? In some . in. These days, you'll find many cases, as litfle brand-new welcome mats at this breathtaking community. With more as 5 pércent than 30 home purchases closed since will do. Read . winter, Meadow Ridge is breaking Don DeBat, records in today's housing market. This success is partly due to the Page 2 stunning custom model that opened

. last October. The,model overlooks , patios and perennial gardens Researching a community . stocked with seasonal foliage. Two is vital before any hôme : . more fieldmodels haveince . opened. This brings the total of on- purchase. Where to start, site models to three - an impres- sive number of models for a Pages 3, 6 community the size of Meadow Ridge also demonstrating th level of commitment by award-win- u online . ning KZF Development. Market What's more, gardeners last au- news, expert . tumn made certain the grounds were advice, neighborhood . planted with plenty of spring bulbs, . all ofwhich are now flowering, beck- profiles and more. Visit: oning would-be buyers to view the The new Mdadow Ridge model has a natural palette àf Interior decor that takes full advantage of the land's hlstoiy. The land at Meadow Ridge once was pdstlne prahle, eventually becomIng a nursety. Enjoy vlewLng earthy and the SEARCH A Turn to MEADOW RIDGE, 2 verdant greens that ave their way to the upstairs at this cutting-edge model. CHICAGO» ee a peiew online atwww.meadowridgenorthbróok1com .comy . .-searchchicago.com/homes owtaking appointments

for Field Model Toursr

THE ADDRESS YOU WANT...THE LIFESTYLE YOU DESERVE.

Seven minutes to 294...five minutes to 94...and...steps to Whole Foods, Starbuckà and more. Onsite sales center located at the corner of Techny, Rd. and Founders Drive. Just west of Waukegan Rd. Sales hours: M,W-F: 11:00-6:00. Tuesday by appt Sat. & Sun.: 12:00-5:00. FROM $495K

tf 1___w r

t

¿

I. L.

.." ", . .- -

Call or Email today (847) 559-9800 Sales by: . www. MeadowRidgeNorthbrook . corn IBSON & MEADOW Rl DGE development jAMES . Kogen-Zivin-Friedman )lIr - 2 MARCH 18-20, 2009 SUN-TIMES NEWS GROUP NORTH-U Todays New iiomo Todays New Homos NORTH-U SUN-TIMES NEWS GROUP '.-''MARCH 18-20, 2009 3

fa empty heaters. The espansive Meadow apett oreas, ninny willI a great room oppeal, encaomoge entertain- How tö research 'C'est si bon' for buyers at 10 E. Delaware itagon ograndscale,wiltra slavw- Ridge - - Today's Willt Itowide, linrnpnna-alpfe FROM FAOE I stopping ftrrpfncr adding In the ambiance. streets and boulevards, Daniel Come for a visit . acommunity Th view the modela, call flan wH Buralmam's archileclaeaf plan The noies center tor 10 E. modets and ulthnately making model trame loam Imottine al 847- for Clilcags was nicknamed Delaware Is located at 33 W. Meadow Ridge their preferred, 559-0 50 0. llOATHEfltItOtltapodanodbpvosvotbayPabtbnatlova. RdacilloicGosdtchnntoare "Paris Iti lIme Pettine" wfteo It 4anhn,tvCooenonaortt'a.aalaOtt,Aoore, tavola. vat. i. 00.41 Tips to find out Ihn cornerstone ofa gond corn- Ishardto come by hinew constniction Delaware Plane, aal weal newaddreasin a neighborhood of MeadowRldgetoI orated sltho was inleodared is l9t9. Nearly nl State SteesI, Safes hnore friendlyfacoa. gateway iOlerseriion of Thchny moatly. 'lb find ont wirrer tIre a cenlnrp later, another re- Rood otmd Foanders Drive la Editorial what you want, schools il a community sisad, sowaud arcltllect, Lacten La- ftoffethe type of understated elegance are Tnesday litraugh Sunday "We ore now Ial king to our ho- tram nano ta 5 p.m., anden Nnrtlmbraok,jootwnsl nf Wanke- Tumnyitatthuos.vouml000ttt visittlte schont's Weit sit n. And Il grange, iv agniO giviag meowoers who come in almost need to know Monday hp appointment. daffy to telina how mnch they gasltood. 11411 4Il-Patalnhilptanoettotot.tnn yoarckildwitfhr slarlisgin ele- Cfticegaans a touch of Pandan that Would makethe building igIit at 'lb help find Meadow Ridge, amentarp schnnl, be sore In checlm flavor wilh 15 R. Delaware, hin For mare inlurmafins, cati enjoy their new lifestyle und Schools, grime, commsnify osi tIte Web tiles nftbe (nome 312-397-1018 or doit WWW, home," sold Shannon Gibson-Gi- Inok for tIre warm brawn brick Advertising Iìtm ropeatt-inspired masterpiece Techoy 'Ibwers as yaor bench- activities .., Illese are all thingshigh ne middle sehnnl and tire haine on thestreets ofPads. teneaotdeiawate,cam. Chi- ampo, direclor of sal es Ihr Mead- OItaWIIkir, nmvatns050r,sìuasnmsasnmstn in tIte Gafd Coasi, mark nod tondinoek. You casnst that factor into where to bsy olucolkigfvschunl.Allscbnotsoer Localed an lire naniheasl cor- MlehaalW. Anachke, CEO and cogn-based @properties ow Ridge. "Many of Meoalow (Ita) tin-4814; nalkorO volpI atri home, so If's important lo re-requiwdtnpssltheermrrealslafe Ridge hove chosen the firol-Itoor misn Ilirio heanty amid lIce pris- orrsfSfale and Delaware, 10E, chale nl Tite Prima Bmop, Inc. fa the encionine laies and line prairie selling of spectacular tetriJrst;suturt;Jlppa (l4pl5aI-5t32 (tuotl;;ppo@p]tnoesomal000 seaychncommomtiiybefnrnmak- repon cortI no tlmeir site ve pro- Defawarelso 35-sturyhnoliqon morhelieg agent tor iS E. master anile and now appoint-fit Meadow Ridge te Northbrook, veoaet fanai and rich, deep noir moitlokWuttsra (312(ant-ltlO; ltta(tt4-4411; Meadowllidge. inganoffnr.Balhowdoesouedn nideittapaeentsnnrrrtorvl.Ynu high rise developed by The Dol aware. ments slraighi ootof design nag-huma deltghl all ayee. 'The unedel kitchen han black rableehy and doattttu@p!0000ttomi000 so? Dricimmgrtrwalkittglltronglmalto can find dotaaltkeU.S. De- atines." granIto countterteps. Par o soesk preview, visit Prime Grsnp, lite. Cnrrstnlly www.meadowridgennrlhbmnok. o commanily glees boyera oparlmeol at Edocotlon fwww. mrodereoastrocliaa and mnrn '"They're never hero happier" soapslmolofllte area, laolsvherecd.gnv/inden.jhiml) and tIme li- Alette sense of commolaity basod, goteO comtotlnity, which ioefrordiredlion," Gibsan-Glainpacoot. However, a personal loar nf tIman 75 percentoold, If ne luxorpmnrblncounlenloyoin the kilclr-baseinlheliniog neeasand mas- llae groando nitd models would St.lt-l-rlMtS dobnyert flndlhefadts? linnis Slate Hourd nf ttducolioa rasilamiulom baildiagfealimres lerbedronyn. unfolded like a Midwest prairiolocated rione la retail shoppingexplained. 'Weshanvlhcmoltowfo " (vvww.tsbe.stole.iI.as). rl and balk; -Franke, Wolf, be best In faffy enperielagn the NEWS Maslinforonalioacanbefotmud all elegant sand-colamed fime-Miele, andSnh-Zernkiiclteo ap- 10E. Delnwareinciodes one-,ingo; and unerolaed balcosies. wildflower, Gihson-Giampn said.ammO first-role Norilibmoobmofan tfteir mew Meadow Ridge . Aanllrerrdeaistonskyonrreat oofnrgctlableprairie setting for GROUP bydoing lome nnlinevfealhing, 01511e façade atid corned holco-pIlotees; o lCnlmler soakimog lubtwa- and tttree-brdmnom floorPrices range from S5St,000 In Since Meadow Ridge began solestrIbolo fiaste oltainable." Agand place loslarlisUSA.gov. esfaleagermltnpalyoainconlact approximately Iwo years ago, Yci IÇZF Deortotnoent is sa in MeadawRidge offerosin floorwlmicim Meodoso Ridge is so cele- with pareuls ofoeltoof-age chit- itleswittr blackmailing. Enleriarin Ihn mantel both; Imardwandplans rangirrgfrnm 845to 3,095h2.6millino and climate-cnn- healed, (www.nta.goe/Cilieea/Fadls. mare than100loitI hove kernloorwith cmlrreot evento If mat even sso, willi tite allachedresi- ohimi). The t'acm andPigures denn so pou eon find not what detailing includes a dramaticflooring In Iinitmg areas; andO-sqmrarefeel. Residemices includotrailed, indoor parhiog is snail- contracted, Now llante Orsi pur-willi poaillvr word-af-inonlb tices raimgisg from 2,300 ta About Your Commnntty page tkey think absal the education frasi eimtrooce willi roslicatedinch crown maldiog und woodl½tn3lhballms;9.to tS-faolcemt'able slarlingal$OS,000. chasers are living io the mainte-neighborly tnockeling, Meadow3,700 sqoore feel. Tite hove pric- Iscai selinala are providing. Or SInne andalitoeslorre eotryarch provides finks lo a weallh afin- with Insel keystone. nasen-fron frames of tIroirltklgrstolfmcintteivtnavocwatedlog begitro al $495,000, willi fsrtnalion,Thetacalghambernfcanloctllteschuntspourchildren dreams. ascosilìor,coltiag-calgeoppmaclimony deliveries osearly as 00 abois agand lauere would aflnndrmttd arrange fur a "Loeies boo Instilled this commettre hnildirrg with o grucetul, old- Adstiliottnf y, Iltese happy horn-to soten outreach in response tadays. Meadow Ridge is proud of Luxury Livingatits Finest in Libertyville olisfnemnitoo.Asbforawelcameloor ofltrn bndding and umeel- carenero are talking willi latineennrorcoiiornicclmalfeages. its qoalily, folt-bricla dtiplrx and rngwmlklheprtnctpai. world siple limaI peefecify corn- kif, wfticlt should provide de- plemenis lIre Iroditiotmol -:NxitttOul;.CIavt; boyero, whick Itas onip helped fo "We walk hopees Ibmugh tirelownlmome-slyle residendes tailedinfommolian on the cnm- PMbsamlunainitantFiodlhr conviacenewconaerslsporlakeittprocess of selling their carment Foor of lime finne plalts ltaoe manity. And dvn'i for?nl pone linklo a cammnsmty's pork din- arclriteclnme pon so often see io thefonorioosappraloftkisguaref-bosse atril make nace lImp lianeflmnl-floarmanlrrsnites, appealing real estate agell, lt's his orhnrlticlvtathecvmmnnilpnrlikmry theGold Casal," said Michael W. jab lo know the communilirs Web siten la find ostwbal utter- Eesclmke, CEO and choir of TIme ingoamavailabte.Moslparkdis PnlmeGrunp, Inc. "lIsa building .theyonll in. elch in character, which io hard _..._ìBefore am nom spccifiesng-ltictsposttheiractioiitrssnlheir Cgnslions. Web oiles. Jal down Ihr times to eume layin tlew.eooslroclioo, lmrfact,ils lIpiria one nf lime hull- Home and condo shoppers can buy -:;- -u Ceileusdota: The U.S. Cnn- and Incollano of aclivilies poor :- ans Bxreaa otters alameakdaseufamily miglnlpseticipain in nod marks hehitmnl the building's sog. . ondemographicobystatn,roan-.okservn while the aclivily is in Cros. Bnyers are io awe of ils with 5 percent down payment or less cml)' and places in ifs ConotylnlOi5tU gall firot lu make lare refined exterior and charming .;' y, mienne, lt aflors Ihn type of as- - $195.8310ePtaleadtt month," .-'andCityDalaBnofc2057,whickviaitnroarewefcnme. can be arressed online lwww, ' Von also gas visit lite recre- deraloted elegance that would first-flmekomr and con- sollt mokethe bnilding nightol homeFtS0ttNG0mt.,0.5,5Tt1lN no0,th,- '- tlKmNGi',Oìitt,Y SWiMMING on -'Thisioknawnrnap-feontMl censnv.gav/-stalak/wnaw/cedb. alinncnntnr,'donneoists,luckeck Mostrecrosion-ballereddomïniom shoppers he- DFarella html). Along with infortoaliososfthn facilities. Drive through -na Ike sirnetsof Paris," tievellteyhavels saco apabig D eB (mortgage insurance), and is akont popalalian, home bupers lawn nod lake a gander at the "However, the ardhiteelure ai dnwopaymentfo step across tIte valid foc Ike 9speecentconda parhs,Aretknyingnadenpnir? 10 E. Delaware io out the only morlgogoinsmlrtOde program," gao find data ahonihousieg, in- tkresholdoftkeAmericas ON THE come, crimeand more. Thbiw.lt'simpuetanitoltoaw thisg that hints at Sarape. lt's Dream. HOME hesaid. Other soorcesforlbis labo-that yonen toying into a safe alsottieamenitiesio and araund ThoI'samyth. FRONT Thereacenofoaapoinloor rnaliooinclodeeityorlsrvnWnb cummanmly.Agaudpfacntoslurt thebaíidinglhatcaploretfme es' Home sites from $tla,000 - t45a,000 Ifyankave astabtejob and ermtrafeeochargedforlhe95per- ,siIes, the U.S. Dnpartmeot ofto tite FBI's omriform crime re- Ornee ufa Enropesn liIeoipie.' Home/tnt p mn!mageo from $3fi5,O5O$t.2 niOttoO goodcredil, you now can gelpre- cenlcondoioans, he said, and, Inside, lU E. Delaware offers Hnoaing (www.had.gav/csm- Paris (www.fbi.gsv/ocr/acr. Modem nprtl Sac O Itas. ,toois-dr3Opm nr tym mu/ape. approved tor a mortgage, place aitigtaaris ofopto$417,Uoøinvalo-annoalprcceatageeate (APR) .-mnnily/ioden.cfm) and local li-him). Orcheck nut the Illinois residents lite iotimole, edotte downpaymentafanliltleas 5 ogbomrowerswith acredifscorewontdbr5.091 perceotinlerest Stale Palmee unifnem crime re- atmosphere ala luxurious bus' Gtnaao Latan Rai. lItro,, aIA,,m/ncla. en BIlaffLaFae teaL :hrary Web siten, which often to the abom-ca ofBltnffdaka percentood obtain a commit- af710orbelterwho occopyllae in this eoampte. pruvide ioformalion absut theports (www.isp.sfote.il.os/ lilIan boilding, said Reachkeu menlfareonveoli000t 30-year ptayectyonlyao apmimarymeoi- taarmarcinfarmation on 5 per- commneily and links la other crime/ncrhomn.efm). Anoiher Indleidoal reaidences are cam- tesvw.t,ewpnrt-nnve,rnsm or nati 847.726,2727 fixed mortgage financing on o drnce,"tr000id. ceatdawnpaymenlmoetgages, -cammamsily Weh siles such an guudresonrceintheU.S.Bareau pinie with high-end standard New Aetnetexo Hos,m lee, "fttimaryresidenceinnleadolthe Herein theenampteFarefia rail 773-303-0039, are-mail acbooIsatmttpv)msaodrucreaIfottti nf jos.(ww,w,goc/bjy/ finishes that litfIode Pnggltu- * t0heleeotto lopercenlreqnired overdclaowyóothajdboya dmaleacts. 10v ,ctsal'cvmclltttm)t pohl cnbioetryhnd'graositethrd - Wt-içrft Tbk Lbbt' toYotip Foo Yhto - - fodaykymonylendera, reporto eandowith asafepriceof norlgagn.enm------. ;StRTIh1.-. - .'TTtydiCt' T ------WintrostMortgage, a leading $263,ls8byplaciagas perenni Leadersalso aayitisimpar- Chicago-booed moelgage corn- down paymratofl3,158.'flte lanfiolodap'smacfmetla obtain pony' borrowerwitlmgooderedilwontdpme-approvalforamorfgagnAad, "Wlaea every atherteoder quolifyfora3o-yearfixedrate renternber,fiaaocingohnmo or toys bto'to 95 perceatcoodo II- loan al$250,000otoninteresl cnndsporchoseisdieedllyhrd lo oanclag,we soy yes," said Perry rate of5percentThemantfnly tfoeborrlawecb individoat, verlO- D. Farello, allorik Side mort- principal had intecestpapmeot ableanddacomeoted financing From the White House toourhouse. gagekanherfarWình-notMont- wanldbe $1,34205. sitnation. gage. Tl'picallybarrorverswha place Whaltfyaudoa'lhacellmalyts TOUR 2RANCH HOMES Accordingla FarcIta, Wiotcustlesslbmi alopercenldasvapay- credilocare?Thesedays, lend- . Mortgage itas otatained awaivermentarereqaired topayprinate erssayyauwaatdneed acredil From mid $600s eneepfionwithamajorprioofe mortgageiOssarasce (FMI).Thescownfatlraot880orhighrrlo Iv a scenic settingfilled withlandscaped ponds,beautiful rook gotdeos aod tuartgagninoorancecompaoytomoathlymortgage insarancois abta'otamsrtgagewith ltper- originate 95 percent loan-lo- boned ooaPMlfactorofl.94,or cenidown, andyoa svaaldbeme- vilJ flowers, avd suarouoded by tire famous MeAt Club golf coasse, corne oalneconvenlionalFannie Mae 5195.Slamonth in thisenample,qaired tapayPMl. home to your very speciol mooch home. Eo(oy n completely appointed and Freddie Mac foxes on any tirai esttetanesof1½peecentsf Ifyso natyhave a credit arare condo cnoeertion or new con- condo'ssateprice atoo masthe ofsl0andnn canh,whaldo t'ao tesidence io oar award-winning, well eotoblished LibertyAlle community. sUuctioacondomininminthr escrowed, adding$328O5per do?Daa'ldismay. If you can Chicagn arno. manthta the pastoral. charmyoarpaeenlsorrichnocle The low-down payment loans To holdmsnlhlymnrlgage intogivingyaoa3tnpaweof . (847) 680-0090 are aoallabte even tithe condo- costo down, Fareilasaggeststhat dmvnpayameni,yaa sOil could . morithomes.oet miniamdevetaper has noi dudngnegotiatïonolhecondo goaliit'foraFnderal HoosiogAd- toment over control of the home- bayerasfndtedcvelopemnrsnitermioislralion-goamnleedmsrt-

awners association lo the own- gage, - pay3perccntofllsecondo price - ..---: ers, bntrnnotbe warrantable. asoctosiogcnstcredil, his bestifyas apptyaladirccl LAVI "Thisexceptionwos granted "Thisin legalonany Fannie eadncnemeutPHAtendre,ac- . toWmlmuot doe to the excellent Moe art°ceddie Macloan sf95 cordingtothe Departmental """RESERVE performance of our past 95 per- percentivon-to-oatoe, andthat Ploasingand Urban Develop- cent gando-toan dents," said can beaned topayfhecostofthemeat (HUD)Visitsvww.had.gnv l-94 in Ri, t 37, weIt to Rl. 2 t fMtlwnkoe Anni north t '/a wiles to evteasce. PareIls. private morigageinssraage oc colt 000-CALLFHAIoraIisI oc-.Potlaw signe to Safes Carino open daily t O-5, olossd Taesdop R Wedeetdnr '"The program in for Fannie onde,op fraolattheclosisg, so IIUD-approced mortgage fend- Mae antI Freddie Mac conform- ltmeboyer000idspayiogthe ersthataaodirecleodomsemenl.

j :' iE The "economic stimulus" means lower prices, easier

I Bankrafe.com -, CIteck rates-dailyat-http://suratimesdnterentocom --- , financing and an. "American Dreamt' home of your own. 10(010 ore tinriirt la roil ipl Pricem oid trontLva oro bamoirl au (IbmIrtlh unti; it rmeaul, poirl art mrpatioilrnt roitvbar000f it atlarfaUs that b5lrl t eta hnno yahoo ntmne arco aualr.Thtro we 0m; 0m tram, rue psttin,ibora we 0m ttitrdm tu melt. Sto Purro/loa

AaurAtu Dama Moe,atat Caateaa,roe Il ' 866-40709WMongerMoenoaeao Cone. 63O.649O694ABI Maana*ee . 647.585-1995ALL Aueercae Momuradar Cone. 630-978.8300 roo loo afmaotolea and mmm ant incerlwa prwlfrf by thu g306nntal tttam it nibs ari mli. ari it's ihr1 In n LaliOWoed aannunty. motan maa.Aaa rttarøraam 2.usm tepo'olaaw.aatrtoaotyege,iaott , abf ha l.ukouooclt Homss,tcn.The WPO/OOltY iolutlitietho Oomayoa'li art etoctil alors you mart tu la, roar irai 005301m, mhapplot and 000- Cau,WE EaPEonn000 OaIEOiFHa,un, A,atoue t totoS Loes30 yr told 4.1111.505$1100 20 4,10131 501514 4.0002.050$130t 25%4,74330 90 hoOf 4,811u.00u1140 25% 011O erjay:eonpltttly rtO.10rd tilts's molArI bicot libar a roo bono. altari cOmnUurQ. c/Ink Ps inca/crin Lv ivin of. itt u nao dal-erOI iii Oanlnyaoeottleebontloyaoirlbatllwr100m005n010odrtdilttyrtoed 4/tn0.050Statoottid.53t3t5rlistd 5.253tOOt 11505 '20/.f321ilyrtittf 4.3710,000$140 Ot'/,4.451 upenitarnlnulllunsovormtlttrd0500tdoeteparKonttb3OpnFHA reti 4.1755,05051100 4% 4.075luyolaof 4.2501.110 11300 20%4.t5P1/1 lumboARM 4_050O.tOO Stun attn4.7t7 Models now grand opening at each of these comntunities( Lansndatopolosil000utosaptott%LW,PnyaOCredltCntdl i/i 1005306M 5.000odIo 20%4.841lsyntiood 25% 7/1 (amboARM5.055U_totSaut 21% 41ES . $1800 4.7800,000$1305 4.ttt Pite enes WnrbmtylCsiioo 0100155 MOnooges C000000 AEF15ANCO UF TO tOO sin vere Napatolilo's Dirait Lender, 0pae We0100da Loi

, olworth eli Lake Twin takes Canp 'Pleasant Prarle \VS()NSIN j rn Lake Genoa L_c_1;;;_ itá erlñi CHICAGO ä: -r. - Høbro lussell s lchmon take ¿k AntIoch Winthrop Harbor .- (J,,(.1 iP(' 11rmntS - LI, t SprhigGrov.. (;;sIi OIduAm 'Zion Singte Fomity ! L. d3worth 0m I . - Lake i Harvard - t_l c, ek. : o Iflfl.:z each oTownhome GMAWPO? . I o b1 Capt n I P(%x La' ¶ . Park 1ngfe Family . (Istak; 1j* Long . s- WonaerII-', LK okjsound purnee ond Towrihome iohtibt4' Lake y. R Manuhotured Caledonia. o rovo''i Htulfan °Wduk.gcin m ¡rl rarkCfty . . thove røyslake oCondo .9) I s , ., Ua41iptà n I .' .. .. y - I i V JNOV$h Chicago Q .. I Woodsto4kr e lo ..--,- o 5_ . Hou HJIli, lsl nd ) "---L Lib He nottwoød MIleß ) \jrakle Grove. . ¡.La - Ivanhoe0 : eek'Idere : Í. s °Lakelluff . I O - i J Mundeletn ç r- c7stal\ LDP Lake Fótest - . s i wfhorn 1M« 4heny \Unlon Lakwood Woods J 'ary. V alley ' EMekit1eHr. No,th ' 4III5 on Hills Lake Zurich r'.Hlghland Park ! ! \HuMte) Lakei. ' fl( )ON E (OUN'IV the Hills Algonqi41n - D rtleid i [ ,. i euftaio -...... ------(:O.------'jThjfòh . LAKE MIÇKIGAN . -- . ! CarpenfersvIIIe I . . rospect s brook : . Mngston . . .-- HmpsIìjre ( I Palaflne i1igtits øVins-ttr 4leepy /Jart'r,r i ,, Arlington He . . - __'-1---- k hts!c3 0Gler,vV - ; I J Pingreero e1 j9ilow '- FRAa s -...__vmi, 'r 'Wilmeib , . . r (t urllngtJn Elglfl,HoffnanEsìa?esaz Sc m . Evanston Esmond _L spiato -Sfr4mw.4d' rdiDerÑIÍ, Ökle ,. - \ 14' ...®$ycamore Sth Elgin' 'ar ¡ BaTfl4 * 'zRtdgeo fD.(&bT -...ylrgll 43 ! - Blhomingd. '-- ---f4 - !Y Wc&re 1Carol Ad . ¡ranknPak . i e DeKalb(' -;:;;1an -'-- ls'òn.0, . ,Elmoo'Park CrflstonMalta ï _,alnt Iila.Ehr$ -_elroseÑrk-® -

o . (11k-siga 'w ovs___T\\_:L Elburn ; Glen EIlyr ak. , Oak. : oenevaÖ I . ¡ -' st bard'j11w od-pari----'--- Jfarbør I - i. -...--- . Chi Wheaton : ßatavla. ter. ..-. -i---- e-- t ! viie Wetcb G CAGO j_ e Down Beyn-Ctco I o . El H HZ . . North' : . I ro !Brooineid.- _HInid 41 : -. _ -- I 's -9ies Aurora. -Liii La ran, . CtcJQo oLee ', Aurcta . I I Big /__ Mkfw. N. . :rliieO:tm0t. i V i L)arfp Evergr en' M .ntpqmery, . I Woodrldg B r .nk. I . "___.___7__ ', - . . ?' - ? ollngbroo \ .. I . ' , Boulder Hill' Palos1Hs. ak Law ¡ 'F Ck,iln.rfl.íon.JA Laie I istings CdUs,Cl i Alsip( ( Plano _,z__ sweg.,0 - la cl,, a Ogd.n Orland .5.. Clii, . Yo,Ill. lhiO OD iton . Dunes onauk,JCh o C)°i ¿" Ov1CNca ¡ndianiiDtiea i o Gr rN . Park O.O r -,Akpod ---i:-Ä1AL5r5ECo. LaleiIOIl.y j Plahfi. NatSnILehofi'I j.- .» ForflbA Souhi1101 nd 1. ,,. Lake 1 . and . Leland o.r Olirn -I ¿I LII fch. n ary . ' . J MHItrooI I ::ì ¿jLe I ' Locort MI;U15.4 Crst L, ., a 1r, gton 4 Cryàtc Laws 1,d5j. er aIär tM .- \fl,. a'hey wood. Lasi4 : H ghland Live ID -; h '- o 9e Hill Chicago $herIdir - ewark 3-Shotv o - l.ynwoad GIflIth 'Rossp r! t'.0 :9:íLM? New aliloAlns,o u 0 -P,ti Pajk Frest ---' s on 'w rest its .x110*il E$ta 'Sauc Sch.zervIlIe KENDALL CS.. 1Crsvk .---. ------1. Vøi4ge - o1 'Lake Hills Lakes o1 mo a . . ' : StUohn, Wckcn in . . CretJ? the Four hannahn F. rtv Park' IvYtCrsc monee ) Seasons ood,53 Manha n Cro\Wlnfleld . Goodenow. Point I f- V . men Sjng.rÄkpo1 ci - vltton .,,. . , . . . ,, Ottawa -4 e ::-r j fl54 . s tdar Lake -4--- Morr4 ..-. . -... i7Centril. ._:; -.MarsetUes :iIV'i.. ,, Ñaplate. ' . - SymedonI. . . ctone o .I . 71 -:z::,__ '..zz: Hebrc° i'ï -t Wilmington o ,'------Hill I I N I) --. . . -- ---i NA r\_J . G- Lakewood \$ LIO jÄ} ! Lowli cç CoaCity ._.L._% 3 :L r hores I o 52 - BäTdò.o Lr.k- Manteno Grand .v Mazon a Grant Park, I; Verona sGodley ! ; /BricovWe Shelby \LeMotte : - . vs Ç'"". I I oKinsman oSchneider.-./ -r- - o ardnr Esseì Mcmence . j_ - .- '- , s- Ransom South WI ngtor °9st BrokIyn 5r j i / Bonfleid. SSoPii, / cO N C E P T S : 5ourbonnis Sun RlerTerrace =(LakeViUt1ge , LL h-. .'-* ,.., --s,-. .--*... :..... k.*$), ¶ a,. S.- Text stnb+Iisting lito 52732 Sun-Times News Group Builders It) SCuLl listing iflfL)rIlIahj()fl to your phone Whipplotree Village - HI-Tech Housing MONTGOMERY s $60,000-$120000 525 N.McHenryRoad Boulder Hill CondomInIums . SW Boulder Venture (McHenry and Lake Cook Road) Ml-541-4990 4 Ricky Way, Suite I 3 $75,900-$93,900 NewportCove on Bluff Lake - New American Homes Inc. www.Ca.italFirstReal .com/c whi. .letree.html (Briarcllif Rd. & Boulder Hill Pass) 630-844-8500 North Newport Dr. . $385,000-$1,200.000 www.bouiderhillcondos.com (Grass Lake & Bluff Lake Rd.) 847-726-2727 Foxmoor - Cambridge Homes www.newport-cove.com 1975 cambridge Ln. $191,990-$286,990 EVANSTON Revere Way - Revere Properties (l-86 & Orchard Rd.) 847-984-4580 7211 S. Ellis Avenue $195,000 . Winthrop Club Condominiums - Winthrop Properties WWW.MyCambridqeHome.com (71st Street) . 312-993-1083 i 567 Maple Ave. $329,000-$1,489.000 NAPERVILLE (Maple Ave & Davis St.) 847-328-4700www.phenomrealtyqroup.com Opera Lofts - Bronzeville Construction Carillon Club - Cambridge Homes www.winthropclub.com 2545 S. Dearborn $239,900-$899,900 I54 ; 3995 W. 95th St. $1 50,000-$274,500 LIBERTYVILLE (26th & State) 312-225-5000 (Rte. 59 & 95th St.) 847-984--4857 The Encitwe at the R...rvo at th. Merit Club - Mint Horn.. . www.TheOaeraLofts.com wWW MyCambridqeHome.com 1697 Burr Oak Dr. $655,000-$800,000 PINGREE GROVE (Milwaukee Ave. (Rt. 21 ) &BuckleyRd. (RL 137)) 847-680-0Q90 CambrIdge Lakes - Cambridge Homes www.merithomes.net 1335 Evergreen Ln. $135;000-$411,000 MCHENRY Tanglewood Oaks - Tanglewood Homes (flte. 47 & Rie. 72) 847-984-4881 Morgan Hill - Centex 3066 TrillIum Ort. West $329,990www.MyCambridqeHome.com (Orchard Road & Galena Blvd.) 630-897-2026 PLAINFIELD 4351 Veterans Parkway $150,000 I - (Route 30 and Bull Valley Rd.) 877-682-5980www.tanglewood-homes.com The Enclave - Krughoff Builders www.centex. corn/illinois CAROL STREAM I 24505 Rockefeller Court $261 .500-$314,800 L NORTH BROOK Easton Park - Lakewood Homes, Inc. (RI. 59 & 135th St.) 815-254-9543 Ridge - KZF Development 369 W. North Ave. $270,000www.kruqhoffhomebuilders.com - (North Ave. Rt. 64 & Gary Ave) 630-665-0531 Square - Cambridge Homes 2282 Washington Dr. - $495,000-$895,000 OMeadow(Waukegan & Techny) 847-559-9800WWW lakewoodhomes.com John Adams Dr. $1 93,000-$226,000 www.rneadowridpenorthbrook.com CORTLAND OPatriot(Rte. 126 & Rte. 30) 847-984-4949 www.MyCambridqeHome.com NORTHFIELD Rlchland Trails - Cambridge Homes Grove - Cambridge Homes Sunset Village - HI-Tech Housing 22 West Meadow Dr. $142,000-$178,000 ¡ $214,000-$293,990 847-984-4994 15105 Freedom Way 2450 Waukegan Road $70,000-$150,000 w (Peace Rd. & Rte. 38) OLiIerty(I-55 & Rte. 126) 847-984-4550 (Willow and Waukegan) 847-724-771 1 WWW. MyCambridqeHome.com www.M Cambrid.eHorne.corn www.SunsetGlenview.com ELGIN SOOÌH SKOKIE r:T' Providence - Town & Country Homes - , $179,995-$449,995 Optima Old Orchard Woods - Optima - 3040 Longcommon Parkway iè 666-902-6325 9645 Woods Drive $249,000-$1.400,000 L ' (Rt. 20 (Lake St) and Randall Rd.) Sterling Estates - Hi-Tech Housing (W of 94 between Golf & Old Orchard Rd) 847-583-4700WWw TownAndCountryHomes.com i 294 & I 55 $70,000-$150,000 www.optimaweb.com West Ridge Village - Centex 708-839-5525 Route 20 & Nosier Rd. $180,000 . VOLO www.SterlinqEstates.us (Routh 20 & NosIer Rd.) 877-873-0595 BEECHER Symphony Meadows - Cambridge Homes www.centex.com/illinois 319 Mozart Ln. . $170,000-$286,990 HAMPSHIRE Hunters Chase - Phillippe BuIlders (Rte. 120 & Gilmar Rd.) . 847-984-4933 .1 1689 Windscape Ln. $169,900 wWw MyCambridçeHome.com Lakewood Crossing - Lakewood Homes, Inc. (Church St. & Rt. 1) 708-946-0100 WADSWORTH 1450 Hearthstone Dr. . . $160,000WWW phillippebuilders.com (Route 47 and 1-90) 847-683-3379 Park - Castletown Mldiano Club - Centex www.lakewoodhomes.com 1393 Somerset Dr. $180,000 3051 Nicklaus Lane $160,000 LAGRANGE OPrairie(Church St. & Somerset Dr.) (708946-9620 (Yorkhouse Rd. & Delany Rd.) 877-676-4407 . . L LaGrange Estates - HI-Tech Housing www.castletownhomes.Com www.centex.com/iilinols Prairie Park - Castletown WHEELING 6 Court Drive $60,000-$120,000 (Jouet Roaand LaGrangó Roa) 708 354 -0395 1393 Somerset Dr. $170,000 'www.CapitalFirstRealty.com/c laqrange.html (Church St. & Somerset Dr.) (708)946-9620 www.castletownhomes.Com A MCHE PUBUCATIÖNS ÂDVETISNG SUPPLEMENT MARCH 19, 2OO N

EXCHA: A Division of Semersky Enterprises. nc.

Mark of ¡Vi tIejrizt li E ncelltt5 rn Awatd V 2300 Skokio Valley Rd.highland Park. IL 2490 Skokle Valley Rd.Hlghlônd Park, IL f Sherwood Terraco, Lako Bluff. Il (847) 266-7000 (847) 432-5020 (847) 615-1111 www.4porsche.com www.audexchange.com w w w. s a a b exc h a n g e corn (p C.) Th*URARU Economic . GetaiiMadiwss Savin Stimulus VEFOLEY on EveryNew Cadillac in Stock! Headquarters: '&éc.of Noimbrook w/TAX CREDITS New 2009 E SPRING r' c .1 Cadillac WHEN A GREAT DEALMATTERS SHOP ROBPADDOR'S... MS//P...... $37050 . $2.500 I/TOSTE . .. . LEAST TO 01/Y flUBAIT: $4,000 INN[NI0RY ADJI/SIME4T $1,000 STEVE. FOLLY IJ/SCOU/Th $2,540 suai o;

., Hew2009CalÍIác . z

E ,. Escalad ' I o :-Stklç.0201 o0 4: MSRP: 25X $45,725 ' '. , 85 SUBARU FORESTER MSRP: o ' ? . ALL NEW2009 * D' Rebato: (j Rebato $2500 . $4 000 (j Lease to Buy Rebate: '.. . Lease to Buy Rebato: ,.. $5,000 Inventoty Adjustment:., * Invontoy Adjustlnent: $2,000 . $3,000 2009 MOTOR TREND o. Stavo Foley Discount' OVER Stove Foley Discount: $4485 ...$2,729 (j . (j FRIDAY, MARCH 20TH-9AM-6PM ri' I'' O 75 SPORT/UTILITY cl) %iwRlor l0 APR for ¡MO. .. S3gg5; SATURDAY, MARCH 21ST-9AM-6PM TO CHOOSE!' ' of the YEARTM $50,500; 40 Months 60 Months MSRP $20,660 9FA, #4826 .219%APR*** No Security Depositi ?( :; 3 , . 36 at signing. /.'.., .,., ..-.,. mo. lease. $2,849 due - 26MPGHWY . Don't Be Fooled! Our Leases Include theAoqjiIItlOfl Few.... 2.51 SEDITh RAND. NEW 2009SURARU OIJfBACK 2.51WAGON SÈWAVEMÚ SUBARU IMPREZA . ' ., -- ,,,. eco s 00(' ':26, s :' : "" ' . !MO. 1MO1 MPG ,' , - - NO SECURITi DEPOSIT! 9 . :. '.' - '' NO SECURITY DEPOSIT! 36 month lease. P9100 CTS3.6 PLATINUM P9395 200$ ESCLADEAWD $20,995 BLACK/BLACK $46,995 P9252 2005 STO VS SANDSTORM ' $26,995 , 36 month lease. $2,894 due at signing. P9104. 2O $2,495 due at signing. 2°''- . -APR - - . ---fl- CTS 3.ß 6010 MIST $20,995 P9309 200e ESCUDE ASO . OJ/CKSIIVCACASI/MERE $47,995 09326 2001 STO AWl) VS WH/TE DIAMOND' S28995 & Locks1 All-Wheel-Drive,AM/FM/CD, Anti-Lock P9247 Air Conditioning, Power, Wins CTS 30 MOONSTONE P9310 2008 ESCALADE MID BLAC HM E 0E $20,995 $40,995 09325 2007 STO AWS VB GOLD MIST $28,999 Wheel Drive, CD Player, ABS, ' Air, Powèr Windows & Cocks, All :.', ' MSRP $22,960, 9DA, #4474 9084A 200e CTS 3.8 . 66005100M : Brakes,: 170-hp Subaru Boxer Engine, $20,995 P9334 2008 ESCALADE ESY BLUE CHIP/CASI/MERE $49,995 09202 2008 STO VB CRYSTALUED $29,995 $18,160, 9JA, #4715 . 17Ohp Subaru Boxer Engine, MSRP ' Don't Be Fooled! Our Leases Include theAcquisition Fee . . P9177 2000 CTS 3.6 PLATINUM ESCALADE ASO ' ' Acquisition Feo $23,995 P9329 BLACK/BLACK $49,995 P9327 2007.5TO VO WHITE DIAMOND. $32,995 Don't Be Fooled! Our Leases Include the

P9146 2006 BLACK $9,995 UARU FORESTERS CTS3.e $23,995 P9317. 2008 ESCALADE Wi//It 0L'JIONTBCASHMERE .Aiitomaflc, Block, Great Gas Mileage, 20K, #P3200 7,995 $50,995 09142 2007. STS AWD VO BLUE CIIIPICASHMERC $34,995 '06 ScIon M '08 Foestef maUc, Sunr000,AllOyS & More. 5.toChO0Se IMPORTS & DOMESTICS '02 Mazda Protege 5 WagonAuto, Sunroof, Moys, 300,Yellow0331 2., $9,995 Evergreen, #3316 6,995 P9182 2008 CTS WHITE 010149NO 09144 2007 STO AWO VB BLACK/CREY.' $34,995 (96 Subeni Fotester LI; BIOS Sund., LeatlierAtloys, Black on Black, Loaded 31K, #4749A Black, #03223A$8,995 09304 '04 SexuS iex 330 AWD $2Z996'04 Satin's Ion 4-Door Lealhe Sunroof,ALItOmatic MInh, 03318 5,996 P9205 2005.SRXAWDVO SILK GOCEN 20,995 '08 Suban' FareBW X Spod AutomaOc, IPod Ready, Black ' 2008 CTS 3.0. ThUNDEO GOEY/GACY $31,995 P9143 2008 STS AWD VO PLATIÑUPAMLAGK $42,995 #4680 $21,995 on1a8c,PJr, 08K, P3320A $7,995 1.996 '06 Mini Cooper S Conysdible ..5 Speed, 21K. Dark Blue, '02 Honda Accord '02 Sub.YiI FotsstX-PiusAutamaUc Sunroof MoVE 41K, P3371 2006 SRXAWDV8 DARK O LUE . $25,95 #4375A $19,995 Jdoma8cMr, WhIte, P2070A $3,495 91960 2009 CTSAWO 3.6V .RJDIA?T SILVER $39995 09333 2008 STO AWD VS 005101 PED/CASHI/BUE $42,995 '07 Honda Accord HYBRID auto., Leather, Sunrool Grey, '01 Ford E250 CWqOVIIS $18,996 SUBARU LEGACYJ OUTBACKS DTS P9323 2001 SRX AlD VO BLACK $29,995. '07 Volvo 860 TO ..ni,to, Leather, Sunroot, 24K Black, #P3243A Lthr., Sunrf.,WhUe or Grey, Low Ml., 4-to-Choose ..... 1,996 09093 ' . $49,995 SUØARU TRIBECAS '09 Outback Ud 2008 015V PLATINUM/BLACK 47K. P3338 ,,$12,9 p3345148/47148 .... 19,996 P8923. 20117 MS : PLATiNUM ,905 - '05 Honda Elemuit LX AWriAutomaUc. LIke New, Orange, i Passenger, Black, 91Ç P3352 $29,995'09 Subaii 0IJtl5d(AutO, Full Pwc, Gold, Black, Grey, 09315 2009 SRXMVD VO OK/SIAL 000GASI/MEBE $36,995 $11,996'09 Suban' ihibecs OVDAIAVI . :11; Sunroof, 5-Speed MInt, Grey, 60K. 3706A #03280 .... 19,895 P9338 2000 OTO WHITE 01014090 $25,995 '03 Acolo CL Coupe '09 lhlbica SE Ltd Leather, 1K to 5K mL, Grey or Cold, P3349/SO $24,996'08 Suborn Ouithack 2.51 LtdSunroot, Lthr.,AUtomaliC, Grey, P9310 1 .AutomaticJr, 13K,'103219 ,.18,995 2009 SOXAWD VB BLACK/CASHMERE $36,995 '02 VoAvo XCTO AWD..Loather, Sunroot 1-Owner Alloys,66K. 4825A $11995 Silver, #03243 .,, $24,995'09 Sobaw OuthM 2.50 SE . P9193 2006 Dis 19179 2006 SAJO 'INFRARED '. $2,995 goß Subani ihibeca Ltd. 7-Passenger, Leather, Sunroof, WHITE IJGUINING $26,995 $11,995 $09 Suborn Leqocy 2.5) SE Sunrool,Alloys,AutomaOO,Red, #93259 .. 16,996 . Leathe 5 Speed, 42k. &ey 4000A $23,496 '01 AudI TT Quattro $0 Subani Thb008 Ltd. 7.ponger, Leather, Sunroof,5-to-Choose Belge, #03248 16,986 P9217 2006.. OTO 09211 2006X110 BLACK : ' $42,995 '96 Subani OUthoilk 2.5lAutomatic,AJr, Full Power, PEARL RED $26,995 857M 2005 SES VO CASHMERE 19,995 .Automatic, Air, Leather Sunrool, 71k, #4741A $10,995 $21,995 '02 8MW 325 Cl '07 Suborn Thbeca NAVI Loather, Sunroof, 27K. #4428 '98 Suano Legacy 2.51 5E SunK, Ailoys,Auto., Grey orBlack, #0327215,996 . . 09161 2ß00X1RPtA11ASIL4ll ' CRYSIALRED' . $59995 Red, t#p33i5A$10,995 P9324.2007DJ3 BI:ACII $28,995 9214A 2006 STSM'JD VB DARK GREY $19,995 '02 Toyota HIghlander 4x4 AWD Auto.AJr, Full Power, '06 Subani TribeCO Ltd.oVD, i Passenger, Leather, Sunroof,20K, 03339 $18,996 11K,4613A 15,996 44K. #P3185 S10,995 '08 Seebaru Leqacy,SE Sedan Sunroof,Aoito,Air,PJI0YS, . IMPORTS '04 Mazda 3 Wagonsunroof, 5 Speed,AlloyS , Air. Yellçw, '07 Suboni Outhack 2.51Mb, Jr, Full Pwc, Low Mlles#03199/03300 5,495 P9163 2008V UTS . PL/TINUM . 66170 2005 STS VO $29,995 .. DARKGREY $19,995 $10,996 SUBARU IMPREZAS 13 995 . P9207 2006 IIONDAAccORD EX on :'' $17,995 '07 Mazda 3 4-Door RedAutomaticALr,PJt0YWbeelS41P9l29 2.51 SE Sedan Alito Air Pilo'Black 003229 392 2007 OTO . . PLATINUM $29 995 AulomatiTrac. Cent BP3340/41 15 996'07 Subani ' P9078 $10,995 ' . ' Prom. 4-Dr. 2005 STO VB PLATINUM $21,995 '06 Mazda 3 2.3L S.dn Aotomatic.Jr. Silver, NIeva, #P3154 '08 Siibarii ESCALADE 8626A 2006TOS3TAS0lA0ASLEc0II BLACK ... $1O995 81650 87140 2006 STO ?IWD VS SILVER SMOKE tJ 20O E$CMADEEIY. . BLACK ., 24,995 s---- 8U24C 2005 BM5845 08cOIIVEEflALE LACK P9253 ; 2005 STO VS PLATINUM $24,995 P9320 . 200S ESCALWÈ ESY ; "VHIrE DIAMOND $29,995 90030 2OO8JUVAJ8ENpIAS IUNABGRY J49,995 09078 2005 SIS AWO VS PLATINUM 9251G , $24,995 2007ESCAIA8EIS'0 OUICKSIWER $31995 10270 2007 MERCEDES-BEC 5550 BURGUNDY' $55,995 P9339 2o07EscDEA!0.,,,.. BLACK $42995 09328 2006 STO AWD VB DAB K G REY $25,00s BUBA 2O00MEECEDESBEIIZSLSSAOG SILVER.',' $69,995 . ô - - ARU. p.i'ÄJsTO1' S email: [email protected] BBB --- - w - - ,- -- - Ch- - Ask about: Còlleqe Graduate Program- visit us at: a D.fi.Id Specials Dem'ster . Your First Choice for Cadillac ':ii :k out Our Weekly Internet i 00 Skokie Blvd ____MEMID' ' , O,ICAOO L u . NORTHBROOK, IL60062 No.thb.00j( at www.EvanstonSubaru.com 'j_J\T stevefoley.comw,_ () . NØIfl4UN (WNø -1115 - oneblockwestoftheEdensbotweeonLake '%TI SALES HOURS cMtt*c*' GIIIGAbU RVL. Cook & Dundee roads Monday-Thuroday 9am-9pm CaO Friday und Saturday 9am.6pm LL_4 800.295.3576 . il'//,. ofNorthbrook SERVEHQUR5 Monday-Frlday7:3Oam.apm ' IN EVANSTON . aßOBui4l3uul 606 ('Please add tax, tille, license and $151.65 doc fee. Sales price includes ¿Il applicable rebates and in lieu of financing. Financing subjecf Lessee responsible tor excess wear and earlytermination of lease. Optiol, to to credit aporoval and insurabilify. 0% APR br 60 months on new 2009 CTS and i?J1 approved credit score. lease, 101v miles per year 15 cents alter. new 2009 DTS. $13.89 per month per thousand rebates applied. Gas mileage Is EPA Estimates. Lease on Illinois, tor all 01 2008 & Jan/Feb 2009. Ali otters end In 3 days. financed. O%PR for8 months on new 2009 Escalade. $20.83 per month per thousand financed. Finance rate varies basedon cre fßased on New Subaru retail sales trom SOA, in ¡t wohiness o customer as determined by GMAC. Some customers will notqualify. 1) Savings off MSRP n lieu of financing and inc!udS * See dealer tor tax credit details. Add tax, tille license and $151 .65 doc tee, subject to vehicle Insurance and availability. all applicable rebates and incentives, remainder of savinps is Steve Foley discount. 2) Eligible customers tnvsl have ,,hase; Forester $1 1 , 793. Impreza $1 1 .879,Outback $1 i ,940.''Flnance on approved credit.score, a GMAC lease or competitor lease scheduled to end 9/30/09 or belore. Prize Giveaway: No purchasenecessary. One onze poi person white supplies last. Dealer employees and their families are not eligible fo win. Promotion ends 3/21/09 at 6pm. NO exceptions will be made. Valid on in stock vehicles only. Otfer.not available on prior purchases & sublect to change without notice. See dealer for details. 011er expires 3/21/09. A s

c:i-i flVSLfl . ' mjnoq, , , I Assurance+ A decode ®O Htrundat Pioneered Amorlose gout Worrnty Now - . s we'ro provldfnonothor kInd 01 conftdonCO. FInance or loase wry Jeep i new Hyundat, nd ti In the next year you lose your IncottlO', welt let you return 71,ot% (ho Hyund& AUuillflcO. Al ltyundSI we EMPLOYEE PRICING PLUS"II , - I think t'e osolor to Ind e job when you've Ot e Car mote why, lote limIted tIme, we oupartded Hyundal Assuranceend we've added , eoroethhtg Ostra. A plus ae k Hyuindel MwraflCO Pulii Il Ciii, R.bat.s 01N11" p , you loue your income, we'll mak your payments tor 3 mnthe white tve, gel beck oit your feet and if øtt'e not eflO19lt tIme to work p. I ittinge out yon can return the car with no I on your crdlt. 0% APR Plu, DRIVING AMERICA Wore eli l'o thia Iogether end wo itisuk tillb'?tIO eester to get - tJis1 IIt through ti withe good eat oit wtleeil.

NEW 2009 - . Limited Time Offer -- - - . EEP -PATRIOT' EMPLOYEE PRICING- PLU I O,' , MSRP $18,270 NIW 2008 o $h7295 ou) EmployeeDiscount $1,781- ElantraGLs C ---- NIW 2008 $20,545. o Automatic, AC, Power $3,500, 'C MidweMt Bonus Cash $500 - o Windows,Locks,Mlrrors,. $13 795* Tucson GLS$5,000 u) w Automatic, AC, Power #4678 , Gregory Bornz Cash $500 Keyless, Cruise, ABS CI, Wndows, Locks, Mirrors,, 5,545* Standard Feihiree . EPOctICnC Stbt$tty Proam, 1actton Control, andMuch Mqrel -#15327 $1 Mtt.Lodr Bqake, ElectronIc Roll Mttfg&tIOnF5 Star Cinsit Rating, Additional Bonus - $500 $267/mô.* Keytess, ABS, CDmM, 8 Bout In CIaes 4W0. 28HWYFuel EMolonct 04r Coniltionlnq, Much, Much More. #14918 rront & Side Curtato Mrba.27In stodifocImmedate deltrery. $14,989* + 0% APR** $298/mo. *

NEW 2009 CHRYSLER Limited Time Offer . $23290 Jeep Wrangler TOWN & COUNTRY -$5,500 is ready forany type of road The Ori Minkan + 25 yrs ofL.eederuhip $AVE2009 BYJEFF TAYLOR is an annual rite of spring. EMPLOYEE PRICING America's Mod Thuied Misduan $20085 higluvas The manual will do sliglttivbttcr, . ------Searchchicago .-AutosWriter l've' had the pleasure (if pounding on Illese Sonata GLS js for exterior styling, one of tite best things O HEW 2008 vehicles in MSRP $26500 $500 For mori' tl,an (iS ycar, the Jeep brand has iiain- srtiii' of the toughest environment about a jeep Wrangler is that the exterior design - Automatic, AC, Full Ppwer, t(i lCSt their linits, but I appreciate them the most ¿I- Traction Control, IPOD, XM, tajiit'd its Icgend;iry off-road prowess for 1)e))f)' in- Employee Diconnt -- Santa Fe GLS doesn't change much. Tite last major redesign $3,502 $14,585* V6, Auto, ÑC, Full Power, ABS, dividuals Who vint or need gc,-anywhcre capability. in the vinter. \Ve'vc just surviveda \vinter of sig- Cwlse,Tilt,ABS&Much, occurred for 2007. The slotted grille leads tIte XM Tilt, Cruise, Alloy Wheels, nificant snovfall. By pure coincidence I liad both Rebate $500 - O-s-- Much More. Demo. #15141 foin at the tail-end of tiw last economic cri- charge followed by sturdy fenders that can becas- I t-,vo- and four-door \X'ranglers delivered right be. & Much,uch More. #14959 sis,Jt'CJ)'Sforinuk for its iconic runabout bas re- ile rcl)L-tced if they get crunched, Both Wranglers Midwest Bonus Ca1i $500 $2371 inaiecl intact more or lcss body-on-frame chas- fore twc, significant storms and they did the job, offer fuli'-framed or half doors, exposed hinges allowing me to drive unaffected to tite off-ice. Gregory Boñus Cash $1,500 sis, sølid front and rear axles, 4x4 go-anvvherc atud foId-elovn windshields if you enjoy bugs in #4681 capability, rernoval,lc My 2009 Jeep Wrangler Sahara testvelu- 23 In stod tor Immediate doItvere etandard fauteras, electronIc rloors, fold-down win(l- tIte fice while driving. Additional Bonus $500' stabttity piogmin, nfl speed tisotton control, wttl-lod brakes, SanIty ele was cc1uippcd with the second-generation shield and gutsy drivetrains. The interior still has the hose-out feature, but koy.thoft detetrentsyetomri, power wtndöws & lorSis, mirrors, air Over the years Jeep has tinkered with models Command-Trac NV24 Ipart-time, two-speed 9,998*+ R** conittioning, ISt wheat, 2nd row atow n' go. child seat anchor watch the electronics othe dash. Att itlul)ueniilt $1 Ó% AP system, tire pressure monItoring system. ' - transfer case tlt a 2.72: I mw-t-ange gear rado. offering wagons, convertible Jecpsters, Scrath- CIting to remember about a Jeep is that its ALL NEW 2009 1f )'Ott spec out yctlr own Vranglcr make'sure Sill)- NE 2008 CH YSLEH PT CRUISER NEW 2008 blers, pickups. e.'ttendcd-length versions and in - P05cc1 to get dirty and the interior reflects tItis $33000 SAV2OOØ - recent years a four-door model. you of)t for the Trae-Leale hmited-slijt rear du- MSRP $16,655 , MSRP $22,100 Genesis Pitil0Sd)l)1tDon't expect cushy environs ne lots E. P. Diocount$2,907 P.Dhcount $1.951 North American ferential. lt provides extra torque arid grip during O For 2009 the tvo- and fout-door Wranglers of luxurious high-end features. $3,500 HYUNDAI slipper); low-traction situations nichas driving O Kebate $750 Bebel. $1,250 "Car 01mo Year" continue tó deliver best-in-dass off-road capabil- For Jeep families the Unlimited model is the Gregory Bou, $1,000 Gregory ¡tonus$1,000 $10,000 over sand, gravel, and especially snow and ice. nusintaining vehicle directional stability insevere Luxury For Less. $29,500* ENTOURAGEGLS it)' with the ability to go "topless" if you'reso way to go. This bigger Wrangler adels 20. fi incItes $11 ,98 + 0%'APR #4591 $17,899 f O%'APR Full Power, 7 Passenger, Rear While testing the Unlimited four-door version driving maneuvers on any type of surface. Hill #4304 #15374 inclined. Winter has to let go eventually andspot- of wheelbase, which makes a Ituge diffcrcítcc in A/C, Keytess, ABS, Tilt, Cruise, $' ring tln Iirst Jeep vitli its canvai top rolled back I actually got Out of a jam with itas J rounded a start assist also is standard on all 2009Jcep \Vran- YSLER SEBRING NEw 2009 J EP JABERTY comfort, ingress/egress; the extra cargo Cal)acity S345/mD.,- -O Mats, Cargo Net & Much, cornet and witnessed two cars in front of me spin gier models to prevent rollback on graded surfaces. MSRP $23,750 MSRP $23,190 is welcome. Four passengers ht comfortably and Much More.#10917 $299/mo1* aut0SPECS and collide. Instead of jammingon the brakes to My Wrangler test vehicle cante with the trailer R. PDt,eoun $2,309 E. R fliscouet$3,542 27 Mo. Lease Thru IIMFCwith 2947 Due at Signing five will be OK. Rebato ' si;000 Rebito . $750 tvoid contact I performed an emergency avoid-sway conrrol option as part of the trailer tow Creory forni. $1,000 Creory Bonus $1,000 ancc maneuver and drove into a culvert and back group available on 2009 Jeep Wrangler models. The latest Wranglers arc pricedbetween $21,000 to almost $33,000 before you add op. $19,441.1. J%'APR up on to the road. Titis system monitors vehiclemovement reladvc #4709 #4052 dolts, so they can get pricey in a luurr} Case in When you do stay on the road the Wrangler to the driver's intended path and activates the sta- , NEW 2009ICHRYSLER 300 Nw 2009 JEEP G ' - D CHEROKEE 4x4. point is the four-door \\&angler Unlimited Sahara MSRI' $31.275 has a slight top-heavy feel, but notso muçh in the bility progran if tite trailer begins to ' sway outside 4x4. lt started at $28,320 and quickly jumped to MSRP $27,415ír- E. P. DIscount$4,876 Unlimited model because of its longer wheelbase. Set parameters. .-.l J)hrount$4,516 n'goryflonui $1,000 - $33,200 with the addition of the dual toi) group, - I did note a bit of body lean when cornering and The power for both the 2009 Jeep Wrangler ltebio $1,000 Rebato $1,500 wwwgregoryautogroupcom trailer tow package, automatic transmission, navi- Creory Itonu$1,000 i 4 - braking but nothing alarming. and Wrangler Unlimited vas supplied by MW Bono, Cuab $1,000 a 3.8-li- gation system and $700 destination charge. $20,899*f O%**APR $24,899*+ 0%"APR The Wrangler is great to toss around and the ter \-6 engine producing 202 horsepower and #4734 #4712 490 Skokie Valley Rd., Highland Purk, IL (Edens Ex.- Rt. 41 Exit (luvey) Apparently,Jecps pricing strategy is OK with suspension geometry balances ride and handling237 pound-feet of torque. - Consumcrs; the Unlimited model has proven lo Visit our web site at; WWW. CREGUIWAUTJQROUPCOM . Plus putt Option I any, tax. license and doc. fees. Au rebates and Incenfives applied on select models. 5.99% APR with approved credit for72 months. characteristics with off-road capability; the low- J cep offers a decent six-speed manual geai- -.- be popular with buyers, helping to, boostsales. REaORYNEWLOCIUION! 18850 W. 6rand Av, Lake VIiiaJurnee, IL 60fl46 er suspension spring rates help provide a fairly box for Wrangler two-wheel and tAIF5!l FAPM SAT four-wheel Ovcrall,Jccp Wrangler model sales are up 28 per- C AMERICA'S BEST WARRANTY! comfortable side on smooth roads. One i.mpor- nr riri SE HABLA ESPANOLI ______O drive models. Unlimiteds in 2W[) formonly WESERVICEALLNAXrS&MOUELI. Cent over last year. O JEEP ______10-Year, 100,000 Mile owortraInWareantyl tant flote aboutthc ride is that both vehicles ___.___w SffiVICE CHHYSLIR.DIDIE & JEll'.CALL USTOLL. FREE18OO-77O-6582 get the available four-speed automatic transmis- So, is the Wrangler tite perfect vehicle for tcnd to bounce you aroutid a bit, especiallyon 5-Year, 60,000 Mile Bumpoe.to-Bumr Warranlyf sion. Of the two I would take theautomatic . the shorter Wrangler. off-roaders, families on the go or those seeking a I i . I, I , .1, I II .1I'I i'. _ as driving a Jeep with a stick in heavy traf- 5- Year Unlimited-Mileage Roadside Assistancet One appreciated standard feature is the clec tough and durable vehicle? The answer is ye5 bitt '. I I I 1 I.Ill . .1'if...IIt . 'I I ( : i : . ic every day gets old, With theautomatic fuel ttonic stability program, which aids the driver in you really have to enjoy going through the woods I t .1 I II I I. III mm i , economy numbers are posted at 15 city and 19 to grandmother's house. S . MUCH, MUCh YOU'RE GONNA SAVE S '-1 O MQRE ATGOLF MILL FORD YOU'RE GONNA SAVE MUCH MUCH MORE AT G O L F M I L L FORD!

. VOTEDONEOFrHF TOP 100 6 YEAR/iOO,OOO, FORD DEALERS IN THE COUNTRY 3YEARSINARO MILE WARRANTY r'- ON ALL CERTIFIED PRE-OWNED VEHICLES! .(_ì,, OVER 400 QUALITY PRE-OWNEDVEHICLES AVAILABLE FOR EVERY BUDGET! (._/

07 CHRYSLER PT CRUISER TOURING . 07 MERCURY MILAN V6 PREMIER ED. RAflOWTE1RMsasst WflACKffAMR . - . PtRLOCKS ILT. X293 OVER 2,000 CARS AND '4'$8,989J189t TRUCKS TO CHOOSE FROM! 5,989J319te

03 HONDA ELEMEI1T EX 08 CHRYSLER SE3RING CONVT. TOURING Vb . ONLY $500 *UIUM11C1RMIS$SS1O POR 1I(HEEL c P?«ER LOCKS LOCKS I WWX*S, TLT, CRUSL CD SREE ßIJ* DOWN. DELIVERS STk#ß398 ALL PAYME1TS INCLUDE TAX,' . $15,989,,$310t .: i0,989ar$239t WIN,.. SPECIAL FINANCRIG AVAILABLE ON TITLE, LICENSE & DOC FEE . , PRE.OWNED VEHICLES ONLY AT GOU MILL FORDI

04 KIA OPTIMA LX 05 DODGE STRATUS 07 UITSUWISHC 01 FORO 300 07 NISSAN SXT SEDAN LAHCER ES SENÌRA SEL SEDAN

wim r-;.,-T..,E. .

no&uJ iiía* *ion ißTMiEflASITSA1 WL 1W1(Lilly M11fl PMO b MIniMORAMM1vIn BRAND NEW 2009 FORD FOCUS uoON I W AniME? illE1*ni TLT iv*i, v & lxo,.urvT,0SLt. EsEl's, MII1vX iMisV's:.TMi554lErWR 101v u 1 &SElMI1U lESt_El $0793,AJJIEWBODYSTYIEI niJ&.rLcM,,i,Ixi4 'MSW«irU, cit$iiIi821 lin 11E G8ii luNulE lu,. ni ElI iIO*liSN cAtlE,.ISthNlaSA 6,989'orl49 '9989cr'21 9' 1O989«239'l 1,989',, 259'$1 2,989' or f279' 12,989','279' 04c8EW 05 CHEVY COBALT SS 05 NISSAN 07 DODGE 06 MAZDA CS OB PONTIAC MAUBU LS ALTIMA 5E CALIBER IN/? "flirt GRAND PRIX G? VN uknI' i *ur**r toii PO!.R RIA 0ElE WU P55 U MACL &IUIWR, EtIUOI&l* 11*10 50ES. V NwuIM OlEisilE ni &M0500X AUiY IMEILi tXX WiOOWI iv. cqis,, co, ns DiMi & tOcx. 1v, 1x10 &Yrff iv.cpins, En Of0EyIOflAPlEuRiXP& SloiiruiLiinwSø50GWA t,umtt51ø,2 CR1111, ISMW SI0#11IA CMini*JilIliC M,t kO DE I1vI1v,SuuM SlELR,COOluSit mains, 0IU0II1I , 7,989' ori 69' 1O,989' or 239''1 1,989'259'$1 1,989,'259'12,989' ,r279'14,989'or299' #82546, V6, . î- X . SFETV CANOPY; FRONT 05 DODGE DAKOTA os PORO RANGER 01 DODGE RAU QUAD 0S LINCOLN MARK LT O%iPnK6oMoNmsUAuur- CLUS CAB SLT XLT SUPERCAS CAD SL? NEMI CREW CAS AWD NAVIqATION SVSTEIt'I, SYfl/C,LOAÙED C

AtTtW ivS i vmiul WOMEMOUS, PIMTN 101v tN &M iv Mini PIMIR LnYI1 socI, ONSILMufILi NtUlAnii ifnii* i 1SU?NRII MAI10 LiAIS. stuMm . 9989'of219' 1O989'239' 1 698W , $339. 21 989' ,439' 03 FORD E-850 050000E 00 DODGE OB CHEVY CARGO 05 FORO EXPLORER OS CHEVY 1;9%PRAVAUAB CARGO VAH GRAND CARAVAN SXT CARAVAN 5X7 2500 VAN SPORT lINAC 4X4 2500 CARGO VAN ill's . tP!R 810 1 IONPIDI . liillitIs 12.889 oR219 - n .. SlAL NiEL*uitwlTuLIID.vAunv VMi1STD W i MLOYWERA CWIW DIAPAMI Nl5luu 1Ri'si vLtWIMRPw,tnt2i ISOMATIC 1Rl's A TX hUA nu,t's. 1v.N0,.m ML 71* . IMni lEy, nittioiOiniisI siI,xiill* WNIMiIT,N1K*1 Till, LnflSfll;IUOSI1* 6989 $1 0.989' or 239' 11989 ar259 s14,989,1 $1 5,989' , 31 9' 18,989'or379' V V I U AIIr I L IVIItiIos-rIVEH'C''I L ES #AVTDWTEWSRrSKpIOcRS& OSGMCYUKON . . SLX4 WITH OWSaYF UIP?EO ao , çt/r* ) t.$IJ,fißATING! ztuaaESu MsnEuE i, +J_ 19999 MStRw 18989', $3791 . . . O4SUICK ' 00 DODGE DUAflGO .. 0_ MERCURY , .. SLT4X4 MARINER 4) RENDVOUS CXL . ,,, ' luThi ._øIfl.lutist '12 r \.' Jí'ìsO ;_. invii ' ., AtER'S 11PM St. IUlI1iOth vg! iUnlç ÇACTORV INVOICE! rt anL AlEstA SMUtS S PACTEl. 11v. tma1i WU', uJ,xinnis tiiz 1O,989o239'13.989«299", 1 8,989'El9'

STOP BY. wE sox YOUR ANIMCL SPMIJSH OIJSH flUSSIAN ' CfiElJ( CffiMßH .EHITJJSN . filiPiNO SSYRMN SALES HOURS: MON-FRi 9AM-OPM, SAT 9AM-7PM SERVJC & PARTS HOURS: MON-ThURS 7AM-1OPM, FRI 7AM-6PM, SAT 8 AM-5PM

., STOP BY, WEiPE%K YÓUR UÑ6UAGE:SpAÑISH s»POLISH»o iLUSSIAO. ÓÌEEK o GERMÁN ENGLlsH FILlPINÒ o AS$YR!AN I WI YQWI RUTHOHZEU QUICK LANE mAw » s r"-" ?" r r »5' p- »TE"»PEN» N'ÍIMTIOpMí1P d 1171j 1r L a' a rip-kkj ìr rcri YOUR AUTHORIZED QUICK LANE DEALER 9Qa*kla . » . .94 COMINO FROM THE NORTH tul. &UI7Ot4WTM IkIT GOLF n.u. EAST 10 MRWUKEI SOUTH le ct pricespamenls ncIde appIicbIe manWctutei rebates 4QakkLaw, nd nceTUeS. In II8 Q sjecial tnancPcesIus i tille, IceTTeandÜOCee. Ti*4Ifll1oflfltu On sletL nls QIIMSP. MSRP may noi be price ai NhichhicIe sold inrade n Iiu al speciI ffflflI 294 COMING FROM TH NORTH . . 294 COMINO FROM THE SOUTH WIIi.aDTrae reII On se(effloIs. In lieu al Tanulaçturer retales. 2009 lord Focus, 2009 ford 1ue(o 1466-8:6-4400 uT OIMPSTIH EAST TO MILWAUKU NORTH I 9tt apn loi 36 inonIh 2009ford scpe, 2009 Fond (-lOO & 2009 Foid flex aie Oapi loi'36 months 2O8 1ur[doe & 2009 ford R3TQ1 a EXIT GOLF RD. EAST TO MILV,AUKrOUTH 2008 Ford F-150 is 3.O pr lui 36 munlhu, A ith approe ceit On seleul models, In lieu of manulatliirers relates. (X, StOOl per 81000 línnce wilh SO OT 'Prices plus la. title license a!d DOC lee. With approved credit on selecl cr1itied uséd cars. Qealer &iy down ivy ailed tuai selling price. Maxunuín balance $10.000 Inn 24 months. f Pius tax.tOle» license & doc.tee Used vhicles 04 FROM INI NORTH OR SOUTH niuMh U T Ot i fInafllflI WII5500 down Øus Ian. uhu. license & 000lee with aproye flus lax, !ille, license & fne, Paynneuls 294 COMING FROM THE SOUTH credit +63sed ou 2008 tMCCtotal TN retalieicie sales repuit+ +Oefeî prolil OoIOmije EXIT DUMPSTER CASI IO MILWAUKUHORTH IinanCiíIg based on B months j 7»9tapr with5OO down, used vehicles S14,000 er higlue, E. 04 ot newer tinancn,O based on 72 mouthsj 795 ap with $500 dnwn»with approved c,edit. Dealei will not honot any pricilig ouais in tItis UIT OEMPSTER WEST YO MILWAUKEI NORTH lomuuni bvei(undei uvuiuOealen will nulOTÛr nr . Ing unrurs n tuis averTsemgnt Puces arc Ouod,2 dais from te ol puOUaOen, Pictures re luí liuslralion purposes only, See dealer loielaits advenlienten1 Prices are gond 2 days horn date ot,publication. Pictures are lot illtidtration unposes only See dealer tordetaìls» . , . 94 FROM THE NORTH.ORSOUTH » UIT DEMPSTER WEST TO MILWAUI(EENÛRTh NUS SANCHICAGO.CO M SUBARUCHICAGOCOM i GROSSNGERHVUNDAI..COM c:a HYUflDRI ,TMiii. THE BUT CNNE GOSNGER ALWS SA..VES YOU MORE..I SAR,flUR NINi$$Ai No pAYMENTS FOR 3 MONTHS VE S9 !iVEST '±tiGES UAPR AvALAE YOUR CHOICE, ONLY..I GROSSINGER. . EVERY SUBARU IS EQ(MPPED WITH Th w . & NO) PA!T$IE.... ür- w .i 111 JUL Y f SAVESMONEY SYMMETRICA I______s - TOYOiTA. NiORTH A:O- r 0' C) g- V . , , Iøtk*, f.. - . lz NEW 2009 SUØARIJ ÑÌÌiIÌ C) ,. I mo. FORESTER aC, z. NEW '09 too II i ii I 2.Sx ' E o o o Io u, o tdEW 2OO HY1ØDAI ELANTRA oC, AUTO MUt427l9,4ATTIIl$P!G o Muflhl. 52059, 4 AT Th1 P9IC u, z o :' o 1349IIH9O59 IEW '09 NISSAN ALlUMA I NEW '09 NISSAN ROGUE o i i 19,1 78 149 u, IiIri'i w NEW 2009HY1JNIJAI SONATA S1,MAdEPnl. t7* lEs. ,1l,. 1AAiíiIi, w A, GL$iW ' . -.,,000 NEW 2009 SUBARU PI_us GET A DATr F11R38. !1G YOUR CHOICE, ONLY... -4 :f , ,, $1000 14995lt9O115 IMPREZA FACTORY REBATE! 2.51 NEW 2009 NYUNIJAI SA f, : GLSU . 3 DAYS ONLY! ThURS 9.9, FRI 9.9, SAT 97 per fl8,995* mo. 1H90133 NEW 2009 SLJBARU ;.'Wer"; 3ßtkkE2,&t IME.çapÍat Sa. Ikirilt, l5tIda rnirru!E,tø; keyli Zúro OUTBACK : . NEW 2008 HYONDA VE Jll1lli U00E1712194A?T!tCE MOSEL 05819, 4 *1 ¡913 P?ICE 2 51 GL4 Lim11 Model I #$U2283 Nrw.LoAsaoul.D - 2O595*,ll6go WE'LL SHOW YOU HOW WE CAN LOWER YOUR '15320 fl%. APR AVAILABlE' - . NiW...OLACIOM* NEW 2009 IIVONUAI GENESIS sioe MONTHLY PAYMENT OR WE'LL GIVE YOU... NEW 2009 SUBARU ., e::. . .., ioaded lOYOlA 5OO! 38V6 .. . .., Lenthsuol & .NAC . .

.: OUTBACK:., ,' ' . j,:,' ci STAR NISSAN USED OUTLET MID C TY.NISSAN USED OUTLET 29,895*LI$299. T2.5i LTD . PSl6?1 N!VíO0HK.. '03 Chevy Cavalier ...... : 02 Hyundai Eleotsa #54U ...... $5995 . ::'"' 02 Volkswagen Jatvi ,$g,995 ,.' 02 Infiniti 135 iiiiu 6,995 Award-Winifing Hyunda QuaIi.ty ...... 02 Suharu Forester ...... 6,995. 23945' Backed By AmerIca's Best Warrant( IJJø7o '02 Audi f14 1Si542& 8.995: $3495 1O-Yeatí £-Vear/ 5-)ear/ GEN 7225 N, CJor. *01 $9995 09 Suzuki Forenia ...... NE:YouwtEvouR. - LJnc.Inw..d 03 Nilsan Maxima 6E ¡J4WA NEW 2009 SUBARU lCC,CCGMi/' COCCO-Mile Un/fruited Mlles T . ;-u.MACURÀ . Ir.flìn,n.c $9995 O6 Ni3san Sontos ...... $9,995 )dr, i pj ARRIVIN 05 Nissan AMmo 3.5 SE i5O2 ; $I.oc8:kee*s ;'.....J . Û66.61O,2O5 .-,..- t} q$ . . lLV'. 04 Mazda 6...... $9,995' TRIBECA DUöMETflORKThNtS . DAft fl6 Nissan Sentie iF433 $9.995 PASS. 'Ol MemntosE.'20 iS4M 1O995 '05 Nissan Altima ...... _I. YDHR 1iX REFUND FOR A DOYH AYUI1iODNYl\\ 05 Toyota Caniry ...... 10.995 O:assJoanvilldo yaurlaxafREIJllsl bilna YOU; lasi pay 03 Infiniti M45 fua&4?o .1 i 200. HYUNDAI AGENT 200Z IITUNDAI SANtA FE 2002 MERCEDES C230 ZØO$117(OTA OØOU.A LE .99: -..--i- '06 Nissan Attimo ...... i 0.995 ,hWA IH5IIA t.. -, 05 Nillan Xtrnra G1311 ...... 1 i.995 . 07 Mitsubishi Elipse I7IC...... 1 i .995 07 Nivan Sentie ...... 10.995 3UW5Jl ,EHKLE$TO 1100 E:FR1,M. :05 M:xan Ouest ...... 10.995 2000 JEEP GRAND CHEROKEE?U '4,995 2001 KIA OPTIMA1i 'ß995 ia isuza AMIGa couvi: u p.& 'asfe1AcaI*vwP11IlnA 05 Nislen Pathfinder s544 ...... 13.995 3995* 2000 FORD FOCUSe thWMalSI '5.995 ffi 2000 SAAB 9.3esTh awfl 2OKMVSI 1O,995 S7EDRDMUSIINBST oioio ø3TDUThCOHøUA AVIO $1L995* '07 Honda Fit Spart ...... 1 I .495, 5'995* 05 Toyota Camoy tS5443 ...... i 3,995 03 FOBS 1.150a. nw S __.r 111,995* 2003 OLDSMOBtLE ALEROfZllll '5,995 2001 CADILLAC DEflNl724291M1f3! 1O,995 5'995* 2003 TOYOTA2003 TOYOTA 'O4MINI CCOPR SIbIL 06 Nissan Attimo SL ...... 1 i .995 SUBARU. 03 NISSAN SENIRA uA COROLlA s,(AMRYLSv '05 Mercadel C240 4Matic s4i1 ..1 5.995 2002 VOLKSWAGEN ¿OLFwLk 6,995 2002 MAZDA MIATA4 IO,995 '995* 09 NISSAN VEIA 1113130 12,995' .a5 SUZUKI FORWU riii u,IIS %J '04 Nislan Xtßflß 4x4 ...... i 3,995 '6 ;_ 01 HYIJP'.O&I SANTA lE 4X4 nmo 014,895* 06 t.exus ES330 fF41JO. . . 1 7995 2001 TOYOTA HIGHI.AI4DER 4X4e $7,995* 0F IED uoi MERCEDES SLK32OI '12,995 S7'935* Nissan O4MMD*DYAOM 'eLag!v.*'l O4 8gD5*I3O* 1 5,995* 2006 TOYOTA 'as s«aii B TIUBECA m,u, '96 Nissan Maxima . . . 13.995, 2004 MITSUBISHI GALANT SE1ll14 '7995 2008 TOYOTA YARISww4 on eius '12995 nnI* 2008 TOYOTA 'aß Toyota Highlander sllt . . 21 .995 . CHECk- OUT OUR WEBSITE FOR 02 TOYSTA SIENNA IIISIOA I,AJ,I COROLLA YARIS 7,995* '04 INFINITI FX3O vzoo I 7,995* ,jssofl Musano SE AWO ...... 1 5.495 2005 TOYOTA COKOLLA4 . 8995 2008 IIYUNDAI SONATA LTD V8I '14,995 2 MAZDA TfiIU11 1153111 11I9A '01 8MW 525xi ¡1NEW AND USED CAR SPECIALS: 9,995* 'Di seaum Fi CRUISEfi 1Ioo., S19,9gS* ...... 28,995 . 4 c*aiu.*c sx is Delïvers 9,og$ruiI57a. 2003 AUW A43tA $9,99Ç J 2005 CHRYSLER 300CMfltw 2rrai '15995 1II,u 524,995* $9995 '03 10Y014 HI5fflANEB au* .9 995* 2008 TOYOTA200$ TOYOTA 09 HONDA *ccono x V 2003 MAZDA MPVMIOtILY5JI(MLIS 2004 INFINITI FX35C 18,995 T SOLARA HlGHt(OS*W , $9 1Rvamctwvto,oa,waS24,99S* UBARUCHICAGOUCOM 9 MERCtES cuao o* Y, 1111010 J 2003 TOYOTA CAMRY LE . 9,995 ß1GE71 CHEVY CORVETTE ZO6W( '21995 126,895* MIDCi : O3TOYOI*SO1APA ,u,u*...... 0,995 '1O,O85.32 '2OD9"'34ß 'OB ACUM taTi. ninu. 4330 W. IRVING PARK CHICAGO . Va Gotta Go To the All-New... Ya Gotta Go To... 888-598-7467 8662384m . . ß6G-51O25O5 reN. LlNOOLt AVE., UNCOLNW000, IL60712 60712 4444 W. IRVING PARK CHICAGO 7225 N. CIGERO AVE,, UNc0LNW0OD, IL . 5757 W. TOUHY AVENUE. NILES MID CI'11L'I HYUNDAI grossirigerhyurnlai.corn TAMOY O0*f0 I OPOMTIT FOI OOtI 001M t . . 888590866G rnìdcitynìssa».com TOYOTA SCION NORTH gossiHgettoVotaftofli.cm . starñîssaflCOm88 8-5907491 Pll oAsis pliax iiile,PiN itoc hato uafiad buyoiow/UKciadit NT tabalea and moan M offa te II incenlive IardloatfnUananOffe!Seod i dan bOnI pub. ulited llis. ebi ppfied. ilos lox. t. ri lee.1J Sce dcaa et the rowille Fai cweIe deI UI" N'A Eiu1suillb, lut 'Ibül liI O??R!ubüe ii Ohlis pn i iuiu troal IppId Na píiarsaes ;E,$)NPauai SJb,OßBan Mc leel)CaiM uui ai aisuJ 111111iaIls ileulei will i,uuiioi incuì eiiws IIthis 3h bu iui sie tor 36 me ulilíe huywuAll nenUves ubates uapliedPluu as,ile, lic to quid IF1I, flE a ro1.OQEM and nay aItt lina p(it.u1 pa soAo hnance, aax SIAHAll Irnand. -a- An aeIl ave aod 2)Aa P$ltt hilpii AISP? iale,n,j,tb l)ttftutapaul aaPulJail 5)YAiiUja;I aipani AILuIliItt All olleis lo . sal 'AA-OAaoe3) AeIcrparnn nay aAI inaIioca ai paseM. No ptia: Dao iII noi honoc pJiint eJcoila tha. Ahi end 3 d,s ham pub. c In SI5) luil siluii I lPt J'lO 'llltjs '101nt uiiprIicliu Alsaillulki lriiaiItliNl isaui3ahe plauiii t-o

= G ., .-- . V . ." ! ... Three GM vehiclesmake Kelley's list of top 10 familyca Curre Motors . t.99/u x6OM8nthsAvaUte! Ç NICE PEOPLE TO DO General Motors lias thtce vehicles in tite To1, 10 Family Vehicle list p°, every year vc put together a list of the TolO Family V BUSINESS WITH g72MathsAvaiI1e! by Kclley Blue Bookthe Chevrolet Malibu (left), Tahoe flybnd evaluating an ever-lengthening list of eligible vdhicics on such and Traverse. ¿4D as resale value, fuel efficiency, capability and idd-fricndlinc o, "If safe, roomy and affordable ate the characteristics that juulifya year, vc put extra emphasis on fuel economy." vehicle as n family air, titen the 4ntcrican family has never hadso man)' The other seven top family cars, according to Kelley, ate ti choices," Kelky libe Book sayon its Web site (wwwkbb.com). cia Civic, the 'Thyota Carnry ilybrid, th\lWjctrnSportWag "\Vhile a sea of options is ultimately a good thing, itcan also the Ford liseape 1-lybrid, the Toyota ltAV4, the Toyota I li make it moredifficultfor families to pick a vinncr. 'ro bel1, case theI lybrid and the i lundi ()dysscy o 'D

Ç. ONVEHICLES SALE! PRICEO t Spark Your engine requires s Oni ! Nothru - WAY BELOW IHVOICE!+ Exhaust onday' Intake plug ignitor to set oft the valve valve explosion of aI and ga I Combustion that producos power t chamber move your vehfcle Electricity from the 1g '?r.'__ 3 system sent throùgh- Spark spark plug arbs from 200Y CHEVROLET COBALT plug center electrode to t Sk #.Afl23 It ignites ground, This spark i air/fuel the air and fuel in th& $8,950orSI 39/mo S9,850or Si 58/mo mixture combustion chambera of the spark plug's Ç Two Subaru models get components are tnte a nod from Kiplinger's Personal Finance Piston prevent the spark fron t's.-,_-- Connecting arcing to areas othei, Ç Ç- CtIiR1t\' I-JILL, N.J. I(ip1bgcr's Personal Finance rod -. decisions and wise financial choicet. The Forester and the tip of the plug, s : b, -.-'- has rccognicd two 2009 Subaru models in the the long ceramic insut Ç, maga- Impreza both offer versatility, performance and value Crankshaft zinc's 2009 Car ßuycrs Guide. The nU-ncv 2009 Subaru qualities that have long resonatcd with Subaruowners Forester 2.5X (above) bas been designated best 2fl9 new and are even ii-sore important in this ccononi)" . Cross-section of wiá - st14 isaAOo8 - crossovcr in the category of small crossovers, and the Praising attributes that made the Subaru vehicles 2()09 Subaru ]mprca 25i h)S lcen named bcst in class stand our, the buyer's guide cited tut' Subaru lmprcza's Si 6Q99or S2391mo in the wagons and minivans catcgor) standard symmetrical all-wheel drive and safety fea- Best in class and best new winners arc chosenon ture, asvell as Sttong resale valua and "impressive" a basis of perfotinancc, value, safety; power, fuel clii- POvor 500 Pre-Driven Cars Available cargo room. ckticy, c(terior design, interior room andcargo space. The 2009 Forestet' was lauded for its affordabiliry Aft GM CertIfied Usei Came wiLli a 12 Moth/ 12,000 MIle Bum' to Bumper Warranty° PLUS a 5 Year/100,000 Mlle Powerraln Umited Waffanty° '\XTc arc ver)' hippy to accept these avards from Ki- and symmctiical all-wheel drive, as vellas increases in Plinger's Personal Finance," said Tom Doll, CXCCUtjVc size and ground clearance over its popuhir predeces- .Icc pCcsidcnr of Subaru of America Inc. "They're es- Inside the spark plug . sor. Alluding to the new model's go-anywhere ttatlCrc, - 1_ *UO1 S3 uw 2w , , , - pecially mcaning6il coming from a magazineso keenly The Insulator, made of nsm Ef c*b N1 CARLO caoi I%., iscrm - the guide pointed out that "it performseven better on - 3s.otJIs&øLPI4 Full Powd Suc. ØAC2SOA Btu. ILPI3M Lo. St1 flose6e - ceramic, helps keep electricity *.I8tIi.lAc25M focused on advising their readers on smart purchasing snowy roads and muddy driveways." -- , $5 99!or $l9!rnò" -$5 995'dr 5791mo" inside the plug. The insulator -.__.99 keeps the current from arcing and causing a spark where it's not intended. DiverstyInc recognizes ChryslerLLC Spark plugs are made to be 21LS ia removed and installed with a six- IbseIø,iMoo,vootsiIC. ttPI4ITA AUBURN HILLS, Mich.The editors of Divcrsicylnc ."Innovative companies such as Chrysler have point socket which helps prevent 99ipm' 7.:995;, l9imó $7 995o, s119ìni s9995 magazine named Chrysler LLC to the magazine's 2009 switched from trying to move the status quo to estab- rounding of the shoulders that might :6 995r s158Mio.. list of 25 notcworthy companies. This annual list is lishing a new one," said Luke \'isconti, CEO of Di- prevent removal of the plug. composed of çompanics the magazine's editors believe versityloc. "Smart companies ace increasing diversity "arc rising diversity-management leaders andare close efforts in an economic downturn as away of beating Ç 23 iW 27 WW Ç CALAC _*AN 7 Z4 ' 4C - LI 7 VY to earning SI)OtS On the Diversitylnc Top 50 companies less-adept competition that vill pull back." 12 pointSix point PLA LS AIV LS O«&4S 4Iar_4 . W1*4 Cy Lt 4 AV41i' LiZ list and have strong potential to be named to the Top ÇL K eHIsti MeceA A Ai $&JAAIO2A - LOADED, CC4thTCPI ßC. 1LP1421 LQAfØ Oc.ngs SiX. I1.P113Ç to*acu. Law m..t e*. ,t.piiist.eu Mociimo1i StE 10$2A L.stheç Moormofl 81k. Ii.P1122 50 list next year." Electricity travels through s9,995si 58fmo' $9,5. or st58imò» $29,995. o, $446/mo-' This is the fourth consecutive year Chrysler has an electrode than runs been included on either of these two distinguished ihrough the middle of the CLL TODAY OR SHOP ONLIPIE 24 HOURS A DAYWWW.. LI l'ri C hvya oni spark plug. leadership lists. Both the Diversityinc Top 50 list and the 25 Note- This lip seals against the wh9k$d worthy Companies list were announced March 12 in cylinder head to prevent exIt beIleèñ1 New York City. Selections for the list any of the compressed Currie Motors - 7901 ROOSEVELT RD. arc based on cm- 'manufacWrã NICE PEOPLE TO DO BUStNES5 WITH - a. aa. s asas pii-lesI data submitted in The 2008 Diversitylnc Top 50 air/fuel from escaping. Hure aredÍò (ROOSJELT & DES PLAINES) ¿Ç Companies for l)iversity survcy different typeán Power traveling O market. , /Ç FOESY PAKK, L SALES: "\Ve are very proud of this recognition, particularly Ç - through the electrodo MF 99 & SAT. 9-7 - under such challenging markct conditions," said Nancy is forced to arc to the lt_of t'i C, Rae, executive vice president ground post causing a SERVICE: human resources and spark that Ignitos the OffiàLET 88579-5543 M-F 7-6 & SAT. 9-4 COifliunications, Chrysler LLC. "Going forvard,our aIr/fuel mixture in the Split groove 6ï: ÌREST PARK www.curriechevy.com diversityill continue to be a source of innovation and combustion chamber. III 5I ÇÇ,1 -y Ç IPCCII I 1 III ç, Ç tt 11511 IlbYJ9f%UIP i4$1 '14 i.at&w Ç competitive advantage, and a key factor inour condii- - aiQ iII I SI lessktiÇ uHaumÇ "Aabi DiLtE) « hWÍ ued viability" i - s bP6 I IIIIIk+tJIfl + I I 'I COPYRIGHT WhEELBASE COMMUt4fCATONs I5i I 1111 I I7I'1 IIaa' I . «ÇÇh Ç Ç" ,r, - - -'- Ç, Ç Ç"!IiÇM7' 1vv, pACAB DR/vt vEB DOWN ¡lOME TODAY WE MAKE THE'BEST CARS RIVES YOU HOME IN A NEWOR USED CA , , Keep Americans Working! : MANCARI OAK LAWN ECONOMY CARß IMPOATS (lt 2004 CHRYSLER SEIRNIG TOURING cONVERTIBLE kcOfld0nifl0. poii« iifnøotia power 2002 PONTIAC GRAND AM 2004 NISSAN PFUIfl '"I tM Loat& Iu?nn* acnnta Jne, iinøn, pow $5995 Fu0 loaded iJk7lal .,!r Aflledcan 46rM(D Md3fliC Spocial-needO ennne. Only...p2995 , FRANK MANCARI cks,AM006t1I, ciue. 5b02I99 Only... cAMÇ6W, bI auge 0 $8995 S. HELP WANTED 14i21 . Owner, Opethtor S; 2001 CHRYSLER SERRINO cOUPE 2002 SATURN VUE 4X4 2005 CHEVY Avio i.s 4o Taxpayers [O0d 3.0 rcRd6nV POOS1RI) .- . fr. Lnfit. 311 tO, oulo$aiC lltCttiditk%iíflO POWV1$tCIí9. SALES S $7995 Onaln7as'Avtoma6 .i*.SSS L aina,fflc, Jfn07at?s intoin0owS, øWOtaiCk$MffM0W. on,v.4995 Only.., 6f.i. bMn - ., S If. Apply in Person. Business is Great! oIlxtnyMtninfr stkt24H7509 .$8995 45 Yea, :. o& d1jÇfl1. I 2000 DODGE DURANGO 4X4 OflJ'. PWI 2001 HONDA CIVIC U,fl1ps,er. Immediate Openings. 7yO.A?4rAc.o(o:r4rn 105. $ 2008 VOLKSWAGEN T Automotive tj OJ?0m411C, air cnid4icnirn, 1o4ni,?r ii*0innar6s, b aviso. 181 I78I Only, 7995tojded a00a& af('46 po*T lt WitO fOfYttLXt34MfMVO. ail íxtsnn,. Brand New 2009 Experience : : You own the company. Brand New 2009 .13,995 , S 2005 FORD EXPLORER XLT 4X4 JEEP 1997 HONDA ACCORD LX VR 2002 CHEVY VENTURE toad autnnA a'r0tn powet wiodco pnio $99952007 HONDA CMC EX CHRYSLER tiei ijtttflftIC, a,rcroi5ni'rQ, II« i10d0O WBt Lo9ed, 7passenge 3iai rvwsea auto. oir ccnd'6oivng,A8S 6rk46TAft tft Oflß$ Only FdnmilniiiUtcn7d' keloso only, autnnalic 6eadiarnps, Mpoinr sail t.056lI JXfS'I. Cflt0 OnlyOiKCtttrlieditWlOW(flflt$! on;y5995 0dOi, uiiclock 4MFIÑW, (ctny , Iy.7?4,995 ii 2003 FORD SUPER DUTY F250 EXTENDED CAB PATRIOT - r- 1999 JEEP WRANGLER 4X4 2005 CHRYSLER PT CRUISER toide. 2005 HONDA ACCORD SEBRING ofOt3kpinot el-rood Loaded outoniatit, afrcxth6n7109, fnwerv.adnin, ¡%7ørbrake power ii:0os, otIl.0t Lad&, OOnaOc. acom6fr.nJ poiw flfflJq r-T- (f Af powersl.nw?g, or Oflfr...59995 . . oflly..6995 lcc's,A/.tfMVO, t,llslceedrq. Lowarilts. CEO OREO' lxly A%4M16 c'nnn. OS i0255P9 $16,995 . YL(n "f'S 2006 DODGE CHARGER SXT NOW EVERYONE GETS Rdadc OÏL t á0mai okcnbn on 2005 INFIN 035 COUPE EMPLOYEE . $18,270 2005 CHEVY COBALT 2002 JEEP WRANGLER 4X4 3 SL 4'v " LIST P $20,705 WM6 6lLcnnse.stk#3.0224.fJnly 10,995FL ld aulosfk EMPLOYEE Jul ced 225 4 ql aLlnna6c, ait cnXti)ih79,pOiR( OteCI69 Haond1 roai11oUC girkli6n7iV. ¡»o«sle, oelL% dm010 ca6 Cose speakn kanln#I PRICING PLUS EMPLOYEE PRICE RElATE: -$868 EMPtOTEE PRE REBATE: :.iefitnkt tt1TMSItTOO Goat ngasl 2006 FORD FUSION SEL PRICING PLUIl., -:995 7995 Only..7995 to mp 6i07 ,nIIa $161tonoo*i111r.$2 1,995 MWE$T OWNER LOYAllY cowsu*B REBATE: ' -$500 -$500 2001 DODGE STRATUS SEDAN 2004 NONDACIVIC LX s,MM6Mauoe stt39 Only.,. 2008 HONDA ACCORD EX-L 1 1,995a_J_ L..A&4 I Ci LE A.tIW ¡,*SM 1,1*1fr stl#77019J.9 MANCAR!DIScOUj -$1,907 flMWEST OWNER LOYAllY -$750 Fkod& aiTheroIenoutama6C air coridthnling, ppner L0i1f 80(O3L .iitCO1916010PQ Xii0 IiaiI6'4 OJ4OT stk# 553O-9 fthi5JIW kJCk AMfM0, 6l cnaic. M;AATh6w, 6t.;cwaiosiks i2I55E4JB oly...8995 2007 FORD FOCUS SES MAMCARI DISCOUTh -$1,965 t0ad au* &7lnr iwfl,,nloiin, power 5 01kV 302499 : i ÏhL.$22,995 Sou 2002 CADILLAC SEVILLE 2005 PONTiAC G6 VB bcly,tt6UW, n'or.le!rcnt Cnatn, pas'sms2-02l9 Only... I 0,995 2006 MINI COOPER S CONVERTIRLE itJ4iied leaEhe(ffltOfln automa'* a:rcniai6nlin9, power FiiIlyloadcd poweisuiirrn( aulrniatiair cnlrittinrnO power 2008 DODGE AVENGER SXT Supn3ia ¡IL 4 heat&l&0&5&2 oardofsn, powwlxksAWFMW, tQ cnitso. OJIStfI 6cAs AMMW, W couse. Only...p8995 Onhy.i9995 $ sta90(ya0rAh6 . . 0u0. a6ir1jm 6* iwro sol QtI1P I Only... 12,995 40!jA!:$23,995 . -S. Si oM;dzo:or.w,.n' zooz JEEP GRAND CHEROKEE UMITED 4X4 2008 CHEVY COBALT S A&j?ty t3dt1 eathn Menor aulttiotk oirc.widttionir#j, Oient roipaslAutwna6c, oir onithtainira, 2008 DODGE CALIBER SXT $9995 Mdi6Of'!nO ftf fJiQJf or tacks, ,iMR6VO. bZ ni/iso Only... poowdownpower9kaWEMvb, tíicnose. Ooly... i 1,995 2. aufM23l AMrM'ÇO, atjminum iilnets, Ont 6to ß1hV.. .$15,995 Brand New 2009 Brand New 2009 f. 0»nM6FAW, ¡iL mise sf613.o4.9FACTORY WRRRANTY 2006 JEEP LIBERTY 4X4 2006 SUZUKI GRAND VITARA 4X4 2007 JEEP WRANGLER X 4 4 JEEPØ 2006 PONTIAC 06 CT COUPE £n0 38L IaIfCn0cFo(0,48J)fbOÇ IOWJ96 CHRYSLER LÖJiai 0t1510! cerMtd, autarnec afrcnitJ,L'onlnO. pon« 'I) Fulivtoaded. avionic, oircow.Oíersng, power erodona, pc'wvr 5 . $ 6ittnvAA(MW,tr2vner* oer I tnt*A6t600VO. - Only...fi,995ki'Á,AMMW,bIlr1wse. Only... 12,995 side airtag 0M'FO6VO, ckonie **ee 01 l2Oi3S78 Only... 13,995 LIBERTY (xtcvywa'ronty Oo)mß. loiiiwoM2-0t9309 TOWN &Iì -. ' VEHICLES: .;;e EAR 80 000 MlLE WARRANTY ON ALL. CERTIFIED PRE-OwNED; + COUNTRY 0 iST TIME BUYERS NO CREDIT SENIOR CITIZENSINGLE . WiDOWEDDIVORCED MARRIED NEW TO THIS COUNTRYNO PROOF OF INCOME SELF-EMPLOYED A USED CAR FOR EVERY BUOG EMPLOYEE us PRICE:$26,165 .:ITOLOER 4i EMPLOYEE PRICE REBATE: -$1,293 EMPLOYEE 41 LIST PIUCE:S26,00 PRICING PLUS . GWSUMER REBATE: -$750 PRICING PLUS T EMPLOYEE PIUCE REBATE: -$1295 Ca-SIGNEfl VERYBODY DRIVE REGARDLESS . oRE g3 I . l5TO(OLfY:CHRYSLER RNAJiCIAL BONUS: $5 00-$5,000 ot ''' II. Ill MlNlVANS&UVS LUXURYCAI 41,000 I' CONSLJMERREBATE: -S500 ocon inssien6q,ie'al to ¿c auci3 cciiiisbca, poiir imws, poiwr $ 2002 CHYSttW7 PASNG1RMIN IVAN 2007 JEEP GRAND CHEROKEE MITEB 4X4 IIßTtL}Y:ASE LOYALTY: -$750 l $ I1flFWO!Geafon asts2.(t6P.9 stkD 221J-9 Mt6TOIQFY;CHRYSLER FiNANCIAL BONUS: -$1,000 f «ks.WFM Re,kY6' Only..12,995 ,MVMW. 13,995 !.f1 1 ?I I 1fi(Yflfhf 1f!IYYÌbfThffI $499530i fl60ThEAenanalbZ in 5 MANCARI DISCOUN7 -$2,376 Only... ¡eaet intnicanne ieeL fxtïywan.cd. stM2-OlOOhly..28,995 FACTORY REBATE stk# 77002-9 MANCARI DISCOUNI0 -$2,710 006 CHRYSLER 300 TOURING 2006 CHRYSLER TOWN & COUNTRY tkfflflII automa &rcondmonino, pOi%0t Loaded. aofahcJrctii0ibcrdnO. cD ee W& 2006 CHRYSLER TOWN & COUNTRY 2006 DODGE CHARGER R/T DAWONA i; lx A6tl tilt cruise. Only...13,995 wfndoi*, xA4M $ p3,995 tnî4el. 7DaeTh 3'1OW 32L avf acnn, FvIJyJo.ided 5 iL 6 HE6 !eaOer Ifl(isons 00116 avIo. û 2 1,995 ct(lfn9 fulpower, T060AISAIS4ÎSUcI2-0JSl-9 Only... 2008 MERCURY GRANO MARQUIS tinf iindos, rk1666V WanISe s61 25l39 Only...p8995 005 NISSAN ALTIMA 2.5 S 2008 CHRYSLER 300 TOURING - 2)' b3fd, autonit.c, an cond,f.n:ra, nri4iinn, li+nr $ FLJoade aunaI, ajrlwvniinoi, tivr$ 2005 DODGE GRAND CARAVAN SXT S.- S -S S criase. OJy 14L cerlffiedms fiity lnd 3.51. au&n13t trcng, O*II + J x AllM 6! ciulse. 0* 26(ccdi6edmiln jx,A1MW, b1 íJgify,. 14,995 Ñtthi& - S Only... 13,995. s t l9Oi4.. 10,995 tikt#«TM6 a 2008 dodae avenger sxt 2006 CHEVY JMPALA LiZ 2009 DODGE JOURNEY SXT s 2007 FORD ESCAPE XLT JEEP® Brand New 2009 LO3ded Z4 au(omai airoyf.6tíctThZ pnnvseaL Mw $ CLise O.. 14,995 FURYadCd, autøn2a &thV. pOweRt)1bi 5 5 6 «FMC0&teThteP.id W cie. .R11FIEOI1IS I.LIJ4,. 14,995 seat heated seats AU0MJatethte RÍia sIki 30242Pt3flly.. CHRYSLER ' IMt wïe.s13269 Only... 12,995 18 995 2005 BUICK LACROSSE CXL 2004 CHEVY MONTE CARLO SS 2005 FORD FREESTYLE 2008 CHRYSLER SEBRING TOURING CONVR1WLE rf»'r a6nLftefly autniia cnIk s GRAND fYkAl4T66 6av6& 5 wtdmkOnly... 14,995 n,yvo leaThe 3t,wseCaütoírntair FlLkn 2.76 fthth &lmn6, auw Only... 14,995 cdibn, Mpoini;AMwcv. tL cn. sLkS 30265 flnty...$ 12 995mi«t6MMe2Jly...5 17,995 3OO .MPG. 2008 VOLKSWAGEN JETTA 008 JEEP COMMANDER 2006 JEEP COMMANDER 4X4 CHEROKEE afrcthtioroa. 2006 CHRYSLER TOWN & COUNTRY UIr1ED oJ wnIerCerP6., 4 IL V8anlnnatì ¿c,dd $ Fidoade autom3 5 ¡.pasWLtnIly6fi3l 6IfXma?&fÙ frX&Y& power iiaÖ et*AMMO. stiJ7929P.8 UST PRIcEs$33,050 ffiV ke1sscalyAMfM?. Only.,.15,995 16,995 6,995 EMPLOYEE 4 -,. hzOøerffk3t0t2O2SEPMVlGM1OAML4R DID EMPLOVEE PRICE REBATE: -$1,625 apr financtng 2008 JEEP COMMANDER 4X4 2008 DODGE CHARGER SXT 2008 DODGE NITRO SXT 2006 UNCOLN MKX ZEPhYR PRICING PLUS Fi'yfdel 7'psseriger. 3nitowseat. auíoma6c air 3 I at f4seaL A*3$ ktln n k3VO ,4n7nUWiitffg, coISUMER RERATt: -$1,500 UST PRICE $27,415 $ $ FiIke ilL utomab W(C)d1V, $ $ EMPLOYEE clf1&wf2, Ifi M(fWCO, W cn,is Only...16,995 Mwe 216i,ffa,o kS l2l48 1 6 995 ti1 nun stAt 302i3P0nly... 16,995M ¿.UTMW. nne * kinile *3G2639 Only.. i 6,995 TOIL11:CHRYSLER FINANCIAL BONUS: '4t EMPLOYEE PRICE REBATE: -$1,000 -$1,351 2008 CHRYSLER TOWN & COUNTRY 2005 CHRYSLER CROSSFIRE ROADSTERWfl&RT1BLE 2008 DODGE MAGNUM SXT 2001 FORD EXCURSION UMITED 4X4 MIDWEST BONUS CASh: . -$1,500 CONSUMER REBATE: -$1,000 Only 6,Ç3.O cerednii(es, auoira6 aI(C(077 pcsi« 5 uQj$ Lnided &j*na aktmV. Ii«Mf $ Ftilft,adegO&vl0,0octer f.'ndJ ff1 66Th6W, 6ftmns i6ng. Mpo666t (51MLflLEASE LOYALTY: -$750 U5T0tllfY:CHRYSR FINANCIAL : -$1,000 Only,,. i6,995 * On.p18,995 *rA446FA01b a7isILO Ufli9f'9 Onfr... 16,995 6w$mI3O2Onlf...5 14,995 55O21J9 '-'S fSf S, fiVi -nj' MANCAR! DISCOUN7 -$3,680 lST0UiLfY;MWWESTOWNER LOYALlY -$750 200SAUDIA4 2008 CHRYSLER. 300 TOURINS 2006 JEEP GRANO CHEROKEE 4X4 2008 JEEP COMPASS UMITED 4X4 stic# 33O1-9 POWERTRAIN WAR WANTY 1emeîlnleìimonuvol autnna al, bsead fiit s Atndufelkiaded, nio1 IeJUfetIa(n$u0 M 5 Aw*arcaxÇ MANCAR! DISCOUN7 -$2,319 stS 323S2-9 A6Th s 7-8360-8 5 7995 k,1senhiy kiwmJìes. SUMl-J3ôlPnIy.,. 18,995 sfk13.0253'9 Only.,. wnT*6 34R6U 6 a Only.. 13 995 nr »I Oiit'... , 2006 JEEP WRANGLER RUBWON UNUMI?ED 4X42007 JEEP WRANGLER UNUMITED 40)1 4X4 2008 DODGE DURANGO SLT 4X4 2004 CHRYSLER SERRINO UMITED cONVRi1RLE 3 IL 6 c1, ûmia T4 elc6iye, afrcøna o Le ßutomac, frC1flO Absdu3 eJffie(k7(n; au 5 pq.vcrw4 &wt#vtv. ff/4 LJU Lf IIWr s IR Q4J paiinrlon,i,n(0M63rM sIki I fen()2. piní tXaeS,AMI61.6VO. Fantastic Cff4lnt! Only...18,995 cksYO. $19,995 unly...a 11995 E;: 008 CHRYSLER ASPEN UMITED 2006 BMW 325 Xl 4DR 2000 CHRYSLER TOWN & COUNTRY TOURING2004 CHRYSLER PACIfiCA TOURING AWD Au(etIoade1, mr Ieathetii! amibc, air $ 5 FLA3dni 36isso jtwíg. FIVE aTAR I)1thIfl, !ullpaiie Ca tXceredmñe OnIy..25,995A*l2U7OnIy... 18,995 tCIL& sl l.4»3LOnIy.,; 10,995 ,..2 1,995 Flv OrAR 00000 FIvE STAR FIVE aTAR l-4 fl Y S l 00000 *0000 G I-I R 'Y S I. E I 00000 Jeep rJeep T:4630 W 9 ST OAK WN DRIVING AMERICA 8821 W1 15r ST ORLAND 4630 W.95TH St, OAK LAWN 8821 W 159TI $, ORLAND C P-I R V 5 L in n (708) °'423-O91 o Jeep 708)4609400 No fllOflev down. 0% aDr Ìioir 'g for 36 months onselect 460-8400 veIcIes, h quaIiryng °423-O91 O (edit, aIIfebaes and incentives assigned to deâseedeaier LI_Ll Io d&als Prices ae pius axitJeJcnse and dóc réé; MAN CA tanufacturr oers subject to change without notice All offers I Block East Of Cicero Ave. Between Harlem & LaGrange Rd. n fatt truo apd expire 3 working days FOm pubiicOtioD dabDealerliII not honní eirors n this avedisenient M.ANCARLàorn ISUZU '00 odsO LS, 4x4, ACURA '94 LKend L MAZDA '95 , 4 door,titl, 'OSSubaru Outback CHEVY '71 VEGA 1052% DODGE '01 Rum 1960 Cargo $5001 police Impoundul X 0840f. 44fr, flUtti, (her, 94l ml. all pwr, c.iînroot, looltror in! eno coral, 491? AlI Wheel drIvel 913,995 lactan' alock, besutitol Van Entended. MIMO, soldo .war%J28Kl73d039045 C extra Clona, nsrÓ5t, Z5O. sis. 7OO.4156O5I 6308850298 grand.uberu.com bodyilntortorruns und drlvuS, metal doOr. window bors rune Vens (rom 5OOt For co p--3 77a619.1962 Morton Crone $4513M ODO, P736333965 encollent, I owner, $2ko. Listings WX)4737523 tC434 -L T 847.5033.343 o' ISUZU '99 Rodeo LS, Me,cedee'OS C240W4 '0$ Sobaru WRX Silver, 4 doOr, stIck, foil power. I J r- MERCURY PJ.4737 JOE RIZZA '92 Acura Integro only TOOT 51X1 Turbo DIacki $35,995 TOYOTA 'Dl SIennA XIS, olloc's, Benuillill. $2909, CALL NOWI 630595-62g0 gcundxohoru.com T-10 VANS '9e Codeo Cuisson 1 nons., Ittir., I owner, ose.. toll 847508S343 Polleo Impounds! For 809103.4* $5.961 $5,05X1 0130. 709627-4256 866-4074251 REATION listings 8004737523 sVOOI CHEVROLET '96 Suburban 2_500LT,'1i4, blue, i poux, MERCEDES '9G 5420, osto, llAr, '04 Sobaru Dolci Tucks ueo '06 Oid Charokee SlIwLlAr! $12,995 toll powor. allosrm must PldvIu I.E ,_ Co, AC/oot, 1.T thronro rims sso. S2ía. ' *'P14647 81.3,995 or $24 NEW 2009 LINCOLNMKS 0365950250 grandxubaru.com DODGE '08 COrnean, ØY8A7 s A/C&tieol, IRPLANES AudI '05A4 K86. $12,500 Asking $8.095 Call NOWI 888695.731 Dic* MeIaWC Leo,e,, Natar Uao wa Tedi Padcago, looks/drives like new, grosS Ori 1105f, '$325i5 ¿B 1087151997 OATS P0 WER #p14736 S14 995 o, 5289/Mo Oho. 1092963957 gao, $23132. 7733107909 Bias Racto, VB, Renr Vaw Camera øL952 Vcalufl.I4aII63 CALL NOW! a8.a'95'7313 'PP:P,'I: OATS SAU. '04 SubOrn Foroxtec 2.SXS CHEVY '02 Eopresa 2500 Sport OATS SUPPLIES Letker Root, Alloyel $13995 Cn,gs Ven, 11651 Odder roch, 43Mh1ot $206/Mo Sholveir. ecc comí, runs erool, DODGE '97 Coreano VII, I LEASE MInI Couper '06 6365950250 groodoubaru.com 141 SUV CALL NOW! 88&698-731i /Mo EASONAL SPORTS 53901.2000. 790290-0986 - green, dorm lrrlerrot, good AUDI '02. Quattro, all wheel #2000S7A $13,995 oc 0276/Mo (39M05) ECREATIONAL loaded, outiWol nranool 120k CAti HOWl 888-6987312 sinner. EserytititW wOrkS. i FOR: $1832000. 3125131412 'OR Cadillac Encolada mIles. $5950. '173405ta'04 EHICLES . Toyota '02 Comry $25,909 8684437537 I 'O2C Ventora herltog000diiiac.00m '02 Jeep End Charekee t.orodi- MU$WÑ ALL NEW 2001 FLEX I OTO RCYCLES Arito AIr PW/PL AC, PW CD lilt 8. Macal MITSUSI5III '02 Galant ES $9,g9:'i : 3551091 si,°jb 8863I'-6951 77 SCOOTERS Call 8886792244 DOCIlE '90 Onra000 cO,RAS a KRS IN STOCIU '98 AudI A Osnttro 2,5 4 dr white. 09t ml CD, toll pwr GlcrdrloNissarl.com T prsnengsr. gWen, runs AC, Moonlooll PW, CDI frust noel $3933. 4798209t1 grenu, nlusl seo, $1,5X2. $3,990 8886366557 '05 Csdihinc SRX VG ca 0% APR AVAIL C,,ll 847-5681343- $20,909 8684437537 NEW 2008 UNCOLNMKX BOATS POWER 'IOYOTA'OlComry 9051ml., JEEP 'DttOrand Charabias ¿roc, COnO,, black, all power, hnritrcgetDdllIac.00el '01. Chan Astro Von Loredo, '154, block, 4 door, p HeatitCoolod F Saals, Du Temp Cocm SYNC VoAivatcn. MltubIt,I '99 EclIpso CD, 563132.0306163382 loniher, lull power oilnW, CO, .99 33 root SC, Aolomatic, VO, AltI O%AP Reyerse8ansg, EI*yI(OyPad L85695 Honda '07 Accord EX Cica AM/I'M. Roar SpolIai Webb Crony $4905 FORD '91 Winstor, 7 paso, oli Cons, bnautlbul. 4ust 5001 Q) OR: s G, flat scrl OPS, $5,7958883554031 8P14549 S155OO or $268/Mo . 7909534118 power. CD alarm, Ostra tison, '99 EncabrIe, 13,299. 84761651352 sri AVAILABLE I .;. flew Icon glass. CALL NOWI 8868957313 CADILLAC 23, 133101, $Y3i0 773629-10532 HIock. Looks A rufo good na,fC nd heat. now TOYOTA '51Voiolls 5 speed, $',S09jbost. Cali 7134900150 BUY arlos, $53 cXcaOßO. greol condf $4500. fall power, a'l 8478123933 '8 NIssan AltIms 6305626584 CHEVY '91 Ashy jEEP '9G Grand Chcrokoc Ltd I HONDA 'OS Accord LX 4 cyl, #P6695 $19.981 ConversIon Von, AWO, wirte FORD '00 Windatar LX, 1iwr, extra Clean, FOR: Morton GrOVe outstending cond. sik Wiles, 8664031251 & l,ui, loll flower. alloys, yrrual. 7 passenger, Blue, (till power. CIIEVROLET'985.1.0 ObIer o Owner $10,900 ob. $2,700. 773509026g like sew. $25J LT. 4X4, bIrch. 4 dOors,iCr, 7736191962 _4 70ó.352658 'OOTooth Cumry LE -Coli 7737258431 . nuotI, CtnIloyO, tcsaoly, spec a, d ocrotIonaI Vehicles o '06 NIssan AttImo CD. A/C, Mach morel toll lignIs $28X1. 773-907-2261 '. SS/Mo 8886366557 1185272A $3.6 t9j JEEP '95 Cherokee, cleari, NW 2006 UNCOU NAVIGATOR NEW 2009 UNCOLN MhZ 95 OnmOn, 32'CItino 866407.LiSl Chevy '95 020 Cargo Van '98 ,md Wlnrlslnr looihct, CD, alarm. rofln good, O p sir, '97 Honda CIvic LX o 6, rear 118, dual AC, PW,.TlILt, S Morel SItIO, strong Ontyr arI trIs, Enei 1131313649A SLOgO CHEVROLET '9ISUDURBAN - $1875 ODO. 708-3239907 P' oc c'cn & floro hOi Orig Call 8lt86792244 2590, silver nid black, running , O ca I od' conti MechanlCftlIy SZ99.) 8888366551 '(IO Toyota CamaS XLE hQnt tod tir. good ires & trues - O o AC, P05, CII, SRS,& Moral i',lcndoleNIouian.ÇoW hourdS alcC! Musr seal I COOl $7c*c. ssl4ng '05 Nieson Altlmrc 3 -C $6,9908886364557 $999 7739767170 $1406. 847 9b32tXl11 6fl278t #PCc6S2 51.9-981 Jeep '9sWrangler Oreen o NEW 2007 FORD F-150 NEW 2003 FORD EXPL 868407-1.351 o 0W4996 1V4X3611 HONDAS FROM $500? '98 Ford WindatOr 4 opd, raYs clutch S srrdslulsld, sul , ca PolIce Tmpoundsl For TOYOTA '00 ECHO 2eir, Chrysler '06 Twn&Cnsntry Auto, Air, Et,a Clean, Rune urban driven, 8-movable hard top w cesso '99 RIALTA, 122k ni, CD pliryor, tiolOrrlolic, Wc. Listings 8OO473-7523 x3436 NISSAN '96 MaxIma. #P14653 $12,885 or S219/Mo $2500 773-87G-7170 u, MotarIrorohi A/C, rullo rood. $2lXt 000. CALL NOWI 888-6957312 Greet, Sharp $2895 4Li FiIIUIÇit i.«ar*S.ic cci,,. s«itaa1 'y £'(luWpOd, 21' s 8 sunroof, power seuls, 1231f, Chovy '06 EquInox 847.7259025 Midway Motor 70965G-5708 18,998' 'oLfAilra_, to 1I1MI'G. S2OcXXI $2,990. OEA3G?c3282 "Socorld Chanco flrrasco" $10,00 s Call 818.7848428 Gond Job? Bad Credit? BUY FOR: $45,890' 8500! HONDAS & TOYOTAS 024 HR. LOAN UY PHONE" JEEP 'O3Griind Cherolrna $26,990 Chrysler '04 7&C LOWERED OR BUY FOR: $299Mo FROM $5001 ßuy PoliiO lmpoun4s 99 Corolla DIr tml3482 "5.2 Credit" Laredo,II cylinder. 534 000 UNDER INVOICE! & Reposl Acutas, tlissons NISSAN '94 Maxlrno suriroo, FORD 33'JAN . NICe tat V,,,, mIco, looks great, si.ko FLOOR CONVERSIOI1 FOR Coged In. 11050 POrfecil Must Clreys & moro horn Sd:ol !or runs untI looks pood. $1220 CALL NOWI 8886957312 OBO. 7731901361 0130, 708272-0737 WHEEL CHAIR USE, LIlIE NEW SOcI $1Xl. 77331672'14 MOIORCYCLES SCOOIERS ListingsX536&O124 cat. L7iß Ask toiletry 773847.1515 Jeep '92 Cherokee 4WD Volkowagon '04 Pirsant 515 GMC '01. Ssnuma *1*1 HONDA '95 CIvIc LX, AC, .'94 Monica Sentra 409 8P14741 $9,9950, S172/Mo VO, AM/iM, StorIe Docket S13at : - HYBRID MARINERS IN STOCK! - ORCYCLES WANTED 4WD Est CirA AM/FM Chevy '04 TraIlblazer $2.295 888 3.S-5O3t $10mo, 122< mlles. Clean. Auto, Air, Ciclan. Runs Great, CALL NOWI 888-695.7312 Chrysler '0.3 Voyager LowMl $a95 88133!ne5031 "Second Chanco FInance" CASH PAIDI! #P14738 57,395 or $127/Mo ' $2450. Call 847 812-7077 Nice, Dnrgain $1395 Gond lob'? Bad Credit? CALI NOWI 888-695.7312 "24 HR. LOAN UY PHONE' t Makes & Modela! 708-6565758 r Lilidmay Mntnr Dl, l773l3-9-68-'t-Z Credit" '08 KIn Rondo NFJ 2009 MERCURY MARINER wIll Pick Lip! '02 Volkowa1350 iella OIS '99 GMC Solari Van ' 2è AC, PW. CD SRS Till A Mnrnt 11P6666 $1_5,98-1, .. -. J ..-.. w*loc*, AutomatIc VG. AltI , .. Call 63E60OS71 866-407.1251 HONDA '93 CIVIC A lot of 5990 8A-63&6557 Dndgo '08 Grd Coronen now yort'i, good Conrtltrori, Webb Chesy $39'.)5 ßIZlA'! J'; vp14686 $14 995 er $259/Mn 7909534118 ssi police impoundsl S1,600bnsr. 773207.7328 CALI. NOWI bßB-G9&1313 CHEVY '03 TRAILEILAZER 4 Cars from $5l For Listings dr, .14, nil power, very pood NEW 2009 FORD EDGE NEW 2008 FORD ESCAPE uo_ Volkswaltori '00 Deotlo ISlA '01 SportogO Cool, I ownr, at,kInI' 860) #II'428ß lwc3T8 1-809473-7523 XC436 #?470A 84,9SOor $84/Mo 4 dr dud, hIC outn. 29', miles, R 98 Mercury Villager 7O5O2&5/O a. owner, CuIra 6000. like r-tcw :i- ; '1)1 honda Accsut 4CR CALL NOWI 888495.7312 Dodge '08 Oid Carayaa #33:17206 SIDOS Db $71w. MoCon C.revO FOR 36 MONTHS Auto. Air, Clean, Rutio Great, 11P14727 $14,995 or $259/Mo Call 888-6792241 7736101982 Scion '06 IC CALL NOWt 888495.7313 GlendateNinSarc.ctirn Gas Saser $1295 CHEVY '97 laItue, bIneS, $20,977.$13,986 5P14518 SU 550 or $12.1/Mn GIS clir.nrtC grill, retruole SIan, 20 MIdway Motor709-6565756 C/ILL NOW! 8ltG95'7313 53,498 betr rurnc, nouOd nysiern, 1(14 '99 Sportilge i CALI NOWI 888695.7312 $2850. 7736840414 OR BUY FOR: OR BUY FOR: $i99Mo - DODGE '02. 0250 Cargo MERCURY '91 villager 4-jr, S spd, .1 cyl, i Owner, MOTORCYCLES 4' rico, Ccellt'flI coed, I Passenger. occellent condì - 1804f hay ml, runs great, $1150. $1,050060. 108781-8788 Inn, 51830 77350358-32 WM'1EOII .1 Honda Accord only 650! SMART '08 FOR IWO CAR 713619-1092 MortOn Grove, ead oc Alive' Any year 41MPG, Only 188 nulos. Asking VOLVO '98S90 CHEVY '96 TaIme 1500 LI OLMO' NEW 2009 MERCURY NEW 2008 MERCURY Police Impoundsi For cdan, mint con. $21.503. Cull 13083463332 I al yr lilOilO. 4,4 burgundy leather, dud only 113133k nil. liii OpIO, Pwr . Listings 8OO473-7523 x6435 Oodvo '01. Grd Caravan Gldsainhllo '99 Silhouette player. alloys und gorgeou'. fllOItn,Oof. hId seal'u, gal kept, Auto. V6, PWiPug Rack $2,03X7. 8476755857 I:oxo, '07 11X350 AWD MILAN SABLE rIwaus rn,)fllainOit. sticrilico. 112103798 53.995 eP3.4333 $27,995 or $485/Mo BLOWOUT 538500807132214930 CALL NOWI 888-698-7312 CALL NOWI 888405.7313 '09 SultanI Legtiey Spec. Ed. '04 Hyundol TIburun CT 3 to Cho050l Rouit 51.6,985 NDA '83 Goldwlng I owner, 630-5553298 grondsotcuruosm Chrysler '05 Pocillca VG SpatIal EditIon ACt SiP14634 511,995 or S207/Mo I d,es' M:nd concI $23X1 or 8,426 888-c36-69T 0000E '01 Rani 1500 PLYMOUTH '0 Voyager 13cr. Lincoln '07 NavIgator L Bibi 1995 VolvO 850 Wagon, lItaIs In - CALL HOWl 888485.7313 )st otter Call 6393735 CarOs. t owner, 12751, eIern, kept, 0851 orI, 1. owner, nico HIghland Park Ford 1/M good conWlsn. 150,XI nulOs. $2100 OBO. 3128691t56 could. $3,680. 847-791-8819 $28,9958474337200 'OlSobaru Leeacy 2.507 $1,1033 at trcst dIet. II oleroOl Nov. LIAr, Rout, turbot $20,985 INFINITI'00020, 4-Dr, aulo, ed, p10550 call 170913087021 or FORD '04 Escapo, silver. low noti, uhr CD. AJC, 83l, 630595O25O g,andootraru.00m NEW 2008 FORD FUSION AutoLoan - mUea'o, nOIi tireS. Most Sect 2AflA8W '2001's 2OO8s leylons. $450. 773563-1093 170815094328 $&3lXl. 7903551409 LIncoln '05 Navigator NEW 2009 . #914142 518,995 or $329/Mo Fjiii itcala, Ra', 3LV6n Ñ*TIT tmprozn Wagon HAVE YOU BEEN TURNED CALL NOWI 888495.733.3 FORD FOCUS . '06 Soba,u 1FT8198 2OO9's Low Mil Great MiIsogel $12,995 BUY FOR: '08 MIa Rio 6385955250 grandsobaru.com FORD '03 Explorar spoil, 4iP6700 $12,982- T-9 ANTIQUE CARS DOWN BY A BANK 4e4, 1. oweer CO/ casselto/ 00 MERCURY '03Mountabneor, $12,950 886401.2-352- rodio, now tires. exc cand, Va, itria. 3rd row, moonri. folly CORVETTE WPSNTED 1953.3572, - $5709 ollo. 7082261864 CARDEALER loaded, 1 owner ene condition. OR BUY FOR: $l89Mo 'O6Subam Oulback Any Condition. Compelira AVAILABLE! FOR 60 MONTHS AUTOMOTIVEj Manual, Raro Rod! 514,995 Duper. 1-8098503056 $8709. 7b2S527-ó562 $10,89 '61 MIa OptIma OR FINANCE $1Z990 corvellebtiynt.cOm 639-995-0298 gcoodsobarU.cocfl #p&626 $12.983. FORD '02 Explorer, 4x4. B66407135i. COMPANY? Enceiloni coodillorc. 5 FOR SALE IMPORTS '09 Nlsuan Mucoso e s D a - a s t- p s $451X1. Coli 773690-1482 o- o- s T- 6 CUSTOM MODIFIED 886615 $27,851 OU! 868407-1.351 T 7 SERVICE WE CAN HELP '01 Kin Rio 5 THE ALL NEW FORD '99 Esplorai XLT T. 9 ANTIQUE CARS - #93003A $iZ9 Bati Crcdit, Mow CrediRcpos, 8664o713S1 '4 dc, 11lit. Suri if, 4a4, colta T- 10 VANS Olson, 1.755'. hII'lway. 53950. NtSSM4 '00 Xttcrca 4cb, red, I ONE Judgcinents ORA I T. 11 SUV 7736191982 Tiiorton Grove soto, 4a4. CO. lITlnIOCulatO. 9651. Solco, 773.503.5002 A T. 12 TRUCKS co$V9OENTLY o '05 Klo AmantI WIlY BUY T- 13 TRAILERS A089720A 5.14,439 HOUR l.00ATEI EETWEEN '01 0MO JImmy 4x4 T- 14 RENT 866401-1353. A LEMON9 Auto, Air, Estra Clean, Runs $5001 POLICE IMPOUNDS? T- 15 LEASE CREDIT OWN A 2009 Great, Beauty $4695 SUV'S, Tecks from $500! T- 16 FINDERS SERVICE . l.oeus '06 85430 MIdway Motor7084565156 FoLlsngs 8-Xa-473-7523 s'tISi T- 17 SERVICE REPAIR #P1.4675 $24.995 or $433/Mo T GUAY! s s CALL NOWI 88&6973j-3 s,, T. 18 TOWING AA j APPR OVAL! .As ' Før Kevin '980MO Jimmy .109 Sutmrulctbaca UnId T. 19 PARTS AND ACCESS I #b'85138 $4.995 2 to CIcooset Low Mit $24,995 T- 21 LOANS '04 Mazda 6 CALL NOW DRIVE TODAYI Call 88-5678-2244 63G-5950250 grandaubsnb,com T. 22 INSURANCE 630-S32 -9S94 GlendaloNlsSan.com 7- 23 AUTOS WANTED RIPOI I '08 Subaou Foraxter T- 2& FOR SALE DOMES11C Howa rd Hummer '06 H3 3toChsoeel$15,995 T- 28 LIMOUSINES MAZDA '00 MlIIenla, exc 0VPV&VÏDWl$Att WI DO! BuickPontiac GMC 48014739 535,995 of $329/Mo 6308850280 graodsubam,cosr, condition,sunroof,author CALI. NOW! 585693131.3 seals, $X3. 773-3496097 T-S FOR SALE IMPORTS Auro GROUP TOYOTA '08 Foui Runner (113)353-6886 Ip8oitl '0G FX3S Sport. toweur, 175f mi, tibio ø'14744 022.9950' $398/Mo new. many outras. must see. Acuca 'O1S* '00 Maz6a Wavon MPV - l'I I l'I Ii-iItl iStI I ut r I:.cn,:\t II - gffl \II )\ I\I CALL NOW? 888698-1313 $2o.. 773307-9301 c.psm $17 995 or S3liflulo AC, PW, CD. tilt, Morel CALL NOWI h86695 73.13 .57,9958855384551 142 TRUCKS We Pay Cash for Junk Cars '02 CadIllac Seville STS '06 Chryale? Sebring '98 Fard Escort CLOS '88 Cutlass Supreme - $9,709 8864457537 2dr, mint condition, nil pse wor W/0 Tubo AC PW CD TitI & Morel #3110472052.395 herltagecadllluc.cotn St,99d88636G55u Coil 8886792244 low milos,$3100. ?909G9622 Chevy Oi S-10 Pickup Junk Cots 'W' Us708.268.73.59 Chevy 'O $mpnIn OleednioNinonn .Com cu P1457n S55oiS1O'M 'Second Chance Finance' a.CALL?OWI Good Job? Bad Credit? '01 Cudlilna SLS "24 HR. LOAN BY PHONE" CHRYSLER '04 SobrInO CLOS "iOCUTLtSS "As always with The Autobarn, you can assume we'll havea greet selecflon at a greatvalue I" #390293A$5495 Dir 177313486363 'EZ Crdlt 4 door Silver, leothor, sunroof, FORD '951 Toares blue, 'luir, lSOAlito, bucket conuole Call 888679244 Có, full power, olloyn, rune good, full power. 51)50. $4250/besti 632781-MOd CHEVY 98 SIio,ndo $OO GlendnleNisnatt,com 6O'lp 7736548X19 Zu. Pickup, wuu cup 4x4, beufifut. Mast Sect $3500. rod, full power, CD Cns. 773-583666-) aUos,orgeo&,s S2X). 'l'alice imposnd tor SolaI' the fonda Accord 21X12 only $10331 7Th583-642 .99 CadIllac Eldorado Toerlitg FOIIb'os Probe , clean no $8.809 8664457537 Honda Civic 87 only 551X11 11 spit, herlthgecndlttac.com Chevy '06 MalIbu CHRYSLER 'OlConcarit. rusi. nino ceci, Ronden, Toyotas Niuosnn A Mero O) "Second Chanco Rnanco" cien,,, Cl), nIant,, runs pood, firm. 7086053150 $3850 OBO. 7063239007 from $5831 t'or Listings Chevy 98 Sllvcrurlo Zu. A8J3 PAYS $500 to $20,000 Onod lob? Dad Credit? 8332660124 Ori. 12.13 Just Minutes Away... Lit,,, C1, Alkjs. J3ud 1inu "24 HR. LOAN 8V PHONE" . $595 88&355o3 FAST CASH FOR GOOD CADIlLAC '97 Sedan DestIle Dir i773i3486263 't-Z Ctedit" O) ItAly loaded, 2nd Owner, $351X1 FORD '95 PROBE01' Red, RUNNING CARS 000csE:oq Intrepid 35, 11111/ stick, full pwr, escolient mpg. . ollo. 773221-2328 in Evanston loaded, very civ,,,,, pOssod nicol $11X5) 773211 7240 Police Impounds! Fords, 708-798-9860 eminsior,. heat, A/C. $1400 e CHEVY '94 1500 Fuit SIzøti Did You, Car Stop Running? ClioWs, etc. troni $5001 For u Pickup. 4x4 cxtta cab, white, 773818603f CD. ufloys, eroat condition. Need new transportalion? Wo t- Listings 81X14737523 tt3443 limited We are located In downtown on Chicago Avenue , 21. 1V35090275 CADILLAC '92 Coepo ponD 'si Tempa, 2 door, Guarantee $1c:O for your trucIoli Chevy '05 Impala .tuns like now. escelloet heat, b Oebttte garage kept, I 04. - cars avail, breo lowing "Second Chance finance" DODGE '04Stratus .VO, i,u $1,290 OflO. 7080319081 babied und pampered Since DONI Job? Oad Credit? 0 I now, non smoking, etderly I to, Oir, 4 dr, no rust/dents, CD, Pontiac 'OS Grand AM SE 2 iORD 'hO Runge:, w/purchaso, 99% app'oved. Free "24 HR. LOAN BY PHONE" very clean, runs gd $4332 Aulo, PW/PL AM,ThtJCD etended cOuple driven, beautiful Dl, 1173)3484283 "E-Z Credit" cub, 5 speed. lookS/runs pot GET Credit Check 53545.1O I cOlo, combo, red WI red I 060. 6IJ6.&$2978 $7,495 88.2555031 tod. $24i 7P6622 I interior, red simulated l'ORO '93 TaureS C,i. white, 4 IL coneetsibe top, Witilo walls, door, runs excellest, full CASH 'I custom order ttoni factory power. $11X10 7735090261 DONATEOURCARto with oIt these boltutitul DODGE '99 Sttotas 'lilt, PONTIAC '03 Grund Am, very clea,t, maroon, 1106 muso, .-, MAZDA '94 u:t000 Pick tip. SPECIAL KiDS FUND. I optiunsi $4,250, Pl' auto, runs/drives great. $1650. CHEVY '04 Camello Co, A/C, power uutomalic, z flinch, (illoys, CD. Help Disabled Children IAt1t 773901.8039* convertible, commelsorative 7085101999 Groat runner. Must oe. $I3. NOW! Comp and Education. Non L ediliori, lemons blue with FORD '93 Toaron Wngon GL $3,900. 773'42.8Ot3 ici Cfi? u.sci Runnets OK, Quickest Free shale top4nIeriç, 3,1X msrosn, spacious. looks S runs o Towing. Freo Ctuloe/t-foIel miles, oil factory options + good, $950. 3126469733 o Voucher. Tan Deductible. many estros. $32 590 080, '92 Dodge Caravan $1600 eba Cull t06&44&3254. CADILLAC '92 Reritwood 6,47144356 PONTIAC '00 Grand Pils OIP :11 _ $500? POLICE IMPOUNDSI Brougttam4-dr, fuit power, '96 PontIac G. AM $1900 obo Sopor Charge, 4 door, green, leather,surtroof,fullpower, florido cor, 1506, new siren JAGUAR '94 XiS Caneoillblo C7r4f Das Auto. Trucks and 4n4's?For 'OlßuckRognl $2300oho CD, beauty. ?L1 . Forget the Rest I Pay th Best ond brakes, ostra clean, runs ahoyo $3490. pISJi? 1311 muon, reul head tumori 77350f3O25 Listings 803473.7523 x366 perfect. $2590. 706-229-1442 708-277-8621 $7032. 773643-7221 . For aH Cars &Tnicks, WE PAY DIG CASH FOR JUNK CHEVY 01 Cavollor, D, 904, n,i. (S CARS PICN tip SAME DAY 4 door, While, CD. Runs excel- o Running or not,7 DSyB lent. $1590. Call 7735836634 773.9346213 CELI. 7 DAYS PONTIAC '78 Graod AM G? CADILLAC '91 SEVILLE Ford '08 FusIon SE-VG LIncoln '08 Town Sign LTD Super clean inJout runs/drives green, reno excellent very T.19 PARTS AND ACCESS 708-975-0035 Highland Pork Ford 1/M HIghland Park Ford L/M clean, $2695. 708951835 great. $1x. 7th937-4199 $15,9958474737200 523.995847443-7200 o s (S sss Most Cash Guaranteed Fer # o CHEVY '87 CORVETTE CHEVY '01 Matlba ' a, Volume MazilaStore in illinois for '06, & 108 accéding to MNAO (1) hood $4O, 1987 cuStom Yoor Vehicioi? 708,969.JUNK 5865 CADILLAC '83 Fleetwood $395 down $69/week, ff1< is Ford '07 Mantang CeneS Red PONTIAC '98 Grond Am SE i rear huts $4t. 4 oli. Cali &reri, C34851849 Lincoln '07 Twn Car Sig LTD Runs/Lkn es, CD, gos nas'ort Brougham 4 door, white, white HIghland Park Ford 1/M Highland Pa,k Ford L/M blk, $2090. 7064841517 'rvli't'' , . P225/hc(S20 oew 000dycor top, reti leathdr, Cotifornik car $17,995 847-4337200 Io $21,995 847-433-7200 oaIc tfres$4w, oa aro driven by elderly Couple, non. Brand New2009 MAZDAØ (fontbalance 2O, 1909 smokIng, never driven In rain, Corvette alum intake CHEVY '99 Lumlna, oocellent Auto Trans , Stk#EZ7535 onall 1.25 FOR SALE DOMESTIC absolutely flawless, mInt Cond, f, manifold & ca,b. 1987 Z28 Condition, 2nd owner, $2590 PONTIAC '97Grand Am, CD Lacan for Coulomb piales und lisio. Ford '07 Mustang Shetby CT Lincoto '06 Sophyr rims & 2 tires hso, IOG 1 sr ilkind known to be in 080. 773-297-2328 Highland Park Ford L/M player, very Ciels, ruso great, 194 hoOds $290. 1992 SlO A white, i297 Chew Lumlna, Highland Park Ford t/M 4 door. $1,995. 7059551835 culstonce, 11, verifiable $44,995847-4337200 1 2009 models Blazer steering column $50, t'tat's in good condition, $1E miles pampered and teken $25,995847433-7200 1X6 ChoW 2h3 cugino comp, $2882.10 at sans 01911511 Or best otter.l you are lntoreot. cora ot'sisco day 1. Must ses No,euiofty depoo(trequtmd Ix, runs $600. 7064255601 to appreciate this beautiful cart CHEVY '98 Matibu runs ea, cull i708i369-7021 or great, clean, block, CD player, PONTIAC '97 Oraud AM 01 . Con be seen, Chicago urea. Fard '07 Mustang Sholbn 36n+ 2LPL3TiyClil.iOpJ,cdCyJt C4er,3i1it 2009NissanMimaS -.$11.995 8474337200 bic. $17133. 700.3742648 MAZDA3Sedan I Sport ENGINE HOIST e,, Chevy '98 Monte Carlo ZIA Auto Tioss, Stk#E21541, VInIJ'a11B1132F6S1241414 like New, ipumped La). $190. ThINKING OFTRADING THA 01.0 '04 BuIck LeSabro Auto,ll, ABS, Allan Wrieets "A 7733589 #3815564 $6,995 CHEVROLET '05 MalIbu, 4dr, Ford '06 500 OhmFetI Pwr CAR INfl TOP $5 FOR YOUR TRADE 886-3555031 Lincoln '05 LS V8 Low Mit PONTIAC '96 Grand Am 07 Call 8886752244 full power, euc condition, gar Hightand Park tard 1/M white, full power, alloy, CD. 1. 77336&13$5 GlendaleNlosan.com kept, $4990, 7733496047 $10,995847-433-7200 Highland Park Ford 1/M 13,937 3 VolkswagensPOPIC2llfNDl 773.8657227 $16,9958414331200 must soc. $1. 847-3294904 68/65 327 ENGINE,15,000 CHEVY '98 PRIZM 4dr, auto, New 2008 Mazda CX9 Nissogue union, $800. Also: 350 4 bolt pwr window & tacks, CD, 506, II main, $250. 773O44876 I5UICK '02 Century LImited CHEVROLET 'ItO Lumina, eacellent condition. $3200. Grand Touring FWDS ,tq maroon. catho,. CD/cassette, 4 door Blue, full power, CD, 773-5035802 Lincoln 'OSTwn Car Low Mi SATURN '04 ton, 90,900 1006 ml, 1 Owner. $3890, Excellent MPG. Must scot 1*1*1*1*1*/ Highland Park Ford L/M miles, gold, 4 door, fuli power, Alt Wheel DrIve, StkIEZ72O1 Lease for I Call 773-5039045. $241X1. Call 847.6755852 Ford '06 FOcu8 $15,9958474737200 Co, gorgeous, $4,200. RIMS Urand New Chrysler Xt "Second Chance Finance" 7735836684 C Chrome Wbeels. $750 or CHEVY '06 CAPRICE- trI, Good Job? Bud Credit? k S2500 down at Iese Signina. best. Call 773719-3994 pot,ce package, 6811 orig mis, "24 HR. LOAN 8? PHONE" to Cboose ror7! 32,779oRO per 39 rnos. BUICK Century, flO.1 CHEVROLET '99 MALIBU LS $3950, 7732160163 Dir (17313466263 't-Z Credit" 2009 ot 'ságén s i 99/mo. milos, clean, runs good, VG. 00,0X1 miles blue, 4 door, Jefta S $3,900 OBO. 7735512372 teather, sunrool, 011oys, CD, Cassetto, gorgeous, must seet LINCOLN '03 TOWNCAR CLASSIFIEDS 20052008 Nissan T-23 AUTOS WANTED $32011: 773281-79/ CHEVY '96 IMPALA SS Signuture Serios, Private puny, 847-3294064 Parting out fo, mora info cali Ford '08 FusIon SE garage kept. 005-smokisg, only Altima's &Maxima's .00 Buick Losabre Frati f733104333 liigirtand Pork Ford 1dM 41,1X10 muent Fully loaded: #go44 $5,995 510,995847-4737200 power everything, 1M radio, Colt 8886752244 muitidisc CD, auto start, too 2009Volkswagen GlendaleHioson.com CHEVROLET '94 CAVAUER many extras to list, In 312321-2345 full power, CD. $1350 080. obsoiuteiy perfect condition. '96 Chm Lumina $2300 NewBeefle 7052720737 Ford '00 MultanO CT Red Conet is out S mechanicatiyi Leas TOP DOU.AP$ PAID W,' OR '98 Mitsubinhi Galant SiSEO Highland Park Ford L/M $i211X) 000. 3122174451 . w/O1.n TII$I QUICK CA$HtI SUICH '98 Regal Red, 96'ToyotaCorslb $1900 $19/395847-4337200 Fulyr. Excellent condition, 4031 N. Eiston Ave. nI-4752552 199mo/36 mos Atlas Towing 7139o5.rtî Coil 7736067482 CHEVROLET '80 CAMARO 228 Save Time violi eomsautochlcago.com NEEDS SOME WORM $1995 FORD '04 Crown VIctoria, LINCOLN '97 From Aak tar Jerry 7138474525 Police tuterceptor, fully loaded, ContInental, $10,990-$19,990 eaceilonl monet, super clean. red, 4 doors,catho,,Sunrf, & Money BIlico '97 LESABRE Nicety Equip. 4030 S. Arche, ave., Chicago $14132 only. 7738180634 full gorgeous, -I - stub cenc,m care w mi. 1 Owner, CHEVY '96 Monte Certo fully $2090. 773 s St - ' loaded, runs/drives Ocellcvt $3200. 3{29435626 I.' -s s.- 'S $241X1 0B0. 773441-6593 I '. CHEVY 00 IMPALA SS FORD '04 Crown Victoria ' 700-22,000 1. Owner, Gar'd, Cobalt Red. P011cc nackage, let black, '97 LIncoln Town Cor '96Buick LoSobre Evttl Opt mcl Uhr, SfR BOSE Chrysler '06 300C $1950 080. 3120886915 garugo kept, uidedy driven, one swner . Cash elderly driven, runs great SS, Etc. Etc. 184, s:th.iso. 1P1483$ S Check In :1 hr! Coil 706-5345637 Aftomoons $1850 7732463077 For Good Cars! $950 or offer 773936587G CALL CefidVOOgeflD00MU'O5,'O6&'O1OcCO(EFU7gtOVOtkSWOqefl Fotd '02 Mustang Cosut '36 n dCSfldliCP/C11.CÍ5. v,r'jy OpÇC'd94. 1cse ii'xiyb $400 for seaters Auto,'t. Keoloos Entry fyrez/s7.iir1 tl c,tpi ..ir1;u ")j if $ ,r SL9O4l 1C itn9jy i 3555691 Mnreury '06 SabIo Piemtor . Store n IL for 2008, 2007 & 2008 Call 24/7 09 Cadillac CTS 'SOR Highland Park Ford 1/M our Test Drive a Mazda TodayJ O2:idcreiifJr'UVLl:lSde 1!31/ 9'u?fy3jyr. S2 .iPr 1.r7i1e' #1 FastestGrowing Nissan 015i509 066-4457537 533.995 847433.7200 'Csedend Ieasewith qued credI , SecuiiIydepast w&vedsth approved cediL Lesseeay 11..:iO)Vtrtj / Û±3 (39 773-240-3077 ltorItagocndltlac.com er aseuith quaed cted1 Securitydepos waived wth approved cred We pay tho best for Junk Cots. FORD '01. Feces SE , 4 dr. 4 cyl, beiesnsubIe lof sass wear, lear Wi/of lnIea90. Otters expio 3 days Iroin dale ol iobiucation. q)Or"oC"fl,LOSÙfyr4ni, aule, PW, PL, ACflreat CD/XM. fnaiicedwtthaççioed ccad'don200S MazdacX'9. "No lessee responsible foc excess wear,araiJor rrieageover 12Km'r. Md tax, ftde, 'ense, &Trucksl Free Same Day P/UI "0% APRIO6G OMS. u 16.67 iief$I, clIc t iy/Q3tSA1P, Pcc\Icg, iQ'J7,1!îfl 1o'. .jr ,c'ise & d No donts/mot, ulrm nice! MERCURY '93 COUGAR 2 70&6569631 f 70&7958&E5 '09 CadIllac DI'S 4Cl? ads PayioefltStiI May2009 through ChasoAsta Financth qualSed cedï1 Add tax, EUe, licciiso aM li (id\l1i)rnrt, desthation and doclee. Dealer rtrespoasibe focpncing eocs in adveitisemenl Cm. S2lOOneg. 625i54129 door, sunroof, CD, eac cand, leebplí'$ J9. Eiealer ro 1e1pCiCiSiOe lcr prinqeílls Get. cash $33909 8864457537 $1250. 706415.6550 doc (ea. Alt rebates & incentives apPlied. OIlers expfro 3 days horn dato ol publication. herltogecodlllac.com WE OVvI i Ti-L Fì!. L C()l,)I\NJ the . the f FORD '01 Taurus 4-dr, silver, . Oufo, B/C, full pWr, alloy wills, '01. Mltsubuhl Diamante NOW) NEED '07 Cadillac DIS 4CR Ata.i(IIOIjI cleOn, $2850. 7067155510 01110758 $4,495 - ' lnMkMoug --. - 'u-. u, - $23,9098684457537 Cuil 8886792244 Find the - , herltagecadlttac,csm GlenduloNisnon,com . WE WILL GET You APPROVED! °okswogen Nissan ASH G000 CREDIT? BAD CREDIT? No CREDIT? automobile '06 CadIllac OTO 4CR FORD '00 MUSTANG Cons. 018$ '03. Aforo BL, sliver, 2 1015Chicago Avenue 1033Chicago Avenue 1034Chicago Avenue 51.0,9090664457537 ALL APPLRATIONS ACCEPTEDI Auto VG. A/C, 6911, nico cond door, ouvrira?, tuil power, CD, 37,560. 532357-9145 Cass. Must Seul 12790, Evanston hetltagecadillac.com APPLY ONLINE AT: Evanston Evanston ow, 713.509.0275 that fits www.GetApprovedNetworkcom '06 Cadillac SIS VO '00 Ford Tasrs $22,709 8664457537 OR CAL OUR 24 1IOUR HOTLINE... #31x.$360 $4,995 010$. '98 88 .hlany your style 847866-76OO 847-47 5 8200 Itoillagecadittac,com . r Call 8886792244 Acesoores, CaruluiY Cured for, i buy Junk Tiucks, Vans, Cats CieeduioNissan,co,s 1 Dauer, Cur, $3.275, 31.2 9532454 www.vwofevanston.com www.autobarnnissan.com MIKE'S JUNKING w, or wißt titles! Running or We Buy Junk Cats w!et w/e titles Null Will pick up TODAYI 'OSCadillac DVllle 4CR .017-438-7366 FORD '09Canlaur OS Blue, 010$'9590 Regency fully . $18,909 8664457537 4 tIr, CD, alloys. sharp. Must 7Os2rj1 . 7859Q frurltagecadlltac,com liii tu g MiiJemian 14633 loaded. Ruris/drisus eaCeilenf, Vehicles Available Ckerolvt sed $1832. 7735090261 $2500 7736416593 Always Over 300 Predriven Suburban , I t Nobody's gonnasave you more! MICAUEM1$IT4 APR ranI (PARit 09 DODGE CHALLENGER flnancinq Now 2009 Funs EcconE u PL4Z4 NEw 2009 Foon Focus NAVIGATION INCLUDED NA VI EL IDTWN 111CL 110FB 200 OR EVERYBODY GETSEMPLOYEE PRICING 25II11 Cash Back! / / U Now 2009 Foso Esso SE PLUS $6,000 INREBATES PLUS 0% APR Nou 2009 Fuon FusIoN SE NAVIGATION INCLUDED STOP IN TODAY AND GEl THE CAR YOU'VE ALWAY DREAMED C NAVIGATION INCLUDED Ou MOr,030 CHARGER 0R30DD -HTT

BRING IN OR .OJS8IRSM .... 2005 DODGE a 00 'JIIII u3 YOUR TRADE & CHARGER SRT-8 835110 sYi --- .;: WE'LL GIVE YO MSRP 44,03S fuj Cash Back' i 9 ILLINOIS! J 18 995 291' TOP DOUAR! $32,9950 i CERTIF!EDPRE-OWtIED FORDDEALER IN

08 DODGE NITRO SXT 09 DODGE CALIBER SE 09 0000E JOURNEY SE OP launa

Boy o 2006 SsounsION 15,995.2t5. & u 2006 FonoMUSTANG IS INCLU000! ra rouas 5010 4012 250IIICIES;U0 200000Es 9.. rororo. arr GOS SPIDER rrraar,AMEII650 r, roan, CHGOnGEM roNaa9rLrO PACIFICA :OOS01,.. lus LOW MILIS 000lOn010r 300 200010G r 5! I PA AMENA 9)080 80011,001 «as #01104 1101913 talaIs .-5L2. sown $79950$9,9950 )U 012,995'J17a.. 012,995.5178-..a13,995J194 00 rubor G RArIS CAGARAN 15,995J23V o rarEr OoOOl 000 404 0000 0GB ro brosoar nArITA FE #9)004 0,0000 GRAND P0000 DT ar00500r TORMO 000500V _S__.___ 92Er, #0)960 WE BACK baboon. DURaNGO SL! 404 Il w, #01916 WHAT #5)001 $4995. 9,995.952n.WE SELL' '12,995)178.. 13,995 '194..'17,995)259.. GroErA, CAVALIER un 0000300 5.TypE an roGna CALSEar -: ...... ranr,nar CIVIC EX arroGaran DOS :.'5 IiiI r'S.,.__ tulsa. - 125 POINT ra anon. CHARGER R/T #00805 %:. 40001000 #0110 INSPECTION 001910 - 3 50113K MlLE - r;A2uuoian- #aonû $5,99500$Ø9950 MAO. CARE '10,995.'171..UMRTEO WARRANTY 000nrr,AOEO - 240100G 0540SIDE 13I995.194.. 17,995.'303 rranoOrTrGO O 00G WISANGLER 4X4 SPORT L'LLLLLL ASS IS ILS FOCE ra000000 300 TOSSING ro rooa TAURUS Lomo RENTAL CAR uSTx20 - ALLOWANCE. Howard 1.847.481.0435 CAREAS VEHICLE PROBLEMS?Call Mr. '6,995)133,..9,595.144'.. 11,I189 REPORT CREDIT 013595 22O 15,995)2312191995)34V.. SALES S EV CE Mon-Fri V-tMon-Fri 7-1 HEIGHTS I'ORD Saturday t-6Saturday S-5 NST4ÑT;CREÒIr. BANK...... :--tNOCREDIT?...... ÁTÉ'PAYMEÑVS?... - ARLINGTON - DIFFICULTIES? cALt.O First" 600YSHOP - PAD CREDIT? REPOS? Custo,BeFMWUYS Comes ¡2 pARTS rPROVAL!b0 - : "Where The ß66695Oo1a LI Mon-Fil 1-t I Moo-Fri 5-5 ¡BIs I.f MM-SIM. UrRAM.PM 801 WestDundee Road Saturday 0-1 Sat 0-12 I 551105E: M-F 7AIit-7pM SAT 5-NORA I PASTS: M-F 7:3SAM-535pM- SAT 8AM410(IN OnuiellonOonduTDu Or°N O [O O° 1115°') Ds1lnotNr DIlly 01015 lOnGING MOrIIaIW0000TIIMII, . VIE SPESO 7911 W Rooseveft Rd. Forest Park(Just West uf Haltern) AhngtOfl Heights Nfl FREE BODY SHOP 050150, 90401ra, Wwwparkplazadodge.com -ESTIMATES- T TORRISI & R015IOR -' SALES0413403042 www.ahf0rd.cOm 51./000I.,00ilI ol0u' urr050l.0110030fb 01W- _10-& t..t 1lUt .... 0111105:: 866-695-0017 1055110 0051151ff . roo...,:;cu0:Corc,r02. 1001 Ilion EIIIrSIM Is011a OIpiolIa Iannlilosoll010roVolrlaalollnll010sOlns-lirSUS lIlo, iLenai ooGpESo sOr UXoI. 09 000 4099 arO rol Ir fruc.JiSi0lr 2201115.A...... -. pIlo 010110 nIlIdo Is sold I, Orlo 1rO 11.10100 64111011, 101006100 OSI Inlolno 11010roryl TolL Io 2lEmR an loo 4 12E0O/ oR niElla 60-111191 oBI 065 011110 Oro mEns larluollo Golly 3900000 00121 la snlnl ¡oMIrIX.101OE0sttRll000IyOsa,1nnsL 2o °la arTIInO rIE -Ts«So lE DuorGIor II. 11,31008 ouO2,lll 0mb« 0010 noulsaprOanolo Suri rollonAs Al.lnS, ODI ORIa 1010000 loOn 0072 WRS 0141011 fldo, OSSI 3rd olIo lassO or 05 Ir A lISIS 05 004091 0941 Isolo) III 01118160 - A

o c'J SA. New Car .Buyèrs Guide .1 e . e Subaru (contd) I. S 'I GERALD SUBARU 1210 E Ogden,Napervllie In Oaklawn NAPLETON HYUNDAI 1985 River Oaks Drive, AUTOHAIJS ON EDENS 1600 Frontage Rd anCari Chrysler-ieee Calumet City, IL w.napleton.com 7088686500 Northbrook 800-7166517 autohausonedefls.Com 630358-3900 I-88 & Orchard Rd, N. Aurora 630 W 95th St.1.7084230910 630-907-0800 www.GeraldSubarlJ.cOm MercodesBenz Napervilie 1569 W. Ogden Ave HERMAN CHRYSLERDODGE7601N.t O'HARE HYUNDAI River Rd & Oakton, Des Plaines. Grand Subaru York Rd. & Grand Ave.Elmhurst (888) 738-9744 www.drivesherman.cOm For The Lowest Prices Call Direct 888-419-97 888.769-5484 . mbofnaporvllie.com 63O.95.025O m o Ave, SkokIe Bensenville www.GrafldSubaiU.com PATRICK HYUNDAI 1020 E.Goif Rd. MERCEDZS-BENZ Of ORLANO PR 8430W. I schaumburg www.patrickcars.com 866-314-4539 159th St., 866-259-6000 www.mercedosoforland.cOm - 7601 N. Cicero Ave., Grossinger SuzukI 6900 N. Mccormick HERMAN DODGE JEEP Mercedes-Benz of Westmont 200 E. Ogden www.grossing0rsuZ.cOm - - oKIe (888) 738-9744www.drivesherman.com I Ave. 866-368.1522 mboestmont.com LincolnWood 866670-2599 o) A RIZZA HUMMER B425Westl59th JACKPHELAN SUZUKI You Gotta See Jack i. st,, Tinley Park, IL 866-360-4576 www.rIzzacars.com Mini 7050 W. Ogden, Berwynlos.48412OOJackpheiafl.00m ANDERSON FORD 6539w.ogden,Berwyn,iL BIL,L JACOBS Mini 1564W. Ogden Ave. G.T, w.AflderS0nBr0sF0Lc0m Naperville, IL 1-866-5188015 www.bii1jacobsmtni.com Suzuki of Eimhurst 334W,-Grand Ave., 7()&705 7900 Jaguar Elmhurst 630-532-5600 www.sululCiofeimhurst.com 'g -w-- 490W, Lake St. '.ahford.com JAGUAR ELMHURST - ARLINGTON HTS. FORD Elmhurst www.jaguarelmhurst.com 888.287-6211 o II 'gf, Arlington Heights (847) 346-3042 o, Bol w- Dundee Rd Toyota 'o I I I. I GRAND MITSUBISHI 303W.Grand Ave. o g MIDLOThIAN 8Ô0SO4-3558 LAUREL JAGUAR OF TINLEY PARK BREDEMANN TOYOTA 1301 W. Dempster, BILL IAY FORD 8031 W. 159th St. 866451-0812 laureljoguar.com Bensenyille 630860-3100 GrandMlstu.com I I 14633 S. Cicero Ave.ww,blllkaY1Ord.00m Park Ridge 847.698-3700 www.breclemaflfl.Com . I :'L g MAX MADSEN MITSUBISHI 1 I I. #llnPATRICK JAGUAR OF NAPERVILLE 1559 W.He's Mad He's Bad, Ho's at 2 SALE locations in CHICAUO NORTHSIDE TOYOTA r-. --r--- CURRIE MOTORS FORDFRANKFORT Ogden Ave. 63O.30O500Oww.patrickjaguar.com MRIWUSt Rt30&45 fordoffraflkfort,COm866-VESFÓRO Downers aravo 630-960-5040, Aurora 630898-6000. 5625 N. Broadway 773.728.5000, chicagotoyota.COm , ,. www.MaxMadsen.com NORTH RIVERSIDE ELMHURST TOYOTA "The Low Price Leader' WE CAN KEEP WE NEED JOE RIZZA FORD OF 888.2058340. http:f/www.eImhUrsttOYOta.00m. 21(0 S. Harlem, 1-888-4OO-19 rlzzacarS.COm YOUR PAYMENTS 'R APR SHERMAN JEEP DODGE 7601 N Cicero Ave, TRADE-INS! ORLAND PARK Skokie (8881 738-9744 www.drivesherman.com AUTOBARN NISSAN OF EVANSTON 1034 FOX LAKE TOYOTA 75 S. Rte 12 /Rand Rd JOE RIZZA FORD OF Fox Lake 847-497-987.5 www.foxiaket0y0ta.cOm THE SAME! on select HONDAs S1W W. 159th St., 868-933-7850rlzzacarS .com Chicago Ave. 847475-8200 www.theautobarn.Com t(ja; 4444W. GROSSINGER CITY TOYOTA 1233 N. Wells including CIVIC!* MCCARTHY FORD, INC 11400 S. Pulaski BERMAN'S MID CITY NISSAN Chicago 800.783-9315 www.grossingercitytoyot .com ChcJgo 773239-79Wwww.mccarthyfordlnc.net r Bill Jacobs Kia 2525W. Jefferson St., Irving Pk. Rd. Chgo. 8885908669 nildcitynlssan.com Joliet 800-630-7607 wvw.BiliJacobsAuto.com BERMAN'S STAR NISSAN 5757 W. Touhy, GROSS1NGER TOYOTA NORTH Nibs (888) 601-2789 www.starnlssan.com 7225 N. Cicero Ave., Llncolnwood 8686108608 EVERGREEN KIA 9205 S. Western Ave.,Chlcago GrossingertoyOtaflorth.COm (866) EVER1Ç1A, www.evergreenkio.com Just 5 niJnute west 01 thg LOOP 0SSINGER GMC 6900 N. McCormick LnCOIflWOOd 866-670-2599 www.grossingergrnc.com GERALD NISSAN 1515W. Ogden Naperville 630- 355.3337 i-88 &Orchard Rd., N. Aurora 630-907-0800 tibertyville Toyota Scion 1180 S. Milwaukee Where Fullerton GERALD KIA OF NAPERVILLE 1210 E. Ogdenwww.GeraldNissan.com Av, Libertyville 877-311-3817 www.libertyviIletoYOta.COm M» rand! Ave., Naperville 630-358-3900 www.Geraldtia.coni NORTHBROOK TOYOTA 1530 Frontage Rd. ..- KELLY NISSAN 4300 W. 95th St. JOE RIZZA KIA 159th & 80th Ave. Oak Lawn 708499-1000 www.kellynlssan.Com 800-734-3205 www.northbfooktoy0ta.cOm CARR'S HONDA 6600 N. WESTERN AVE. Orland Park, 7084030300 rizzacars.com , clICAGO 773-274-7777 www.carrshonda.com I Vue,; ibii(k) tlic°.tsIa(h, Voti (]hoo.sc iIcGns(hI MARTIN NISSAN 5240 Golf Road, Skokie OAK LAWN TOYOTA 4320 W 95th St. 800-NEW TOYOTA 800639.8696 www.oaklawntoyota.COni CASTLE HONDA 6900W. Dempstcr, Morton 860838-2300 www.martinnissan.cOm Dealer riot responsible for errors in this ad Photos for illustration E.. Land Ro,er purposes tinly Data subject tö change wthqut notice*Trade Keys prornotiop to y Crovo (847) 965-7070 www.castlehondacars.cOm' qualified buyers with approved credit Everyone may not qualify 2 9% APR for 36months on New Civic models with approved creçiit SO down Vehicles Bili Jacobs Lanci Rover Hinsciale300 E Ogden NORTHSHORE NISSAN 1350 Park Ave. West, Orland Toyota/Scion 8505 W. 159th St. Ave Fiinsdale, IL 60521 866-516-8045 landrovers.com Highland Park NorthshOreCarS.cOfll 847-433-7900 Tinley Park, IL 708.342-6429 w,.OriandToyota .com willi loan values over ACV nJay require cUstomer to pay all or some negative equity ' ED NAPLETON HONDA South Side's #1 Hon - www.OrlandScion.com da Dealer - 6701 W. 95th St., Oak Lawn866-430-0044 Bill Jacobs Land Rover Hoff Est. 1051W. . PAULY TOYOTA 1035 S. Rt. 31 One Mile South Higgins Rd. 60169 866-516-8035 landrovers.com , Pontiac HONDA CITY 4950 S. Pulaski, Chicago of Rt. 14, Crystal Lake 815r.459-71th 847-658-9050 773582-50CC) www.liondacityChlcagO.COm Grosslnger Pontiac 6900 N. McCormick LAND ROVER WINNE11(A 80 Green Bay Road, Llncoinwood 866670-2599 ww.grosslngerpOntiaC.COrn PLANET TOYOTA I-57 & Rt 30 Matteson Auto Winnetka, IL 866-5384421 www.fieldsauto.com McGRATH CITY HONDA 6750W.Grand Ave., Mali, 800828-7012www.planettoyoiaonline.cOm Chicago 888-614-4422 w.mcgrathcitYhoflda.00m . unlay Park 1.800-509-7439 Porsche LAUREL LAND ROVER TOYOTA SCION ON WESTERN NewCa-rBuyerè'Giìidé Now Openi 8031 W. 159th St. laurellandrnver.COm O'HARE HONDA RiverRd&Oakton,DeS - JOE RIZZA PORSCHE 5130W. 159th Streeet, 6941 5. Western Ave. Chicago J Plaines. For The Lowest Prices. Call 888-274-0425 Gland Park 708.364-2400 rizzacars,com 773.8847200 www.toyotaonwestem.Com PATRICK I.AND ROVER 1559 W. Ogden Ave,NapervIlle Acura e e s . I I I PLANET HONDA l-57 & Rt. 30 MATIESON AUTO630.300-5000 www.landroverofnap0rville.cOm MALL vmw.planethondaOflline.COm 8bO-780-4139 Volkswagen JOE RIZZA ACURA 8150 W. 159th Street PATRICK BMW 700 E. Golf Road, Schaumburg PATRICK CADILLAC 526 Mali Dr., Schaumburg Orland Park 88&261-8642 rlzzacars.com 888-768-9770 ww.patrIckbmw.corn BREDEMANN CHEVROLET 1401 W. Dernpster 877-749-9921 www.patrickcadiiiac.com St. Park Ridge 847-698-1234 Next to Lutheran General RIZZA SAAB 8425 West 159th Autobarn Volkswagen Countyside Hospital www.bredemann.com RIVER OAKS HONDA ll22OTorrence Ave, 6191 Jouet Rd. 708-354-8600 (Only 15 minutos from Lexus St., tintey Park, IL 866-3604575 www.rIzza.com Downtown Chicago) www.vwofthlcaçIand.COm Lansing IL 800.928-5630 www.rlveroakshonda.Com Evanston 1033 Chlcego Ave. 847-866-7600 Audi r BuiàÍ RIZZA CADILLAC 8425W. 159th St., flniey Park, 868-360-4574 www.rizzacars.com Currie Motors Chevy Forest Park 7901 BREDEMANN LEXUS IN GLENVIEW 2000 Mt. Prospect 333 W. Rand Rd. 847-392-6300 N. Waukegan Rd. 47.79.09iwww.bredemaflfl.com a' www.theautobarn.com AUDI OF TINLEY PARK 8021 W. 159th St. Grossinger Buick 6900 N. McCormick W. Roosevelt Rd., 888-294-3409 w.currlechevy.com SCHAUMBURG HONDA - Automobiles "ABob 866379.5929 auditlnleypark.com iJncoinwood 866-670-2599 www.grossingerbuick.com Rohrman Deaiership 750 E. Golf Rd. 847-8&HONDA STEVE FOLEY CADILLAC 100 N. Skokie Blvd. BREDEMANN SCION 1301W. Dempster, BILL JACOBS VOLKSWAGEN 2211 Aurora GROSSINGER CHEVROLET 151 E. Lake Cook LEXUS OF ORLAND Park Ridge (847) 698-3700 www.bredemanfl.Com Northbrook 866-3723654 wwv.stevefoiey.com 8300 W. 159th 708-342-6475www.lexusoforiand.cOm Ave. Napervliie, IL 1-866-5186025 www.bilIjacobsvw.com LAUREL AUDI OF WESTMONT 276 E. Ogden RIZZA BUICK 8425 West 159th St., Rd. Palatine 877-359-2438 www.grosslngercheuy.com VALLEY HONDA in Naporville/Aurora 4173. Ave. 866-383-3044 www.Iaurelaudl.com Tiniey Park, IL 868-360.4575 www.rizzacars.com Ogden Ave. lRt. 34) 630-851-5700 valleyhonda.COm NORTHBROOI( SCION 1.530 Frontage Rd . MCGRATH LEXUS OF CHICAGO Kennedyat CITY VOLKSWAGEN 5330 W. irving Park Rd.. 800-734-3205 www.northbrookscl0n.cOm HOSKINS CHEVROLET Division 877-866-3887 www.mcgrathlexus.cOm Chicago 866-717-6611 www.cityvwchicago.cOm Chevrolet 175 N. Arlington Hts Rd. Elk Grove village 847.4390900 www.hosktnschevrolet.com Hyundai - ADVANTAGE CHEVROLET l-55 & Route 53, VW OF ORLAND PARK 8920 W. 159th St. Bollngbrook 888-655.5359 www.advantagechev.com s. BILL JACOBS BMW 1564 W. Ogden Ave., Bill Jacobs CadIllac 2001 W. Jefferson St., Joiit FAMILY HYUNDAI 8101 W. 159th St. Tinley I S IA' 877-4449167 vwortand.com Sat Service 8-2 Naperville, IL 1-866-516-8015 www.bIllfacobsbmw.com JACK PHELAN CHEVY "You Gotta See Jack Park, IL 60477 800406-9591 www.familyhyundat.cOm 800-5400731 www.BilliacobsAuto.com 2055 WestAUTOBARN SUBARU 6070 S. LaGrange Rd., 4000 S. Harlem, Lyons 70&4424O00 Jackphelan.r.om JOE RIZZA LINCOLN/MERCURY Chicago) ADVANTAGE CHEVROLET LaGrange &Jollet Countryside 15 minutes from Downtown Ogden, Naperville, IL 888-753-4262 rizzacars.Om 798.497.3999 www.theautobam.Com Volvo BMW OF ORLAND PARK 8470 159th St. GROSSINGER CADILLAC 6900 N. McCormick Roads, Countiyslde Auto Mali 8OO-961-7w Grosslnger Hyundal 6747 N. Lincoln Ave. Orland Park, 88&500.2369 bmwop.com Lincoinwood 866670-2599 www.grossingercadiIiac.comwww.advantagechev.com PHILLIPS CHEVROLET Rtes. 30 & 45, Lincolnwood, IL 866-238-4771 grosslngertiyunda .com Franklort 866-281-0769 www.phllllpschey.eom LAUREL VOLVO OF TINLEY PARK kA.I BERMAN'S MID CITY SUBARU 4300W. 8031 W. 159TH St. 866-339-4583 St. laurelvolvo.com ELMHURST BMW 466 W. Cake St., Eimhurst 888- LOREN HYUNDAI l6iOWaukegan Road irving Pk. Chgo 888-598-7467 subaruchicagO.COm GROSSINGER CITY CADILLAC 1241 N. WellsBill Jacobs Chevolet 2001 W. Jefferson St., S. 287.6555 www.emhurstbmw.com Chicago &)O783-9315 www.grossingercltycadjiiac.com Jouet 80507.6841 www.BllliacobsAuto.com RIZZA CHEVROLET 8200 5. Harlem, - Glenview 847-7290300 www.iorenAutoGroup.com AUTOBARN MAZDA Countryside 6060 Bridgevlew, (888) 560-7799 www.rlzzachevy.cqm ww.mazdagy5ciii PATRICK VOLVO 1600 E. Higgins Rd., LaGrange Rd. 700-354-2700 EVANSTON SUBARU #1 Subaru Dir in Illinois, Schaumburg 847-6054005 www.patrickvoIvo.com Evanston 1015 Chicago Ave. 847'-86&96 715 ChIcago Ave., Evanston 60602 1-888-473-1603 LAUREL BMW OF WESTMONT HERITAGE CADILLAC 303 W. Roosevelt rd., McGRATH CITY HYUNDAI 6750 W. Grand jazdaofchlcagOIand,C0m . 430 E. Ogden Ave. 866-385-9527 bmwofwestmont,com Lombard 888-818-5725 www.heritagecadillac.com BILL KAY CHEVROLET 601 Ogden & i-355 WEBB CHEVROLET 888-548-0275 Ave., 888-613-661.1 www.mcgrathcltyhyundai.Com Downers Grv/LIsle 63968-2900 blllhaychevrolet.com 9440 S. CIcero Ave., Oak Lawn www.webbchevy.com c'1 o' autos SEARCHCHICAG - pr y wes a I M s C.) aut0STAFF .iwm,. -- ». CLASSIFIED w.!,. j_ of vIce president JIM DYER :; 312.321.2061 . [email protected] WE LL IJEATANY DEAL 16IT6b. ; N 7, ,ç, ',,.,'. - FoRD DEALERS TiME! (-i IN THE ÇOUNTRV NV' JW FORD. EVERY . », NICHE PUBLICATIONS . 5 YEARSIN A ROWI . director 86 : DAN CAHILL :: 312.321,2775 0518nvallabtoØß'$ - . O39D!_g/ ,oi&i, Oe'.&OB'S' : -t-- avlS 4lV1Tfl PIC91 .v8w094c9. _. . [email protected] ;; ____ -aIW48gPd(ei . 1/ B ; ., ' w C, :1- NEW 2000 FORD NEW 2008 FORD NEW 2008 FORD NEW 2008 FORD C) »« SEARCHCHICAGOAUTOS o . . . w . online editor FOCUS. '. . : FUSION ' TAURUS .ESCAPE 'O . Stk: #P1803 :: : . : : SUc. #R511 Stk, #T478 - 51k #A1321 '. O JILL CIMINILLO :: 312,321.2685 [email protected] , S1O,222 '::$12993 . $18,799*, $i3,786*, O w o o )p. NICHE PUBLICATIONS The Lárgest Selecion of New Ford Inventory ìn the Enlie MidwestE z . publications designer .. I 2 3 42 96 jOHN LEMEN :: 312.321.3094 o8' 8 09'o OB'. 8. 09's 00's56 a OD's - 26 32 avaIlable ....- available 08'. 8. OB's OB'.&Oe'. atvargprke1 ... available - avaIlable evallabi. [email protected] EYM0g p00O 8 . A C R O S S , - .;. , I0 i . A wrench in London? A A d 5. Hydraulic-suspension car - - NEW 2008 FORO" 12 NEW 200B FORD. NEW 2000 FORD NEW 2008 FORD NEW 2008 FORD NEW 2009 FORD 6. Mr. Tucker »pAUTOMOTIVE SALES - '3 '5 lo. Insight maker RANGER F-150 F25O Super Duty EXPLORER XLT FLEX EXPEDmONXLT: - sIk1D345- '0 î 1 1 . 1960s mid-size Plymouth - sales manager, south Stir. #1(612 : Stir, #113265 SIk, W2335 Sik. #E941 . Stk #CO25 - 14. Cherokee, Wagoneer rolled Into TERRANCE BOYLE :: 708.802.8031 IT IO $1O37O* $18.798* $221671* one $11,799 $16341* $23,9, 19 20 21 16. An Acure In Japan [email protected] 22 o WAIOUANTYYIZA?,IQO,QOO pS,, 449% APR FinancnqAvailabIe on Certifléd Pre-Owned Vehicles!0 23 í1 7. Shift too soon .'20. Ronds ride sales manager, west . : ,;r::,..:., - 22. Roadster builder Donald ' -. . 24 25 28 .., GEORGE MOLNAR :: 630.978.8194 UNDER $8ÓOO TRUCKS, VANS&SUVs CARS Unmarked police car 27 1999 DODGE STRATUS sv. t29342 2,995" 2001 CHEVROLET TRACKER LT 4X4 4DR sui es34i 6,95O" 2003 SATURN tON 2 se,. s2s3si $6,8S0 28 29 30 31 Pavement Inventor [email protected] 998 DODGE RAM 1500 ST S&M'.5174 2003 FORD ESCAPE XLT 4WD S犃 835O* 2002 PONTIAC FIREBIRD Bao 1To!S&2% S,45O 32 26. BrakIng assistant s35 2001 VOLKSWAGEN CABRIO CONY. CLX OMX4Ì1( Suc. *29356 8,695 . 1997 FORD RANGER XLTs&.2s304 485O* 2001 GMC YUKON SIT 4WD S&iI4 9,850" 935O* 33 ,. 27. German FWD specialist 4,95O 2003 CHEVROLET SUBURBAN 1500 LT 4WD ssvi69 1O,650 2004 VOLKSWAGEN PASSAT GIS AWDs&#oi 34 sales manager, north 2001 FORD W!NDSTAR LXs&i2 : 28. Caddy SUV 1997 INFINITI 045#rsiss2 6395* 2003 NISSAN MURAHO SL AWD S&J8 12,250" 2003 UNCOLN TOWN CAR SIGNATURE ssCtTf 1O,650 30 12,650 2004 MONTE CARLO SS SUPERCWARGEDStI im4e i 1,350 33. FascIa frames this MICHAEL NATHAN :: 312.321.2975 2000 MERCURY GRAND MARQUIS LS S&3 2006 FORD E-350 SUPER DUTY XLT 5M29I51 2001 LEXUS RX 300 AWD S&iFS2 i 2,950" 2004 HONDA ACCORD EXs&nssie . .. i 2,45G 35. Nissan's sunroof mnathan@suntjmes,com 2000 CHEVROLET S-10 EXTENOED CAB StkM9t3S s6'395 38 2000 TOYOTA CAMPY LE ss#l5s s650695O* 2002 TOYOTA HIGHLANDER UfAITED AWD StkJ29264 13,350" 2005 CHRYSLER 3OOseís7i - 12,650 2006 FORD FUSION SE Sti.tFSO57 12,750 31 38 Popular '50s Ford option 2001 HONDA ODYSSEY fls&9 2007 FORD EI5O CARGO VAN StkUS25 14,795 A deer Triumph 2005 DODGE NEON SXT sn waits s7'650"7895* 2007 CHEVROLET SILVERADO 3500 LS w!Sbstoy 5&Jf$ 19,350" 2007 FORD TAURUS SEL S 13,750 2007 FORD FIVE HUNDRED SEL S&*sat 13,950' 39 Service dept. vehIcle (slang) 2004 SATURN ION 5i1ci29154 7,95O 2005 FORD EXPEDITION XLT 4WD Slfl00iT41SiFS1972 19,65O 2007 FORD EXPLORER EDDIE BAUER 4W0 Sesea 20,250' 2005 CHEVROLET COBALT SS SUPERCH*RGEDSSI. i1U 13,950'. 40 41 Metropolitan maker 2002 CHEVROLET BLAZER IS 4WD Stk.t29fl8 . 795O' 2004 DODGE NEON Sfl sa.i28s 7.995* 2008 MERCURY MARINER LUXURY 4WD S&lFS? 20,650' 2005 LICOI.N IS S5(IJIII 13,950' Al . Like Minor only bigger contact us - - - - - 2008 HONDA EP.EMENT EX AWO sikFsmw 21,250 2005 HONDA ACCORD SEs& #ji 13,950' 42 : 2008 PONTIAC GRAND PRIX GPsusnas 43 Bed cover 2007 TOYOTA Fi CRUISER surs7ssa 21,550' 14A50' 44 . . . - . 21,850" 2008 FORD CROWN VICTORIA LX sa. trsim2 14,950' British tíatfic circle SPECiÄL5- 2004 LINCOLN NAVIGATOR ULTIMATE 4WDsesm4 2008 SUBARU TRIBECA LIMITED AWD.'2 23,250' 2006 MERCURY MONTEGO PREMtER SfFS8OO 15,650' On-board mapping p. 312.321.2685 I e, [email protected] 2007 DODGE CALIBER SE s&øs7 . $10,450' 2006 VOLVO 560 2.5Ts&sis 15,750' 2005 NISSAN FRONTIER SE KING CAB 4W0 StifS7868 I 1,250' 2003 FORD EXCURSION LIMiTED 4WD OIESELSIk.#2928123,450' 45 2006 VOLKSWAGEN PASSAT Vb LUXURY S&125514 16,250' 49 a.k.a. emissions equipment 2005 FORD FREESTAR UMITEDSUFs6so8 1 1,250' 2007 FORD EXPLORER LIMITED 4WD s&wsa 24,650 1 1,950' 2007 MERCURY MOUNTAINEER PREMIER AWD S1 24,950 2005 UNCOOl TOWN CAR SIGNATURE UMITEDS&SFS7838 16,695' SEARCHCHICAGO-AUTOS 2005 SUZUKI GRAND VITARA EX 4WD Stk.tFSi723 2006 PONTIAC SOLSTiCE CONVERTIRLE 5U57555 16,550' 2004 DODGE DURANGO ST 4WD Suc. #28256 i 1,950' 2007 FORD F-150 SUPER CREW 4W0 itsail 26,250' 26450' 2007 CHRYSLER 300Stk. u323 - 16,950' E RS 350 N. Orleans St. 10-N Chicago, IL 60654 2005 FORD ESCAPE XLT AWDs&rsm3 ' 1 2,550' 2005 INFINITI FX3S AWD 51UF57943 2006 FORD F150 SUPER CREW KING RANCH 4W0 27,250' 2008 FORD MUSTANG DELUXE CONVERTIBLE ssmi9 17,550' DOWN i 9. AMG badge found on these 2004 CADILLAC SRX stk.#}siias . 2006 MINI COOPER S SĿ 18,975' 2008 NIA SPORTAGE LX 4WD 1F57708 s'3''50'14,850" 2007 CHEVROLET SILVERADO 2500 LT Zu 4WD SesoS SIi3442 250' OU reservoir vehicles 28,950' 2007 FORD FIVE HUNDROED LIMITED SltFS 19,35O 2004 VOLKSWAGEN TOUAREG V6 4WDSIkIFSTIS4 16,45O' 2006 FORD F250 XLT CREW CAB 4W0 Diecell SitF5 19,550* Knotty wagon trim 21. WW li highway 19,250' 2008 VOLVO XC7O 3.2 AWD $&IFS7 28,950' OO8 MERCURY SABLE PREMIER sscirsaosz 2008 MAZDA (X-1 stk.#Fsmto 30,950' 2008 VOLVO 560 2.ST Se,. srs3i 4 Transmission slip-up "Mag" wheel 2008 NISSAN MAXIMA 3.5 SE SSIFS753I I 9,950' 2008 LINCOLN MKX AViD StKwSw43 2006 LAND ROVER RANGE ROVER SPORT HSES&I2933 30,950' 2007 FORD MUSTANG GT S
20,750' SearchChlcago.Auts Is featured In these 2005 CHEVROLET SSR#wsv . 2395O* Spinout star Lamborghlni mascot 32,650' 2008 VOLVO SSO 3.2 StitJFS32 . 27,850' 2005 CHLVROLET CORVETTE S& 128912 34,650' 2008 FORD F250 XL? CREW CAB 4X4 Nsai$tL 1157949 First FWD Dodge Mixes wilh fuel for combustion Sun-Times News Group pubøcatlo,w Canadian-buIlt guliwing 29. Aspect ratio refers to height of Corvette tuner enjoys this MADE M ISTAKES? GET MIIGIVEH ANO DRIVE HOME or call 800-26HSO0 : . "driving" 30, BugatIl's handle (,0 f 'Çl t il 11. Fender Ashowforcars 4I It'..4t'5i) ------i:£*4al Sales & Service Oper. until lOpmI Days of Thunder hero Shop without leaving car SIJNI'IMES C&irierNews u 9423 W. LINCOLN HIGHWAY 25u1uIiaN$Sn*I Shift-gate cover 34. Speeding driver (slang) ; ,. -. . 14. A deluxe Comet -,- FRANKFORT1L60423- . 36. Italian tire maker -SUN i 5. Four-wheel skid 38. Korean sport-ute IIra1dNews FO ._e. v.anIe a vta U.CIflCCC WIYUr 18. Australian-built Pontiac - :-. :,, ' -V--E FO K D 42. Tire valve mounts Inside this Bé'äconNewsNàèThHe Sun www.fordoffrankfort.com8 6 6 - 9 7 - 3 6 7 3 ofliriaricing offers °Avaifabte on select Fo«I Certified models to qualified bvyes with copyRloHr WHEELBASE COMMUNICATIONS 4Pius tax, titis, Iicens& doc t Includes factory rebates when applicable In lieu reeponslble for pricing etmrs ¡n this advertisement Pilcas and offers PIONEER PRESS approved credit Fiotos for illustration purposes only & may not reflectthe actual vehicle. Dealer not SOUTHrowNStR expiretwo dayfroñbtkatIòhdath.'Based onExecuUve lníoñnadon System DeaterflanklngforFolTi DMsIon 41.AII RetailTnick salesfor'2008. All vehicles suWectto- aply,onIytO newretall defivedestakén from dealerstockwithln. pnorsale. Mnldjtkal èquipéd vehicle In stoc4c Dealer reserves the rightto verify 1eaJM offers ..ON 2O5 ROUTE I%eSL.ES 30 SOL.JTII LINCOLN a. HWY. - \the applicable advertised time penod Offers do notapply to fleewholesale or poor sales All veiIcIes sutectto pnorsales ,,,.' t,, 04 0 . ,.,,,Nt,.

2008 2008 ('R. ES t DE NTS )iIltéT «B PRESIDENT'S AWA R D AWAR D

s ..'z:,, s ,', I k 'ç

£ 1

o

¡a

AutomatIc Automatic Model I FAi 639EW, Model # CP2639EW, 2009 Honda Stk#H22546 2009 Honda Stk#H22338 Civic DX VP Accord LX . Sedan if HOÑD2 Sedan $ OFFICIAL VEHIC$.E OF THE MIlL

Per Mònth For 24 Months Per Month For 24 Months Totaldueatlease .' $2OOPlusta i linseanddocfee Total due at lease fripdon ls$2OO de, &ense and doc lee

Model # RE4859JW Model # RL3829EW, 2009 Honda Stk# H22549 2009 HOnda Stk# H22410 CRV EX Odyssey LX rj 4 Wheel Drive

Per Month For 24 Months Per Month For 24 Months NHL antheNHI. Shield are regisleîe Iraemarks of the National Hockey League. NHL20D9. AllRlahts Reserved. Total dueatleaseinception ls$2000. Plustax,fle, lieuse and doc tee

ÌO.CHOOSEi::coos. i.5TOCHOOSE iOÌOCKOOSE OCHOOS1' 2004.2007 ACCORDS 2003-2007 CIVICS 2004.2008 ODISSEYS 2004-2007 P310Th 2004-2007 CR-Vs . Froms 13,488 Froms8,966 Froms 13,497From sll,988From sll,688 To $.19,997 To $18,997 Used Cars To $29,997 To $21,997 To $24,997

t 'Prices p!us tax title license and doc fees. afl rebates and incentives applied Financing on setect years makes and models. Based on approved credit Io qu&itied buyers. ffaased on closed end leases. Io qualified buyers with approved ciedit, 12,000 allowable miles peryea i5lot each addiliona) niile (Odyssey 2O). All lease vehicles require tax, title, license & $151.65 doc fee due at lease signing. '09 Civic : Residual: $11,896, 09 Accord : Residual: $14761.50 '09 CRV : Residual: $17,248, '09 Odyssey : Residual: $15,674. Additional options extra. lessee s responsibleto, excess svearear maintenance and insurance. Subeçt to early termination penalty Valid three days troni publication, Dealer will not honor errors in this aveisemenL ot available with any previousoffers, Exceeding Your xjectations For Over 35 Years! Publication I\ IuII)fl0CI''8S 'I'hursday, March 19, 2009 17 _B_ IThtrsday, March 19, 2009 wwwpioneerlocal,com A Pioneer Pres Pubilcation (Dc)

, I O . 0 O O A O I d I I I d I I

TOYOTA BREDEMANN LEXUS wìrelèss 2000 N W)WKEGAN flD , GNVEW Chicago s Largos? Service Couler , BREDEMANN TOYOTA 1301 W. DEMPSIER, PARK RIDGE (847) 729-6000 Proud to beiul hIe Cluicago!auid area since 1931. Introducing t3ROE MAN N .COM (847) 698-3700 > DREDEMANN.COM. 10 MC GRATH LEXUS OF HITS Vt3ISHII . apleton MOTORS k CLASSIC TOYOTA CHICAGO M1tsub1sh ," 515 w;3REENMy Ro. Unilmted calling to anylO numbers. 1250 W DMSJON r (800) NEW-LEXUS 3 WAUKEoAN It.. Fie ns &Fa It.Anywhere n America. Anytime. ' r , I347-CLASIC d in i . \ - 2009 MitsubishiLancer DE CIASSICOEALEROIIOUP.COM Full lOO,OO Mlle Warranty, MC GRATH LEXUS OF , WESTMONT i t. i : Fully Facloiy EquIpped. ( ox LAKE TOVOTA 470 E. OGDEN AvE. ": Fo«MERLY EVANSTÖN TOYOTA" Get the best value in wireless. (800) NEW.LEXUS '.75S,RTE,12., FOXLAKE WWW.MCGRAThLE)(US.COM (847) 437-9147 ' FOXLAKETOYOTA,COM LEXUS OF numbers to shareon any Nationwide Family HIGHLAND PARK GROSSIÑGER TOYOTA C Iioose i oSharePlan with 1400 Anytime Minutesor more. 3040 SKOKIE VALLEY ROAD, NORTH HIGHLAND PinK 7225 N. CICERO, LINCOLNWOOD (847) 432-1900 (866)612-6679 LEXU SAU TO S . CO M V. numi,ers onanyNatlonwidesingle-Ilne Plan c:: hoose 5with 900 Anytime Minutes or more. LEXUS OF ORLAND '. GROSSINGER CITY Activatlonfees, taxes & othEr charges appIy. 8200W. 159111 ST. ' TOYOTA . (708) 342-6475 1233 N. Waas Sr., CHICAGO Choose any numbers on any network. Even landlines. WWW.LEXUSOFORLANO.COM (800)873-9315 BOB ROHRMANS ARLINGTON LEXUS IN Pius, get unlimited talk with America's Largest PALATINE LIBERTYVILLE TOYOTA Mobile to Mobile Calling Family. Over 80 million strong. 1285W. DUNDEE RoAn, PALATiNE 1 180 SoUTH MILWAUKEE AVE. UUST 'AEST OF fT. 53 ON DUNDEE) LIEEIITWILLE 1847)-991-0444 (847) 362-1500 O. LIBE RTYVILLETOYOTA . CO M PAULY TOYOTA LANDRO :tI .t 1035 S, RT. 31, LANDROVER OF CHICAGO A II . ONEMILESOUTHOFRT. 14 AT HOWARD ORLOFF 826 Toulìy Ave.Park Ridge, IL 1815)459-7100 (847)658- KENNEDY Exp. AT ARMITAGE 9050 1888)510-0669 800-794.8046 100% amazing. 50% off! Our best Samsung phones. OSLOFr.COM NORTHBROOK TOYOTA 1530 FRONTAGE ROAD LANDROVER OF NoRmFIRooiç IL 60062 Already a customer? HINSDALE e e (800) 743-9594 300 E. OGDEN AvE,, HINSDAI.E WWW.NORTHMIOOKTOYOTA.COM Samsung AliasR Samsung Sway Samsung Omnia Visit verizonwireless.com/myverizon (866)516-8045 HIN S DALE LAN DRO VE FIS .COM OAKBROOK TOVOTA/ Now$ 9 Now$ 99 Now$fl99 to manage your account online SCION IN WESTMONT only only LANDRO VER lVlAZDA NISSA,' PORS(. scioNr 550 E. OGDEN AVENUE only L 7 and set up your Friends & Family HOFFMAN ESTATES LIBERTY AUTO CITY/ THE AUTOBARN NISSAN (630) 789-9600 $99.99 2-yr. price- $50 mall-In $79.99 2-yr. pace - $50 mall-In $169992-yr. pdce-S70 mail-In rebate PORSCHE EXCHAÑGE FOX LAKE SCION OAKB ROO (TOYOTA CO M numbers today. 1051 W HIGGINS ROAD. MAZDA OFEVANSTON - 75 S. RTE.12., Fox LAKe rebate debltcard.WÌth new rebate debit card. With new dehitcard.Withnew2-yr.actbatinnon HorFM6N ESTATsS 1001 CHICAGO AVE. PORSCHE PIEMIER DEALER 1000 E. PARK Ava, 2300 SKOKFE VALLEY RD. (847) 497-9147 2-yr. activation. :; 2-yr. activatIon. suce plan withemail tëature, oremail plan. LJBEIIrYMLLE (847) 475-8200 (866) 516-8035 THE AUTO DARN . COM HIGHLAND PARK FOX LA KL SC IO N CO M ORLANO TOYOTA! LANDFIOVEFIHOFFMAN.COM (866) 474-4313 SCION 8505W 159m ST., LIBERTYAUTOCITI.CCM (847) 266-7000 BOB ROHRMANS 4F'ORSCHE.COM NORTHBROOK SCION TINLEY PARK LANDROVER LAKE BLUFF 1530 FRONTAGE ROAD, (730) 429-3900 MULLER MAZDA ARLINGTON NISSAN OR LA N DE Cb N . CO M wlh'td mricas st ar, enable.1ire)essIetwork KNAUZ AUTO PARK 150 SK0IcIE VALLEY ROAD, "WE SPEAK YOUR LANGUAGE" N0RmUR0OK Rouis 41 @ AT. 176, LAKE BLUFF MOTOR WERKS HIGHLAND PARK, IL 915 WESTOUNDEE ROAD BARRINGTON & DUNDEE RD., (800) 743-9594 BUFFALO GROvE WWW.NORTHUROOKSCION.COM (847) 604-8100 (847) 831-4100 BARRINGTON KNAU Z. CO M MUL LE FICARE. CO M (847) 590-6100 Call 1.877.2BUY.VZW Click verizonwirelesscom Visit anystore ROHRMAN.COM (866) 289-6275 MOTO RWE R KS .COM PAULY SCION PATRICK LANDROVER 0F ON ATE. 14, CRYSTAL LAKE v0EKSWA ' VERIZON WIRELESS COMMUNICATIONS STORES AUTHORIZED RETAILERS Equipment prices, models & return poiicy vary by NAPERVILLE M ERCED: LIBERTY NISSAN (815) 459-7100 (847) 658-9050 AUTOBARN i 559 WEST OGDEN AVE. 920 S. MILWAUKEE Ava.. UBEflTYVFLLE VOLKSWAGEN OF Ali listed locations are open on SUnday (except where indicated). Call for store hours location Authorized Ret.iilers may impose additional equipment relared charges, IncludIng NAPEHVILLE AUTOHAUS ON EDENS (866) 329-2296 cancellation fees. MERCEDES BENZ LID ER fl'A U TOF'LAZA. COM RoLLsR: COUNTRYSIDE! ADDISON JOLtEr 3330 Mall Loop Dr. 81 5-439-5100 (630)300-5000 ' LAND RO VE ROFN APE FI VILLE. COM )6OO FROWrAGE Ro, NOR11-WROOK . LaGRANGE P45W! 1801 W. Lake St 630-916-8066* LAKE IN THE HILLS 290 N. Randall Rd. 847-458-2866 MARTIN NISSAN STEVE FOLEY ROLLS-ROYCE sMAR1' 6191JOLFETRD ' ALGONQUIN The Cellular Connection 847-658-0808 (800) 716-6495 . 100 SKOFIJE BLVD. NOFFTHB900K ARLINGTON HEIGHTS 138 E. Rand Rd. 847-253-0329 * LINCOLNW000 Lincolnwood Mall 847-568-1554 * ARLINGTON HTS. The Cellular Connection 847-255-2222 AUTOFIAUSONEDENS.COM 5240 GOLF ROAD. 5K0KIE .lOntv15rr*itosfroniDoitownO*ago) MATTESON 4063 2) lth St. 708-748-7444 (866) 799-0300 (847) 564-4090. ,.- smart center LAKE BLUFF (708) 354-6600 AURORA 740 N. Rte. 59 630-851-2254 * BARTLETT WIreless Millennium Communications 630-483-5050 STEVEFOLEY.COM KNAUZAUTOPARK MCHENRY KNAUZ MERCEDES BENZ MARTIN NISSAN.COM THEAUTOBAFIN.COM BATAVIA 350 Randall Rd. 630-761-2160 * ELMHURST1he Cellular Connection 630-834-2776 ILLINOIS' LASOEST ROL1SIlOYCE DEALER Room 41 & RoUTE 176 NEWt 350) Diamond Dr. 815-344-2177 KNAUZAUTOPARK BELVIDERE 1912 Gateway Center Dr. 8)5-547-9493 EVANSTON Norris ShoreWireless 84/-733-07W LAKE BLUPP MERRILLVILLE,1N401 W.8lsl Ave 219-736-8400 ROUTs 41 @ RT. 176, NORTH SHORE NISSAN BLOOMINGDALE Stratford Square Mall 630-582-4707 GLENVIEW North ShoreV4reless 847-729-6100 Rit. 41 & PARK AvE. VWSr, (847) 234-2800 BILL JACOBS 2109 Soulhlake Mall 219-756-7440 LAKE BLUFF KNAUZ.COM 336 W. Army Trail Rd. 630-980-4322 * JOLIETThe Cellular Connection 815-838-2900 HIGHLAND PK. VOLKSWAGEN BOLINGBROOK 224 Weber Rd. 630-226-4660 MT. PROSPECT 1 W. Rand Rd. 847-259-2627 * (847) 234-1700 (847) 4.33-7900 SAAR 221 1 AURORAAVE., Ni.pEiu.e LAKE BLUFF TowerWueless 847-457-1 168 HIGHLAND PARK FORD/ KNA UZ. C O M VVW.V. NOIITFISHORECAR$ .COM 697 E. ßoUghton Rd. 630-783-8966 * NAPERVILLE 1 1 1 E. Ogden Ave. 630-420-3299 LINCOLN MERCURY SAAB EXCHANGE (866) 516-8025 NILES 9635 N Milwaukee Ave. 847-967-1 150 * LAKE ZURICH Corporate Cellular 847-54O444O UILLJACOBSVW.COM BOURBONNAIS Northf;eld Square Mall 815-936-7605 NORTHBROOK North Shore Wireless 847-291 -8855 1333 PAcKAvs WEST LOEBER MOTORS i SHERVOOD TERRACE, 5700 W. Touhy Ave. 847-647-7724 * LAKE BLUFF SUBA BRADLEY 840 Klnzie Ave. 8) 5-929-0693 NORTH CHICAGO North Shore Wireless 847-689-8101 HIGHLAND PARK LOEIIEFIMOTOIIS .COM Golf MIII Mall 847-298-3047 (866) 924-1111 CALUMET CITY I 245 Torrence Ave. 708-862-0500 OAK LAWN The Cellular Colinectian 708-499-4088 (847) 831-5880 4255 W. TOUFIY Ava., PONTIA AUTOBARN SUBARU OF NORTHSHORE NORTHBROOK Northhrook Courl 847-509-8527 H PL M . C 0M UNCOIJVW000 9040 WAUKEGAN RD COUNTRYSIDE! VOLKSWAGEN CHICAGO NORTH 6451 W. Diversey 773-836-4401 * ROUND LAKE BEACH Fhe Cellular Connection 847-548-5890 GROSS1NGER PONTIAC MORTON GROVE Rit. 41& PARKAVE.AS1 1652 N. Milwaukee Ave. 773-489-6200 * 235 Skokie Blvd. 847-2/2-///O (847) 675-1000 6900 N MCCORMICK BLVD. LaGRANGE NORTH AURORA 1852 Towne Cenler Dr. 630-907-2055 * SKOKIE North Shore Wireless 847-673-5800 (847) 967-9040 6191 JOUET RD. HIGHLAND PK. 3620 W. Irving Park Rd. 773-463-5364 * JOE RIZZA LINCOLN WOOD SAAUE XC HAN G E .COM WAUCONDA Wauconda Cellular 847-487-0400 (866) 670-1654 lOnly 15nneftomDowntnQigo) (847) 433-7900 4265 N. Harlem Ave. 708-457-1377 * NORTH RIVERSIDE WEST DUNDEE The Cellular Connection 847-426-9933 LINCOLN/MERCURY North Riverside Park Plaza 708-442-0755 * 2055 WEST OGDEN AVENUE, OROSSINGEFFPONTIAC.COM (708) 354-6600 WWW.NORTHSHOnECAHS.COM 81 0 W. North Ave. 31 2-397-5800 * WILMETTE Linear Communications 847-853-3500 NAPERVILLE BILL JACOBS MINI PATRICK SAAB THEAUTOBARN.COM CHICAGOSOUTH 120W. 87th St. 773-994-9100 ORLAND PARK 9264 W. I 59th St. 708-403-8200 * (630) 355-8140 1564W. OGden Ave. MULLER PONTIAC 526 MAth Duuvs, SOIAUMDURG 3435 w 26th St. 773-522-9300 * Orland Square Mall 708-403-3122 RIZ2ACARS.COM (866) 51e-8015 150 SKOKIE VALLEY ROAD, (888) 350-1599 CHICAGO CITY 500 W. Madison 312-831-0127" PALATINE 784 E. Dundee Rd. 847-934-81 I 3 * FIILLJACOIISMINI.COM PATRICK SAAB . C O M EVANSTON SUBARU HIGHLAND PARK, IL 715 CHICAGO AVE., EVANSTON 500 N. Michigan Ave. 31 2-464-1 390 * PLAINFIELD 1 2632 S. Rte. 59 81 5-436-7388 * NAPLETON 1847) 831-4100 (888) 473-1605 VOL VO 209 S, LaSalle St. 312-658-3900"' SCI-IAUMBIJRG I 249 E. l-liggins Rd. 847-330-6010 KNAUZ MINI MU LLE R CARS CO M RIZZA SAAB LINCOLN/MERCURY KNAUZAUTOPARK E VA N STONEU FIARU .COM NEWt 36 State St. 312-726-8277 * Woodlìeld Mall 847-619-0773 826 TOIJHY AVE., PARK RIDGE 8425 WEST 159m STREET, BARRINGTON VoLvo,:. SOUTH ELGIN 596 Randall Rd. 847-695-1667 * Rouît 41 @ RT. 176, LxE BLUFF' TINLSY PARK 300 N HOUGH (FIT. 59), BARnINGTO. CHICAGO RIDGE Chicago Ridge Mall 708-346-9557 * (800) 931-6583 (847) 604-5050 SULLIVAN PONTIAC LIBERTY AUTO CITY! CRES1WOOD I 3447 S. Cicero Ave. 708-396-9822 * ST CHARLES I 24 5. Kirk Rd. 630-5 I 3-5326 * FARIÇRIDGELINCOLNMERCURY.COM KNAUZ.COM (708) 429-6000 (847) 381-9400 : . 777 W. DUNDEE ROAD, SUBARU CRYSTAL LAKE 1 125 South Route 31 815-444-6080 VERNON HILLS 70) N. Milwaukee Ave. 847-247-2300 * AlFUNGTON HEIGHTS, IL 1000 E. PAFIKAVE., baernyviae DOWNERS GROVE 1404 8utterfield Rd. 630-953-8052 WEST DUNDEE Springhill Mall 847-426-2177 PATRICK MINI (847) 392-6660 (866) 474-4313 HOWARD ORLOFF WHEATON 109 W. Geneva Rd. 630-668-2199 700 Esr Gou RD. U ILLS U L LIVAN . COM GURNEE 6543 Grand Ave. 847-855-6019 * SCION LIBE FFTYAUTOCIr,'. COM VOLVO WHEELING I 538 E. Lake Cook Rd. 847-215-8788 * MAZDA:. SQIAUMBURG, IL 60173 KENNEDY EXP. AT AFIMITAGE HILLSIDE 2201 S. Wolf 1d. 708-947-2500 * (866) 370-6567 BREDEMANN SCION (888)510-0669 HODGKINS 9402 Joliet Rd. 708-387-0554 * WILLOWBROOK 7450 Kingery Hwy. 630-887-2944 THE AUTOBARN PATRICKMINI.COM PORSCN 1301 W. DEMPSTER, PARK RIDGE ORLOFF.COM HOFFMAN ESTATES 2734 N. Sutton Rd. 847-645-0100 * MAZDA OF (847) 698-3700 SUZUKI In Collaboration Willi HABLAMOS COUNTRYSIDE/ WWW.BREDEMANN.COM RUSIP1ES CUSTOMERS MITSUØ1 LOEBER MOTORS PORSCHE GROSSINGER SUZÙKI PATRICK VOLVO *aptla$1LI ESPAÑOL LaGRANGE 7101 N. LINCOLN AVE-SOUTH OF 1600 E. HIGGINS RD., 1-800-899-4249 5700 LAGRANGE Ro. LIBERTVVILLE TOUHY, UNOLNWOOD 6900 N MCCORMICK BLVD. AlcatelLucent o MITSUBISHI CLASSIC SCION LiNcoLNw000 SCHAUMBURO, IL. - (708) 354-2700 (847) 675-1000 425 N. GREEBAY Ro., WAUKEGAN (847) 605-4005 gov't taxes &oursurdmargei could add 9%-33%to M AZ DAG UYS CO M i 1 19 5. MILWAUKEE AVE, LWERÌYNLI.E LOEUERMOTORS,COM (866) 670-1654 PATRICK VOLVO.COM & SSC Admlnlstiative/llfle/mO. & others by area) are flot taxes (detaIls: 1888-6841888J: (847) 816-6660 (888) 300-0958 G ROS S IN G E FISUZ.CO M "Our Surcharges (Ind. Fed. (mlv, Sec. of9.5% oflnterstate &Int'I telecom charges (vamies quarterly), 7C Regulatory LIBERTYF/ILLEMITSUI3ISHI,COM CLASS ICDIR E CT.CO M yESrbIIl.Activatlonfeejjlne:$35($25torsecondary FamllySharePIaflhlfleSW/2Yr.A9m). eadyterrrtlnationfeelline. up to4O(/mlnatterallEwance&addIdIargeSaPPlYfOIdata tent or recelved.Frlends&Farnlly:Only domestic landllnerwIreIelsnumbers JOE RIZZA PORSCHE VOLVO OF LISLE ; BIGGERS MAZDA LiBERTY AUTO CITY IMPORTANT(ONSUMER INFORMATION:SubjecttoCust.Agmt, Calling Plan rebatefomm & uedltapproval. lipto $115 eligibility limits; set up & manage unMyVerimon.Olfers & coverage,vamyíng bywc., not 1320 E. CHICAGO ST., ELGFN NAPLETON MITSUBISHI 8130 W. 159TH STHEEr, Midwest's 1orest Volvo Suporstoro ellgiblelleesonan accoEntslIare theMIlie FrIends & Family nurubets, up to a«ounts CONTINENTAL SCION SUZUKI lolherthan dimectoryasslstance, 900numbers arcuttomer'sownwlrelessorVolce Malla«ess Eumbersi lncluded;all 51x5 (866) 9-MACHINE 826T0UHy AVE., PARK RIDGE ORLANO PARK 9960 JOuET ROAD, CoUNmyslos 1000 E. PARKAW., LJEERTVVFU.E RTE.53 lBlk.SofI-88 debit catd takes up to 6wks& eup. In 12 mos.C2009VerlaonWlreleSS. THE MAZDA MACHINE ON FIT. 19 (800) 931-6583 (708) 364-2400 (708) 354-5800 (866) 474-4313 (EIWTOLLWAY) available everywhere. Networkdetails& coverage maps atvzw.com. LImited-time offers. Whllesupplleslast. Rebate HIGGERSMAZDA.COM NAPLE TO N .CO M R IZZACARS CO M CONTINENTALMOTOIIS.COM LIBERTYAUTOCITy.COM (630) 852-6000 WWW,THEVOLVOSUPERSTORE.COM 7.

18 Thursdny, March 19, 2009 I NEWS A Pioneer I'ress Publication Thursday, March 19, 2009 19 A pioneerPress Publication I CURRENTS

CUSSES spiritual lives, Call Bob Volleyball on Tuesday and Boot Camps for all ages. How Illinois lawmakers voted ¡n Congress PEEK AT THE WEEK - Galassi, (847) 965-0920. Thursday mornings in the The center nrw offers Body LET US HELI YOU . Week ending March 13 senior-citizen real-estate The Flex Kids for ages 8 to 6 ADLlNES . disses are gym from 9-11 a.m. This tax exemption and deferral, TheAmedc JuIsh held in the Nues Township non-competitive ongoing andages5to9OflTht11s- SubnhiSi0 for Corn- the senior-eltizen tax-assess- Artistsci i 'Mà Schools ELL Parent Center, accepting program is free to mem- days; this class gets a child munitY Cn1endai arere- ment fi'eeze and the long- Deputy Atty. Gen. Oqden: Senators confirmed, 65-28, David W. Ogden as deputy attorney general, the 9440 N. Kenton Ave., Skok- new members. The group, bers; guests can pay a drop moving with the use of light second-ranking post at the Department of Justice. Critics cited his litigation al pornography cases. Detenders uiredl4 dayspreceding tinie-occupant.homeowner le: founded in the early 1920s, in fee of $6 for residents weightan steps, BOSU and Celebrate! called that "character assassination." A Yes vote supported Ogden. publication. the date of property-tax exemption. focuses on the broad as- and $10, non-residents. other appropriate fithess Sen. Rkhard Durbin: Yes; Sen. Roland Burns: Yes .. , . c_ desees wifi Send tNues Managing pects of artistic perform- equipment. Youth and continue 6-8 p.m. March 30, Announce Your Special Family Events: $410 Billion Bidet: Senators advanced, 62-35, $410 billion in spending br agencies operating on stopgap Editor, PioneerPress, 8701 ance and serres to enrich lb-MayNIØt Rufor ages Adult Boot Camp on Fr1- and preparation of simple and April 6, 13, 20 and 27 2009 budgets. AYes vote was to advance FIR 1105, which funds $7.7 billion in both parties' earmarks While w. L'the Ave.,Glenview ¡L the cultural fiber of the 5 to II will be held from 6-9 days combines cardio inter- denying lawmakers a pay raise next January. The bill was passed by voice vote. ' wills and durable powers of Call (847) 635-1426 to regis- 6002G. Information rnm Jewish community Call p.m. March 20 and April 17. val training with segments _.. See. Rkhard Dvobln: Yes; Sen. Roland Burds: Yes - attorney for health care ter. Birth faxed to (847) 486-7495 or Lori-e Slaw, (847)72-0744, Swimming gym, crafts and ofweight training and con- Engagements Ech,J ' Aitomatk Pay Raises: Senators upheld, 52-45, existing rules under which lawmakers get a cost-otliving and property also are avail- e.mailed to mbottari@Pi°- T1: Tota en* Corn- or e-mail [email protected]. snacks wifi be included. ditioning in a child-friendly ' Announcements A1flIUU.'!S)c1 raise each January unless both chambers vote to deny it. Separately, the bill at hand (HR 1105) would deny a able by appointment. nI_, in Partnership with Cost is $10, members; $15, environment. Adult boot vitjì )Ut) S5Ø raise in 2010.A Yes vote was to retain autopilot rules (or raising members' pay. neerIOm. The Jeiey$iecnsei 51f,. RkMrd Durbin: Yes; Sen Roland Burns: Yes &ort for Oakton Conmiunity College, nonmembers. Camp adds a challenge to Weddings Birthdays BENEFITS Motorcycle Touring Club EÌc)).41 " 2 is offering free Fbmily Lit- the usual workout routine. D.C. SChOOl Vouchers: Senators refused, 39-58, to strip HR 1105 (above) of language giving the District of Alzheimer's caregivers, meets at 7:45 p.m. the Boys Nit. Out for ages5 t't' I) -n P eracy Classes on Saturday The class uses multijointed Columbia City Council the option to end D.C's school voucher program after the 20092010 academic year. A The Mfle SouthMuir those suffering from grief fourth Tuesday of each to 11 will be offered from 6- Graduations .vUhjviph'kitphi i 43 mornings. Classes run from exereises that help burn Anniversaries Yes vote was to preserve the school voucher program. ers' ScholarPClub will and loss, and seniors seek- month in the Des Plaines 9 p.m. April 3. There will be sen. Rkhsrd Diirbin: No; Sen. Roland Burns: No 9 n.m. to noon at Gemini more calories and fatCall Ench i\iidiljnnnl have its Spriflbenefit, ing to improve their nutri- Elks Club, lower level, 495 sports, games, snacks and Junior High School, 8955 (847) 588-8400. , - .1.23 "Win, Place, Show for tian are available at the wii. Bring a friend. Cost is Bar & Bat Special lo àiO i!óI$:th. Lee St. (two blocks north of Bobby Rush, D-ist Y Y N SchoIarShiPS' frnm 6-10. Center of Concern in Park Greenwood Ave., Niles. lessons are Retirements ConservatIon: Members failed, 282-144, to reach a 2/3 majority Route 14), Des Plaines. Jer- $10, members $15, non- Pdvit Mitz'vahs JesseJacksonJr.,D-Znd Y Y N p.m. April 17 atMaywood .' Note: Child care is available for passing a bill to give wilderness protection to 2.1 million acres in Ridge. The center also of- seypine Cruisers' Sunday members. offered for people of any Dan lipinski, 9-3rd Y Y N for children who are out of California, Colorado, Idaho, Michigan, New Mexico, Oregon, Utah, Park Race Track. Tickets fers affordable personal Breakfast Rides leave at 9 age who prefer one-on-one, Luis Gutierrez, 0-4th Y Y N GlunoswGirlsages 6-II Virginia and West Virginia and protect federal land in other states. A are $30 per personand in- diapeiCall Pamela Any orders of two or more towns wiII'rec&vea FREE print suitable br framingi Peter Roskam, R-6th N Y N counseling to adults of all n.m. from McDonald's or smaller, group instruc- Yes vote backed S 22. Surber, TLC director, (847) get ready to be pampereL Danny Davis, 0-7th Y Y N elude: valet parking, admis- ages. Call center social Restaurant at Oakton and tion. The cost for private 827-4137. Enjoy an evening of haii Clean Water Members voted, 317-101, to authorize $1.8 billion Melissa Bean, 0-8th Y Y, N sion, Maywood Park's worker Ma Fcgart lessons is $20 for members; For more information1 contact: Lee streets in Des Pbaine nails, lotions, jewelry mak- over five years for programs to keep raw waste from overflowing into Jan Scliakowsky, D91hY Y N grand gourmet buffet of (847) 828-0458. The center $25, nonmembers; semipri- CLUBS Rides are usually 25 to 85 ing and anything else girly Liz Maier at (847) 486-7230 or water ducts and $13.8 billion over five years to help communities build Mark Kirk, R-IOth Y Y N chefs carving stations, all- is at 1580 N. Northwest miles. Call Bett1; (708) 366- vate lessons are $13 for and maintain sewage and water systems. A Yes vote was to pass the Debby Halvorson, D-llthY Y N from 6-9 p.m. May 8. Fee is you-can-eat shrimp, chick- Highway, Suite 310, Park Les Bavds, a monthly 3822, or Joe, (847) 217-5876 members; $16, nonmem- celebrate@pioneerlocaLcom. bill (HR 1262). Jerry Costello, Di2th Y Y N $10, member and $15, non- Submit your ads online at: www.pioneerlocal.com "Send Us Your News" en, pasta andfish entrees, Ridge. The center also of- francophone dinner-group, or visit wwwjerseyp- bers. Call (847) 588-8413. DavIs-Bacon Act: Members refused, 140284, to strip HR 1262 Judy Biggert, R-l3tb N Y N member. BillFosler,Di4th and the "Decadent Dessert will meet at 6:30 p.m. inecruisers.org. (above) of a requirement that workers on projects funded by tite bill be Y Y N fers housing counseling for TheFitness Cintu has Timothy Johnson, Ri5th Y Y N Tabl&' In between live bar- seniors and others seeking March 21 for dinner and TheFitness Centeroffers paid at prevailing, or union-equivalent, levels for the particular region. Hiles Chapter Toastrnas- scheduled "Fimtastic" pro- PIONEER PRESS Donald Manzullo, RióthN N Y ness racing, participants conversation at a restau- water classes. Classes in- A Yes vote was to remove the so-called Davis-Bacon requirement from affordable housing pro- grams for children to corre- YOtIR LOCAL SOURCE Philip Hare, D-llth Y Y N can take a chance onsilent rant in Des Plaines to prao- tei'smeets at 7:15 p.m. the elude Hydra Fit, Hydro the legislation. grams designed to prevent spond with its popular aer- Aaron Schock, R-lBth N Y N auction and raffle walk tice using the language in second and fourth Wednes- Conditioning, Wet & Tone, John Shimkus, R-i9th N Y NV homelessness, in-home- obic classes. Instructors For a more detailel description of the issues, see our Web page items. Call Kathy Hanson, an informal setting. Atten- days of the month at the Aqua Boot Camp, 1120 Fit at www.ploneerocaLcom and pick your hometown paper, health care referrals, Morton Grove , 6140 Lin- will escort children to and (847) 318-6171, for tickets. dees must have the ability N'Go and Water Tune Up. click on News and click on Politics. friendly visitors ibr the from the Clubhouse. A half- to listen in French, without coin Ave. Members learn Dwp-in fees are $9 per homebound and volunteer hour. in the ClubHouse is Pioneer Press CENTER OF resorting to their native how to feel comfortable and opportunities in the office class for nonreidents; $8, included in all class fees. CONCERN language. E-mail les- have self-confidence talking residents. Call for times Classes are Mondays and ¡n the field, bavardsyahoo.com or call to an audience. Call (847) Low-cost income-tax and fees. through Fridays, and in- Club F'()Ufldatiofl of Park involvement. (847) 720-4502 by the pre- 583-9328. l)tcl):sration will be avail- CHAMBER Registration is under way elude sports, fitness, art, Ridge is accepting applica- ceding Monday evening if Otiotaniling Agcnts Digest Applications may be ob- :tble by appointment on COMMUNITY f.m. Nitos Family Fitness science and cooking Stop Oututanding Results. tions lòr scholarships from The Hiles Chamber and attending. Continued from PAGt15 'l'ucsday, Thursday and Ceni er's Summer Camp by or call; ask for Jenny or 'The # i SelIPng RV14C Office n tamed from high school ca- the Membership Team ai-e Hiles Historical Society students who live in Park S:lttIl(lay mornings through I Chiacchieroni Italian- l)man5 for ages 6 to 11. Joy, (847) 588-8400. Skokie Since i 986." Serving the Entire North Suore. reer counselors, or from launching a new benefit will participate in the Jew- Davis, Daniel Denka, Emily Ridge, attend an accredited Ajatil Il at Center of Con- languagedinner gioup Activities include SpOrtS, Shirley 1-leffernan, 1029 called the "Next Step eVOsco Shop & Share Days The foUGalig isthe Fenn, Shoun John, Arman- high school in the arca, and ('Ct'U ill Park Ridge. Adults meets at 6:30 p.m. on the oul.door games and field Thinking of SELLING Your Home? 13()flflie, Park Ridge. Appli- Breakfast," an informal March 23, 24 and 25. Shop Group Fitness schedule. arc seniors in high school III' ¡tll ages with annual in- secondThursday of each trips, from June 15 to Aug Call for a Free Market Analysis 847-674-9797 do Sacluti, Joydeep Singh, cations, recon imendations breakfast meeting foi' new at any JewellOseo store to Daily drop-in fees are $8 for ftch oflicc iiidcpcnde,itly on ut-el ¿k Oper.fled WlU) will graduate in 2009. ((IITICS of less than $40,000 month at Salerno's, 1716 E. 14. Camp hours are 9 am.-3 Joseph Turbak, Elise Wit- and trnscripts must be members. The 'next step" help the Niles Historical So- residents; $9, nonresidents. (excluding Social Security Kensiiigton Road, Mount p.m., with extended hours of turn. 'llese scholarships are received by April 1. Ques- in their Chamber member- ciety raise money for their Express cards are available l)QflefltS) are welcome. The Prospect. This is a casual 8-9 a.mn. (an additional $5 awarded Ofl the basis of Lions can be c-mailed to: ship is to attend this orion- oiganization. For details, for numerous visits. Scholarships Ice Iòr basic federal and evening of conversation in per day) and 3-5 p.m. (an tation. They will learn call (847) 390-0160. scholastic nient, linancial barriebs(ñ)msncom or call state returns, including Italian. The next meeting additional $10 per day). Fees C&dio flislon: Cardiovas- 'l'he '!\entjet}i Centwy need and extra-curricular (847) 204-430f;. more about getting in- Outstanding end unit townhomeHandsome 'Ibedim i 5 (latIPortageParkBeastyr (lockVery spacious lowntionne With Schedules A and B and the will be April 9. Call Gabriel- Our Lady of Ransom run $128 for members and cular workout with muncie ew construction winianyGeorgian w/att Garaqe on on 3 UnitsBeaeiituttidiedtirsopen living A dining rm tlonr volved, chamber benefits, shaping using interval Step, uyradns Kitw/42'mapte(it Skokie prettiest A prestiyiou Decorativetryics, updtdhitplan Urigtrlnewwindows EattlC(l Income 'fix Credit, la, (847) 541-8524, or e-mail: Parish, 8300 Greenwood $166 for nonmembers for a . . abiiietry,Kianite Cntrtaps &streets lounat living S dining S 1111m Itardwond & ceramic tiletIro and effective networking. Walk-ui liaritrienAll e k is $25. More complex re- Ave., Niles, will hold its an- plyometries, Kiekboxing or s s appia lormal diniiilin FillEst-iii-kit w/tireaktast riso 3 Aptu liane sephuIs bldgFinishedlower levelw/tiill ichiacchiei'[email protected]. full one-week session; three batIr,laundry rin& storage ' The event will be from 8-9 Master bath InH riiytish bsmt,soerlonks yard4 Burma upNnw root S tuckptg Nice wood : ,i' I3OSU combinations with No rrluirttrby assorts Plenty ot tuins cost as much as $50. nual St. Joseph's Sweet days per week (parent's att 2 1/2 car gar Low asnlnth Firislid buirit Main tir sun porchDeck nthe backyardNew Join the CatholIc parheog $235K n.m. March 24 at the Nibs I-tiIity desirabtesaid outas-in as trptc Intivurg ini 2 car gar The center's offices are at Thble from 8 n.m.-! p.m. strength training Fsh u League for choice) is $86 for members; douclopijient. $349,000New rent. siding & gutters , I I Chamber Board Room, Women'sBowling with core work and stretch; I 1580 N. Northwest High- Ladies Night Out at Classic March 22 (after all Masses). $111, nonmembers. Hamm AN David Hraun Jolrn »las ElIzabeth Lindsay 8060 Oakton St., Nues. intermediate to advance. 847-686-2000 way, Suite 310, Park Ridge. The suggested donation is 847.322-6217 847-400-2382 847630-3796 Bowl, 8530 Waukegan Pilates Is aseries of '7i' PRE-Ò'RIVEN ÇkRS Call (847) 823-0453 to make Register online or call $5. Proceeds will benefit the Mat Road, Mortaio Grove. Fee is controlled exercises that Core Cardlo & Strenqth: -. an appointment. Home- Debbie Juris, (847) 268- work of the St. Vmcent De- t.- I' $15 per week. All skill levels Improve core strength and '. t 8180. engage the mind and body p hound residents may ask to Paul Society of the commu- tone your body. Ciross will K .;- p I welcome. Call Deanne to develop strong flexible 962 lOI have a tax preparer come The Pilles NIit of Roses nit;y. Call (847) 823-2550. include functional strength SkOKiE Drozdz at (224) 628-4009 muscles without building to their home. Alovely tioiniewith nctiDesigner granite gourme GOF1GEOUS 0NICKISTONE NEW Eaceltent opportunity lo own D 114 will celebrate those who or d,[email protected]. exercises, ab and back kilttrat speso to torniiy FREE MULTIPOINT , FITNESS CENTER bulk, seven weeks. rctidecturat details Two Story m,CONSTRUCTION IN M1IIVIEW Dis a corser bunldinD In a terrific P work, and end with a yoga entry with c$rcular slaircoantubuloso masternuite w/prrvot 4 tIrs, S bttis, 2 car gar Marble(nrtagePark locahon. New Center coiais$ors also dedicate their time and tal- deck, Jacuzzi,skytigtit, 2nd , -- knIghts of Colum- Sky liNtits througtioiitSranite 2 story toyer, oak stairs Cherrywirrdows. boiler, etc, gar The Private PNat*s Mit tir laundry, trtiwd tiro, crowncabs, granite INSPECTION t: enta to help others April 25. Cur wed stretch; beginner floor. Orond new stctien. Many cnunters & SSdoors tuck pointing & (silty are available to help eligible Nies .-, fltheu nruldings, 2 trptc, towrn beetappls io kil. Family irre w/gas fp -u rin. Units Piave been updated , bus (North American Mar- Pabutous updates A slooP lo WITH COUPON - - tir. 987 Civic Conter Dr. 50-minute session to advance. roc im w/Sttr OR/ottico, utilitytorOn deck 6 goba. Master Sorte& orn bnatrt & spacious WI residents apply for illinois It is a great opportunity to See. $609,000 . I t;yrs Council, Niles), pro- rot S both. Brick patio,icarw/Cnrotr laciiuVsep throwergleaming trdwdtIrs. Two 5 showcase your company to Niles, (847) 588-8400 or fee is $55, member or $65, gar S woiking to parti. +tiatc. Full tin. borritw/tuil ha/Sthrm 2 bdim unhs, two 4 roost Circuit Breaker property- FIM:60 nun- O/e' vides ways for members to nonmember. - - www danttoriaereatty,corrn ¿gAioo available loi rent ibedroom and onu 4 nourri tax relief grants and li- the community by sponsor- www.nilesfltness.com. F 2 bedroom unit. utes of choÑographed low- A ,'. -, Cyniac Lukqse Dan EIartn - help others in the commu- - - Etnul Dio Ctrrti(tna Eno 0FFr cense-plate discounts, 1111- Ing the event Call (847) flthess :;- 841.077.2870 847-268.7944, 77-230-5985 - 173-616-1653 Ftthsss The Mlles ., ANY $E11(E WORK OVEÌ sioo nity while trfing to im-- The Nies .-". . nois Cares Rx (prescrip- 268-8180 or visit Center presents Fitness Peek,PAE2O. prove their familyand Canter offers Co-Ed Adult tion-drug assistance), the- rjleschamber.com. Press Publication A I'ionecr Press Publication A J'ioIlCC1' rrhurJiiy, March19, 2009 21 20 Thursday, March 19, 2009 I CURRENTS J I CURRENTS J the week of April riety of class times and lo- ner to intermediate, Coi'e ChaIIene: Chal- 1700 S. Elmhurst Road, March 26 and April 2. In of Special Recreationsea- air 11t21(l shine on April 10. Come faculty steif members to be fl.IflS April cations from which to lenging core stability with Mount Prospect Sneak this three-session workshop sonal brochure for summer 18. S'°' P1°Y and meet the Easter bunny held Sept. 25-27, 2009 in Peek Ute & Fit: Perfect for 2-.Juy 25 al Grennan choose. Registration will be cardiovascular and strength preview sale is 7-9 p.m. children will arrange is available. M-NASR offers at Dee Park. Hunt is for the Park Ridge/Des Plaines Continued from PAGE 19 the mature adult. Work at 255 Oketo Ave. accepted at Howard drills on the BOSU balance March 19; brIde admission cropped photos and create people with physical and highl.S, kids ages 3-e. Ilunt for 3-4 area. A )'euflk)n committee your own pace - a combina- lt.g1l':uIiOfl fees are $71 for Leisure Center, 6676 W. trainer; 9:10-10:05 n.m. is $50, guests pay $25. Gen- journal entries. mental challenges, behavior ycar-olds is at 10 am., and has been formed to locate RUSH DERMATOLOGY impact simulated fight se- Lion of low impact (with .kIenk4; $88, nonces!- Howard St., until all classes ' . 3-6 yenr-okls is at 10:30 P ' Mondays. eral sale is 10 a.m.-8 p.m. and learning disorders, all former WMTH-FM 9 'p , ''r', ')'' quences derived from the sanie high intensity) nero- Posh Storytime for ages (hills, COIl(847) 967-1529. are filled. Call (847) 967- March 20 and 10 a.m.-6 hearing and visual impair- n.m. Pre-registration is re- alumni. Contact martial arts, boxing and ba-bics. May include basic EasyDoes It: Oilers ma- 2 and up will be held from Rcgit(I' atHoward Leisure 6633. quired. p.m. March 21; free admis- ments and emotional dis- reunioncjwnithalumnj.com. sic selí.defense, designed to step, stebility ball works andturc adults the opportunity 10-10:45 n.m. March 20. abilities an opportunity to (vntvl, (i(i76 WHoward SL sion. See wwwBridesAgain- Nues Padi District is ac- SummerCamp for State-of-the-art dermatology, offering comprehensive condition the heart, burn body toning with ab and to exercise under the close Emphasis is on listening enjoy a variety of recreation St. JoImBrebeuf is look- stBreastCancer.org ReglStfltion has begun cepting registration for the kindergarten through sixth- skin services from infancy through adulthood. calories and improve seIf back strengthening begin- supervision of a certified in- and sharing stories in Pol- activities. Maine-Niles Ing for all St. John l3rebeuf foi Nues ParkDistrict Tee- Spring Learning Gymnas- confidence. structor to achieve individ- The Men's Md Women's ish, but all are welcome. graders includes sports and School alumni. Alumni ncr to intermediate. serves Des Plaines, Golf lull Ib? girls and boys, ages tics Program. Classes are ual desired level of fitness. Association of Advocate games, arts and crafts, should contact Libby Ryder, Heart Rate Up School's Out: Monday Maine, Lincoinwood, Mor- 1 to 5. rlebDll iS anintro- at Golf View Recreation Ste,1 DriNs L Strenqth The class consists of low- playground activities, field (847) 966-3266, or e-mail Lutheran General Hospital Gaming will be held at I ton Grove, Niles, Park Ridge Getyour heart rate up with This Step class will oiler impact aerobics, step or dtictiOfl to baseball funda- Center, 7800 Caldwell Ave. trips, spray park, swim- [email protected] and sponsors a variety of fund- p.m. March 24. Challenge and Skokie. To receive a this variety of high intensi- variety from week to week. ¡ì)cntils and team play. Programs offered are for ming and more. Four two- submit their name, year walldng resistance work, raising events throughout friends to Guitar Hero and seasonal broehure or to of- ty, tow impact cardiovascu- One week is Step with 10 Teamshirts and Major ages 3 to 14 and include be- week sessions are offered floor work and stretching; graduated, address, phone W OW%T,h ,MD VIctoria H BarboSa. MD, MPh the year to benefit pro- other games on our big fer support for people with CIje,ic lar mutines with some minutes of cardio drills fol- League replica hats are ginner to intermediate skill beginning June 22. Hours number, maiden name (if Dir«tOç MOIS i DermatoIoic ucgety Assirtant Proletor 10:10-11:05 a.m. Mondays grams of the hospital. From special needs by volunteer- Boardcefljfied DermatologO Board cer5fed DermatOlogist muscle conditioning; begin- screen. Munchies provided. provided. A week of indoor levels. Sessions are Monday are 9:30 a.m.-3:30 p.m. Be- lowed by core strengthen- and 10-11 am. Fridays. 9 a.m.-5 p.m., March 26 and ing call (847) 966-5522. applicable) and e-niait ad- ing and the next week Step clinics are held the week of or Friday evenings begin- fore and after camp child .Skin cancer treatment .Treatmeni of skin. 27 a Pampered Chef prod- Intervlew$nq SliMis for dress, and may share a sto- hair and nail diseases Dm:e Aecolaks: Includes April 18. Season play runs ning March 30. Skills . Cosmetic services Interval; intermediate to ucLa sale will be held in the the Savvy Job Candidate NUes care is also available. Regis- I-y or tell how SL John Bce- a mix of dance and aero- April 25-July 25 at Grennan advance. Grainger Atrium of the hos- will be held at 7 p.m. March taught include tumbling, ter early. beuf made an impact on ToSCflEDULE AN ApPOINTMENT, Shopping bics, followed by an abdom- Children ito third Ficights, 8255 Oketo Ave. balance beam, vaulting, their life. PLEASE CALL (847) 568-9911. pital, 1775 Dempster SL, 24. Career Coach Karen Preschool: Early regis- A.I.S. Stretth:Isolated inni workout foi' intermedi- fade and adults are invited Registration fees are $71 for ininitrainp and bars. Regis- 471 1West Golf Road, Suite 71 1, Skokie, Illinois Dining Park Ridge. The sale will Evertsen will help portici- tration is important to en- stretching to increase flexi- ate to advanced levels; 6:10- to celebrate spring at a huf- residents; $88, nonresi- tration is accepted at SCHOLARSHIPS Hours by appointment with weekend availability feature kitchenware, bake- pants improve interviewing sure child a space for the Conveniently located near Old Orchard Shopping Mall. & bility; 8-8:50 a.m. Tuesdays. 7:10 p.m. Mondays. fet lunch with Bunny. Spe- (lents. Call (847) 967-1529. Howard Leisure Center, ware, stoneware, cookware skills. fall 2009 semester. A five- The IInolsSons of ItiIy' Most insurance plans accepted. cml entertainment and a Register is at Howard 6676 W. Howard St. Call More Aerobic Med$ey andTone: Step, DrWsandStrenqth and more. Call (847) 723- day morning program and Foundation is offering Cricketthltl: Inteitribal craft project are included. Leisure Center, 6676 W (847) 967-1529. Low-impact aerobics, kick- This class will offer variety 6105. a four-day afteinoon pro- $1,000 college scholarships Additlonat Appointment locatIons for RUSH Dermatology Powwow Drum Group will All must register for the howard St. boxing with some toning from week to week for in- RusuDerrnaro05y RusH Dror.,rohogy RUSH Drmratology Anew 3'sPreschoolpro- gram are offered for chit- to high school seniors who 610 5 Mapi. Sude 3900 featuring The Service League of be held from 3-4 p.m. event. Lunch will be March 1725 W Harroon. 5ve M 6)19 S Fa,mw, Sude 102 exercises for beginner and termediate to advanced lev- choWo. iiro, Werimoet. IiIeo Oa Park. lSno.6 Nues ParC District is ac- dren turning 4 years old by have full or partial Italian 1312) 942.2195 Advocate Lutheran General March 21. Watch a Chicago 28 at the Howard Leisure gram is for children who (312)941.1195 163019684500 advanced participants, eis; 6:10-7:05 p.m. Thurs- ct'pting registration for Sept. 1, 2009. ancestry The foundation J.w.I is sponsoring a fund-raiser based group of native Center, 6676 W. Howard turned 3 after Sept. 1, miss- working at their own pace; days. (;ids SOftb011 Leagues for ing the deadline for the reg- will award students who featuring Chicago Choco- singers, dancers and drum- SL, with two sittings, 11 Cricket: Dee Park now Pier' i hupirb 5:15-6:15 p.m. Wednesdays. girls in first grade through ular 3-year preschool. Chil- will graduate this year from Total BodyThnlnq: Partie- late Company candy and mers who perform in tradi- a.m. or 12:30 p.m. Fees are has a cricket pitch that will high school (as of 2008-09 a recognized public or pri- IodNpili BodyFlex:Increase lean ipants will develop muscle chocolate. The sale will be tional dreSS. child residents, $8; nonresi- dren will experience their be ready for use this spring vate Illinois high school. a muscle mass and boost tone using higher repeti- school year). The season flrst,classroom experience. held from 9 a.m.-4 p.m. The Go Club for ages 6 dents, $10; adults $8. Call the park district for beglflS with a clinic on April Classes are from 12:30-2 Applicants will be selected resting metabolic rate with tians of lighter weights; for April 1 and 2 in the rental fees or availability. to 12 usually meets the first Bunny will scatter eggs 18. Opening Day games are on the basis of financial this strength-training cinss beginner to advanced lev- Giuingm' Atrium of Advo- p.m. Tuesdays and Thurs- and third Saturdays of each filled with lots ofgoodies at need; scholastic achieve- 6:20-7:20 p.m. Mondays and eis, 5:15-13:05 p.m. Tuesdays. cate Lutheran General Hos- May 1G. Major League repli- days, or Wednesdays and Mehndi: Come and learn month on a drop-in basis. 9:30 n.m. April 4 at Golf ca li:its, jerseys and socks ments; activities in high Wednesdays; 10:05-11:05 pital, 1775 Dempster, Park Fridays at Howard Leisure how this art form has been Yoga: Stretch and soothe View Recreation Center, al'e piovided by the Park used in many cultures as school showing character ToWiy Avenue and n.m. Tuesdays and Thurs- Ridge. Contact Nicki Ter- MAINE TOWNSHIP Center. The session runs to your mind from S-9 a.m. or 7800 N. Caldwell Ave. at l)istiict. Participant must well as how to mix and ap- and leadership; an appli- days; 9:05-10:05 a.m. Satur- son, (847) 723-6147. May 21. Call (847) 967-6633. Nues (enter Road! 5:20-6:20 p.m. Mondays, 7- the Spring Egg Scramble. SU)ply their pants, shoes cants personal essay and days; and 9:30-10:30 n.m. MaineTownsNp's ply it to yoursell Workshop 8:05 p.m. Tuesdays, 8:15- MalaeStay Youth and Fami- Kids ages 1-8 are invited to :wnl gloves. Registration is .Golf Maine Park District faculty recommendations. Carpenter Road Sundays. LIBRARY will be held 2-4 p.m. April 11 9:15 p.m. Wednesdays, 6:50- ly S;rvices presents a pro- participate. There will be CCQ1)ted at the Howaid is taking registration for: at Dee Park. Anyone 14 and For applications contact the SkokJe/Nes 8 p.m. Thursdays, and Hiles PUbHC Library, Illinois Sons of Italy Foun- Canilo Dance: Instructor gram from 7-9 p.m. April 1 complimentary refresh- Leisure Center, 6676 W. Youth Baseball: League older is welcome. CHAMsUOr CoMMF! AND IJIDUSTRY will teach a variety of 10:10-11:20 am. Fridays. 6960 Oakton St., (847) at Maine Thwnship Thwn ments and goodie bags for I lOWflt'd St. Call (847) 967- dation, 9447 W. 144th Place, ball is available foi' youth Visit; one of the Park I1 moves; intermediate to ad- 663-1234, wwwniles Hall, 1700 Ballard Road, registered children. Re- l29. Orland Park IL 60402, with j. - Is u library.org Registration is ages 7-15. Practices begin in District offices, Feldman I-r-J' vanced level; 8:45-9:30 n.m. to motivating music. Eveziy- Park Ridge. Township member to bring a basket a self-addressed, stamped April and games begin May required for programs. Hiles Park District is ac- Recreation Center, 8800 o Sundays. one rides at their own pace Trustee Laura Morask will to collect treasures. Fees envelope, or e-mail LL cepting registration for 16. Hot Shots Baseball T- Kathy Lone (one block The NUes Chamber of focus on "Gang Awareness are residents, $8; nonresi- [email protected]. The dead- Carino InteivM: Tiy this in a team atmosphere. The Hiles Sister Cities Spring Youth Soccer Ball Skills Clinic for 3-7. south ofGolfRoad on and Prevention." As a pros- dents, $10. line is July 1. Winners will cardiovascular workout Reservations are required Polish Committee will host Leagues. There are pro- yealff-olds begins May 2. In Western Avenue), Nues; or Commerce . at the Service Desk before ecutor with the Cook Coun- be notified by Aug 31. with muscle shaping Par- a poetry reading from 2-4 Chikiren age8 and oMer grains foi' girls and boys adi1ition, there are Hitting Dee Park, at the comer of Om4 each class. Bring a towel, ty States Attorney's Office Reminds you to: ticipants will interval Step, p.m. March 29 in the Niles are invited to participate in' age 4 to eighth grade. Clin- and Pitching Clinics for 8-14 Dee and Emerson Roads, MAINE heart-rate monitor and a Publie Library 6960 Oak- and an expert on local HuLe, Kickboxing or BOSU the Flashlight Egg Hunt irs l)Cgifl April 25. Season year-olds beginning March Des Plaines; or cadi('847) SENIORS Shop Locally water bottle to class. Class- gongs, To register, call combinations with weight ton St. The poems are from 7:30-8:30 p.m. April 8 PlaY begins May 2. Partici- 14 so players can freshen 297-3000. es are 45 minutes. Class written by Wieslawa Szyin- Michelle Biondo, (847) 297- The Maine Township training. Intermediate to at Tom O'Shanter Golf I)111t5viÌl develop individ- their skills before the sea- times vary. Daily drop-in 2510, Ext. 271. Visit MaineStreamersprogram Advanced levels; 9:20-10:20 borska, who was awarded Course. A pizza dinner will unI skills and teamwork, as son starts. REUNIONS fees are $6 for members; the 1996 Nobel Prize in Lit- wwwmainetownship.com. offers a variety of opportu- Call the Chamber office for. n.m. Wednesdays. be served at Golf View vcll as enjoy the benefits .) $9, nonmembers. Hot Shots Sports: Hot .WMTh-FM (and WMT1F nities for residents 55 and erature. The poems will be MaineTownship's FISH Recreation Center before o!' lOntiflUOUS exercise. referrals on businesses in the area Ca'dio Kkkbox: This 60- Sh9th Sports ati1 the Golf TV),the high school broad- older. Membership includes SpInnln-Yoqa Blend read in English and Polish (Friends Indeed Serve and the egg hunt. Bring a flash- Nues Paik District will minute workout combines Maine Park Ditrict have casting voice owned and a free subscription to the class will flow from Spin- by three professors from Help) is in need of volun- light and bag for eggs. Sib- l)1OVide soccer uniforms. high-intensity aerobics, box- joined to bring various operated by Maine Town- MaineStreamers monthly (847) 268-8180 ..' niug right into yoga. Ex- Northwestern University. teer drivers to provide resi- lings not registered and l'artieiI)ants must pur- sports classes and clinics. ship High Schools, will cele- newsletter, which details oc- lag, kickboxing and condi- press Yoga wifi focus on The poetry books were do- dents free transportation to parents will not be allowed cluse soccer spikes and Offered are Baseball, Bas- brate 50 years of broad- tivities for the upcoming tioning exercises. Hand- stretching and include core nated by the Lirnanowa medical facilities in and to participate in the hunt or kg guards. Registration is ketball, Tennis, and Soccer casting in 2009. Broadcast- month. Most activities are www.nileschamberacom wraps are required and are strengthening. Express Public Library in Poland as near Maine Township. To dinner. Fees are: residents, taken at the Howard classes. Stop by the Feld- ing from a small studio at at Maine Town Hall, 1700 available at the Member- Spin is from 6-6:35 n.m., part of the book exchange become a volunteer driver $10; nonresidents, $15. Lcisui'e Center, 6676 W ship Service Desk for $5; program with Nibs' Sister man or Dee Park Recre- Maine East High School, Ballard ìoad, Park Ridge, and Express Yoga from call Ed Oken, (847) 696- Registration is under I l()WOi(1 St. Call (847) 967- the first program was aired 7:30-8:30 p.m. Mondays. City Limanowa. Call (847) ation Ccnthrs for details. unless otherwise noted. Visit us at our new Iocaton 6:40-7:15 a.m. Wednesdays. 0761. To schedule a ride or way for Niles Park District's I29. Dec. 20, 1959. Over the past 588-8005 or (847) 588-8033 Contact the MaineStream- Co Step: This step for information call FISH Coach Pitch program for Soccer Spring Soccer 50 years the stetion has FUND-RAISERS by March 24 if interested Nues ParsDistrict Bright ers, (847) 297-2510, or gu to class includes a warm-up, coordinator Gloria Stepek, girls and boys, ages 6to 7. practices begin in March grown to include radio and 8060 Oakton Street in attending. I*ginnings Preschool regis- www.mainetownship.com (847) 297-2510, ext. 288. and games begin April 4. television studios at each of high-intensity step aerobics, Brides Aabst Breast It is an instructional league tI1t100 is conducted for the Soccer is available for Maine Township offers (inside the NorthSide Còmmunity Bank) abdominal exerciseand a Cancer is sponsoring a Scrapbook JournaIln for where the coach pitches; no 2009-loschool yeat Both 3- the high schools. Plans are PARKS . grade levels K-8. cool-down stretch; 6:10-7:10 Charity Wedding Gown fifth- to eighth-graders will hitting tees are involved. and 4-year-old programs under way for an alumni' Peek,PAGE 24 p.m. Tuesdays. Sale at vritoi:i inthe Park, be 3:30-4:45 p.m. March 19, Maine-Nibs Msoclatloo One week of indoor clinics ai,e ()fl'eI'Qd, There 'aré a va- Easter Eqg HUnt: Rain or gathering for students and' A pioneerPressPublication 22' Thursdny, Mnrch1, 2(Kflì A Pion&er Pres Púb1iCCfltk) Thursday, March 19, 2009 23

%VekÍy IVVorshÍp À, . . wtÌay ¡'V"'oi;Ìiip .. - » -y. $4';nE7. '"J' t.f4& -'.. '" fl, ,-.. , ,. .. - ARK CHICAGO ISON NORWOOD PARK PARK Rrn CHICAGO CHICAGo CHI(AGO NORRIDGE SKoKIE I Edison Park Norwood Park Lutheran st. James Lutheran Church Victory Worship Center Zion Evangelical Lutheran Edison Park LuTheran Church Sunday April 12, 2009 Sunday Worship 10:30 AM Shabbat Service Fridays 8:15 PM Asst. Rabbi Shari (hen Holy Communion at 10:00 AM Nursery care during service Shabbat Service Saturdays 10:30 AM Cantonal Soloist Charlene Brooks i United Methodist Church ChúréhELÇA 7400 W. Foster Avenue, (773) 631-7666 3750 N. Novo,(773) 205-3787 Church RCA Special music and Children's Sermon 6740 North Oliphant Avenue 591 7 N. NinAvenua (at, '&kerson) wwtütjamesonfostèr.oíg www.victoryworshiponline.com ' 6626 N. Oliphant Ave., 773-631-9131 Children's Programming for Shabbat Katan, third Saturday of Choir Director Nona Balk 8600 W. lawronceAvo. '- - will be offered Interfaith Families Welcome Chicago, IL 60631 (7) 31-286: Sunday Morning W'rsbip 1 1 :00 AM wwv.edisonparkIWheran.org Ages 3- High School each month, 10:00 AM for families Sunday Morning Worship-1O:00 AM Sunday Worship 9i30AM ' i To God Above Be All the Glory with children under the age of five. All services sign language Phono: (173) 792-3030, Fax: (713) 792-3031 SundayServices-1O:0O AM Wednesday Bible Study 7:00 PM ' Sunday Morning Worship Schedule Adult Education 9: 15 AM : Call Church for Dotes & Times SundàySthoòl 10:35AM Morning Minyan Check our website for Adult Holy Commuroncelebrated1", 3 & 5th Friday Worship 7:30 PM Liturgical Worship with Holy Rev. James P. McCracken www.edisonparkumc.com for the Following Activities: ' Yoúth&Adult BibjeOuss',,., Communion 8:00 AM end 9:45 AM PARK RIDGE Monday - Friday 7:30 AM Education classes Sundays SpMe of the'Word,on Youth Service Fridáy7.:30 PM ' Email:[email protected] Jonercise, Weight Watchers, Choir, Religious School Pre-K - 7 Grade And High Holiday Schedule 2nd . SundaylO:45AM Contemporary Worship with Holy St. Andrew's Lutheran Sundays. ', Christopher Léwis, Postor PROSPECT HEIGHTS : Worship Days & Hours LineDaning, À. A. Meetings, Girl Scouts Communion 11:15 AM. Sundays9:OOAM-11:OOAM ' Handicap Accessible & . Midweek Bible Study Church 8 School Sunday Church School-9:0O AM Rev. Ramona Dosey r Sunduys,1O:3OAM , 6th St. Alphonsus Uguori . P05k! SnSthflelder Sunday School ages Prek thru 260 N. Nohwest Duthway, (847) 823-6656 Hebrew School Grades 3 -7 WedaasdaylO:30'AM' Potluck, i:30 AM (with Confirmation Ministry) Catholic Church Devar Emet Messianic MORTON GRÓvE grade 9:45 AM w.rw.standrewspurkridge.org Sundays 11:10AM12:10 PM Unstaffed Nürseri availabli Sunday st. Mary of the Woods Luiheriókn Bajus, Pastor 41 1 N. Wheeling Rd., (847) 255-7452 and Wednesdays 4:15 PM - 6:00 PM Synagogue Sunday School for Preschoolers ' Affended Nursery for Sunday Services Sunday Worship: from9145-11:OOAM . : Catholic Church. st. Luke'i Christian Coniríun,on servite ' www.saintalphonsus.con, Youth Groups Adult Education 7800 Niles Avenue, & Nursery Age Bible Study, Handicapped Access from south& September through May (847) 674-9146 Rev. Róberi C. Johnson, 7033 N. Moselle, (773) 763-0206 Community Church - , . Worship Days & Hours: Koleynu - Volunteer Choir :Thursdays, 10:30 AM & Fridays, 7:00 PM 3rd Sunday. ofevery moñth parking lot 8:30 & 11:00 AM, Pastor Joyce MKissenger, Director of Music 9233 Shernier Rd., (847) 966-9233 High Holiday Services www.d.varemet.org Youth (High School) Bible Study, www.srnOw.org Choir practice Thursday 7:00 PM JuneAugust9:OOAM Monday-Saturday 8:15 AM ! Saturday 10:00 AM Children's Sermòns 2nd Sunday of the Month Sunday Worship.10:OO AM Mass of Anticipation: Rabbi Michael A. Weinberg Saturday Vigil Mais 4:30 PM Contemporary Worship: Sunday 1:00 PM 708-453-3514, Fax 708- 456-8816 NoRwooD PARK Shabbat Morning Services "Celebrating God's grace and mercy for Sunday School 11 :00 AM 5:00 PM Saturday Cantor Pavel Roytman Young Adults RiMe Study, Sunday Masse7:30,9:00, www.zionnòrridgèiLorg Saturday 5:00 PM ' St. Alban's Episcopal Church Lori B. Sagarin Director of Wednesday 7:00 PM over 86 yearin old Norwóod Park." Sunday Teen Praise Band Rehearsal . ' ' Sunday Masses: 8:30 & i 1 :00 AM Sundáy,12:OOPM i 0:30 AM and noon Weekday Masses . Vespers: Monday 7:30 PM Midweek Religious Studies . 11:00AM 6240 Noah Avondale, Norwood Park, Postor: Rev. Curtis A. Lambert Congregational Learning NORTHBROO Sunday School & Adult 9:45 AM ¿ Choir Practice: Sundays, 9:30 AM "Our Lady Mother MonFri 6:30 and 8:00 AM for Adults and Youth . Illinois, 773-763-8845 Choir Rehearsal Wednesday 7:30 PM (September thru May) Additional Information: Susannah Wesley Club (Women's Group) ofthe Church Çonfession Sâturday 3:30-4:15 PM St. Paul Lutheran Church Wednesday 6:30 PM Temple Beth-El ' , : www.sgintalbansdrUrch.com School: Pre-3 thru 8th Grade- Before YouthGroup Friday 8:00 PM Christian Day School- Pre-Kindergarten Meets once a month on 8701 W. Lawrence Avenue, (773) 625-3369 Holy Days Vigil 7:30 PM 5201 Galitz Street, (847) 673-5030 Club Maccabee Children's Club Praise Service Last Sunday of each 3610 Dundee Rd. Sunday service at 9:30 AM & After School Care thru 8h Grade For K5th Graders at www.ourkdymotherchurch.com Holy Days 6:30, 8:00, 9:00 AM & 7:30 PM : st. Alban's offers the Catechesis of the web.mac.com/stpaulskokie 4th Tuesday of the month. month Featuring our Praise B (847) 205-9982, Fox (847) 205-9921 Ongoing Faith Formation- Kindergarten Sunday Morning Worship 1 0:00 AM Devonshire School in Youth Worship Sunday, olmotherchurch@àol.com Rev. Gregory Sackowicz, Pastor Good Shepherd Sunday school program. St. Luke's Lutheran Church thru 8t) Grade and Postor Gordon Smith templebeth-eI.org Saturday Evening Worship 5:00 PM Rabbi Kirk Gliebb 3rd Sunday of every month Mass Schedule: Ieekdays Monday through We have a Preschool (3 yrs. Old) Morton . lt is a Montessori-bosed program that (ELCA) High School Youth Ministry Program Friday Shabbot Evening Services: enriches Grove Community your child's knowledge of Fellowship Hour, Devar Emet Messianic Synagogue is a Pastor, Rev. Jerry Miller Organist, Friday 8:30AM, Saturday 5:00 PM through 8h Grade School. And offer A Reconciling in Christ Congregation .!fst and fourth Fridays - Traditional Sundays 8:45 - 9:45 AM community ofiews who believe and Church :,the Holy Spirit. Your child is welcome Dana Samova Mvsicoi/Youth Director, Sunday 8:00, 9:30 & 11 AM wonderful programs of Religious 205 N. ProspectAve,, (847) 825-6659 ' SKOKIE Sunday School & Bible Study Class, teach that Yeshua (Jesus) is the Sunday i i :00 AM Presbyterian Shabbat Service at 8 PM to join us for morning song ut www.sllukespr.org Noralyn Baroja Senior Exercise Class, Education for Children and adults. 8944 Austin Ave,, (847) 965-2982 Sundays 9:00 - 9:45 AM Promised Jewish Messiah. Young People's Liturgy of the Word Second FridayWine & Cheese 8:45 AM and class at 9:00 AM. Email: [email protected] Tuesdays & Thursdays 8:30 AM : Carter-Westminster Rev. Matthew Conrad st. Monica Catholic Church Bible Study Sundays 9:00 AM Holy Days 8:30 AM & 7:00 PM reception at 5:30 PM fol!owed with Ecumenical Inauguration Vigil United Presbyterian Church Temple Judea Mizpah Fellowship Hall James Dòwning John Schuman, Minister of Music 51 36 N. Nottingham, (773) 763-1 661 Worship Service Sundays 10:00 AM Norwood Park Lutheran Tuesday 9:00 AM Perpetual Help Kabbalat Shabbot Service at 6 PM or January 19 at6:30 PM. Please join 4950 W.Pratt, (847) 673-4441 8610 Hiles Center Road, Theatre Performances Date Luksha, PK - 8 Academy Principal www.stmonicachicago.com Fellowship Sundays i i :00 AM Church(ELCA) Novena Eucharistic Adoration First a traditional Shobbat Service at 7:30 PM us for a time of song and prayer www.cmupc.net The Church is Handicap Accessible 5. (847) 676-1566 Edison Park United Methodist Church Daily Mass: Mon- Fri 8:00 AM Adult Choir Practice Sun. 9:00 AM 5917 N. Nina Ave. (at Nickerson) Sunday Morning Worship Schedule: wviw.Iemplejm.org Fridays 9:00 AM-3:00 PM Third Friday Family Service at 7 PM Sunday Worship: Variety of Worship Formats, is a church with Open Hearts, Open Handicapped Accessible e,.. (773) 631-2860 Saturday Confession 4:00-4:30 PM Weekend Masses: Saturday-4:00 PM 8:30 & i i :00 AM (School Year), 9:00 AM Contemporary Service Small Group Ministry Friday 8:00 PM - Saturday Shabbat Morning Services: Minds, Open Doors. (Si. EVERYONE IS WELCOME (Street level accessibility to main Church) Second Friday of the Month 7:00 PM Baptism 2d4h Sundays of the Surday-7:3O, 9:00, 10:30AM, 8:30 & 10:00 AM (Summer) 10:00 AM Sunday School (for all ages) Adult Choir & Handbell Choir 9:30 AM Casual Shubbat Service & Chair Lift Available Parking in Rear. Sunday Services-1O:OOAM I 1 :00 AM Traditional Service Family Shabbat Religious School Month Rev. Richard J. Klajbor, Pastor and 12:00 PM ' Thursday Worship (Summer) ' . (Holy Communion celebrated 1, 3, NILES TorahStudy 12:00 AM FellowshipHour St. Peter's United Grades K-7 Polish Liturgy Moss: Sunday- 1 :30 PM 7:00 PM Sunday - Christian F.ducat!on The Edgebrook Church Our Savior Lutheran Church and 51h Sundays. Service of the Word Lutheran Church of the '.10 AM Traditional Shabbat Service ' for all ages Michael Scott Porter, Senior Pastor Church of Christ Sunday 9:30 AM - 12:00 PM 6155 W. TouhyAvenue, (773) 631-1155 Norwod-Park LCMS Confessions: Saturday- 3:00 to 3:45 PM 2 & 4ih Sundays) Hebrew School Grades 3-7 Shabbat Yeladim 9:45 AM (School Year) Alex Wickell, Director of Youth Ministries Oakton Street 8. Laramie Resurrection ,' http://edgebrookchurch.org 6099 N. Northcott Ave. Baptism: 1' Saturday and Sunday Church School-9:OOAM (With Tuesday4:15-5:15 PM 8450 N. Shermer Rd. Nues IL, 60714 '.' Jntroduction to Temple for children Child Care Provided Office Hours: Mon., Tues. & Avenue, (847) 673-8166 Sunday Worship 10:30 AM ( at Nickerson & Hood Avenues) 3id Sunday of the Month Confirmation Ministry classes for 7 Religious School Grades 8 - i 2 (847) 965-8210' up to ages 6 and their families. Older Rev. Dr. Stephen M. Larson, Lead Pastor Thurs. 8:30 AM to 4:30 PM www.stpeteruccskokie.org (773) 631-1 100 & (773) 631-1606 Rev. Ted Schmitt, Pastor and 8th grades) Sunday 11:45AM- 1:15 PM Ensemble Practice, Rev. Kristina C. Weber, Assodate Postor Sunday Worship 10:00 AM Sunday (Sept.-June) 10:30 AM siblings are welcome to participate. [email protected] Rev. Andrew Izyk, Associate Pastor Nursery room (with PA. hooked up Central United Religious School PreK ; Wednesday 6:30 PM Rev. Dr. Malcolm Minnick, ir., Pastor Sunday School 9:00 AM r (June-Sept) 9:30 AM Sunday Worship 9:00 AM Second Saturday of the month at 9 AM to Church) Two Sundays a month 10:15 AM Praise, Prayer & Bible Study Fr. Jumes O'Brien, In Residence Emeritus, Anne Krentz Organ, Director of Methodist Church (September thru May) Ist Sunday of Month. 7:30 PM- Jazz Sunday School and Adult Bible Study and the fourth Friday of the month at Available during worship services 8237 Kenton Avenue, (847) 673-1311 Rabbi Amy L Memis-Foler Wednesday 7:30 PM Fr. William Holbrook, In Residence Music Ministries Melinda Romseth Heiland, Rev. Richard Lanford Vesper Service (Sopt-June) Rev. Robert C. Johnson-Pastor www.skokiecentralumc.org Cantonal Intern Beryl Bellows 10:30 AM Wednesday 6 PM Sideny Helbraun, Senior Rabbi Director of Children's Choirs, Nancy Olson, Childcare provided. Bethel Community Church [email protected] Rev. Dr. Bruce T. Anderson- Pastor Lenten+Midweek Services Sally Gold - Education Director Advent & Lenten Worship Services- Jeffrey Weill, Assistant Rabbi Member Care Coordinator Sunday Service 10:30 AM Air Conditioned Sanctuary Carolyn N. Sonderson- Minister of Music 7601 W. Foster Ave., (773) 775-2355 st. Paul Lutheran Church Wednesdays-i i :OOAM with Soup Sunday school 9:30 AM Terry J. Kane - Executive Director : Wednesday at 7:00 PM Victor Weissberg, Rabbi Emeritus Congregation Bene Shalom www.bethelcommuniiy.org 5650 N. Canfield, 60631, (708) 867-5044 A member congregation of the Luncheon following (March St. Mary's Episcopal Church Adult Education Multi-faith st. Eugene Catholic Church Kim Harris, Cantor Children & Adult 4435Oakton, (847) 677-3330 Evangelical Lutheran Church in America 4,11,18,25, and April 1") 306 S. ProspectAve., (847) 823-4126 Families Welcome Community Theater ( Sunday Worship 8:30 & I J :00 AM Rev. Walt Schoenfuhs Adult Choir Practice 8:30 AM Sunday 7958 W. Foster Ave., (773) 775-6659 www.beneshalom.org Theme: UAt the Cros? www.sfmaryspr.org High Holiday & Festival i, Encounter Gathering: Sunday 6:00 PM www.slpaulcanfield.org Fellowship i i :30 AM - 12:30 PM www.5t-eugene.org St. Michael's Orthodox To List Your Holy week services+ Fridays 7:30 PM; Sunday School & Adult Bible Sunday Services: 8:00 & 10:00 AM Pastor, Reverend, David 1. Haley ; Street Level, Air Conditioned Kabbalat Shabbat 6:30 PM St. Timothy Lutheran Church Daily Masses: Church congregation Palm Sunday- (Sunday of the Wednesday Service: 9:00 AM Study-9:45AM Sunday Worship 8:15 & 10:45 AM Choir Director Joseph Poprawski on3rd Friday of the month 9000 N. Kildare, (847) 676-1 300 Passion-April 5-1 0:00 AM.) Blessing Mon thru Fri-6:30 & 9:00 AM 731 3 N. Waukegan Road, (847) 647-8398 Sunday School & Nursery during worship, Senior PastorPastor Paul Jordan Sunday School & Adult Bible 9:30 AM please call E-mail: [email protected] Kabbalistic Prayer! www.sttimothyskokie.com Weekend Mosses: www.slmichaelniks.org and Distribution of Palms Youth Fellowship Associate PastorPostor Rob Youth Choir 9:15 AM Sunday Meditation Service 10:30 AM Sunday Worship 10:30 AM Sat Saturday Worship 6:00 PM Neil Blatchford at'. Maundy Thursday-April 9, 2009 8:30 AM & 5:30 PM, Sunday Worship 10:00 AM The Rev. Sarah D. Odderstol, Rector Bukowski Student MinistriesPastor Accessible Church Building 5'. On 2nd Saturday of the month Choir Practice, Thursday 7:30 PM Sun - 7:00, 9:30, 1 1 :30 AM & 4:30 PM St. Paul Lutheran Christian Day 847-486-7252 7:30PM Holy Communion with the WHERE ALL ARE WELCOME! Discover the ancient faith and rich Temple Beth Israel Special Kabbalistic Meditation Bible Study, Monday 10:00 AM Shawa Clarke Confession: 4:00-5:00 PM Sat School Pre-KGrade 8 Stripping of the Altar Check website for all activities. traditions of the Orthodox Church Changes can,be,: 3601 W. Dernpster St., 847-675-0951 Service Sunday, August 31', 10:00 PM Youth Christian Education Music & WorshipPastor Andy Clifton Good Friday- April 10, 2009 Baptism: SHARING GOD, TOUCHING LIVES, Handicap Accessible S.. the first Christian Church- founded r www.tbiskokie.org Esther Knapp Religious School 3rd Sunday at 10:30 AM faxed to her , Childcare aVailable for all services. EVERYWHERE 2:00 PM Good Friday Liturgy (The J :00 PM Jit 3 Sunday of the month By the Lord Jesus Christ and described Likral Shabbat/Kabbalut Shabbat, Sundays 9:00 AM - 12:00 PM Rev. Erik Weber Church wiN be open for private Park Ridge Seniors & Women's Bible Studies ' ' Rev. George Koeune, Pastor; Wednesdays - February 25-April 1 in the pagos of The New Testament. at 847-486-7456.' ' Presbyterian Church - first Friday of oath month, 5:30 PM Hebrew School Sunday 12:00 1:00 PM Birthday Sunday3" Sunday Sejfember thu May. donations from 12Noon Io 2:Oa PM) -01 each month Rev. Jerome Twarog, Associate Pastor; Lenten Soup Suppers 6 PM Light Nash - 6:15 PM Thursday4:00SiOO PM ..... Today her Apostolic doctrine, worship, [email protected] The Day of Resurrection of Jòsus 1300 W. Crescent Ave., (847) 823-4135 Call for information or see the website. Accessible, Building 'RèV.PhIHp Grib; Si, Resident Lenten laize Services 7 PM - and structure remain intact. ' Kabhalat Shabbat service Rabbi Dr.'Douolos Goidhamor Christ (Easter www.parkridgepresby.org :'-.: _,rfrr't ¶,'tt.;,.. .'t . "'.- .-.'" , ''-"- 41a'- A Pioneer Press Pubiicntkm Press Publlc4ion 24 Thursday, March 19, 2009 t CURRENTS f i' l'imleer Thursday, March 19, 2009 25

NOTICE OF PUBLIC HEARINGS l'aik. Members pay $7; is $5 ¡ici' session. Call (847) Spouse Loss, (1:30-8 p.m. Tuesdays; Sudden Loss, Peek . guests, $9. Attire is semi- (;85-9900. Consolidated and Community Development Plan dressy/dressy. (2a11 the hQt- 6:30-8 Mondays. At Cook County Community Development Block Continued from PAGE 21 Good Mourning Proqram line at (630) 415-8499 for in- (1133 N. Northwest Highway, Grant Program will meet 6:45-8 i.m. every formation; for directions, Chicagn -i-- Families with Emergency Shelter Grants Program free tax filing assistance Ibi' third Monday of the month HOME Investment Partnership Program call (847) (;78-7068. Children Loss Group meets )4dt athftfl//flIòÌjeerIocaL seniors and low-income res- at Lutheran General Family . - . n-ost;c every third Monday, 6:30- Rat. Pifofi 3 DATE: Thursday, March 26, 2009 pro grim Fm % Dcn APR Pioges ideiit.s 55 and older at Thunderbird Singles will Care Center, 9375 Church Rat. PolMi Fin % DewS APR Thursday, May 7, 2009 7:30 p.m., or in Glenview, F..i %Dos APfl Rit. PalMs Thwnship offices, 1100 Bal- host a "Spring Fling" super St., Des Plaines. r[lle I)t.o_ KENILWORTH FINANCIAL, INc. 6:307:45 p.m. Wednesdays 630..812.21ooTHIRD COAST MORTQAOE LLC 847.7364583 TiME: 600 PM, lard Road, I'rn'k Ridge. For dando at 8 p.ni. March 20 grañ) is a sUl)pOrt grM1p for 847449-8800COuNTPIVWIDE beginning March 19. http:/,4vww.KenhfworthFJnancIajcgm an appointment, call (847) in the Hyatt Woodfield Ho- children, Cáhs and fanilies PLACE: Cook County Board Room 30 yr fixed 5.0000.000$645 20%5.034 . 30 yr fixed 118 North Clark Street 297-2510. t,el, 1800 E. Golf Rond, who have lost a loved ote An area AIZhMmIr'S sup- 5.0000.000$850 20%5.04530 yr fixed 5.0000.000$900 20%5.093 County BuIFding.Hoom,567 4.7501.000$645 20%4.872 ' through death. Preliminary 3øyrfixed 5/1 Jumbo ARM 4.7500.000 20%4.973 Chicago, Illinois 60602 AARrS Driver Safety Schnumburg, $7; and a port group for caregivers $850 20%3.75630 yr fixed 4.3752.000$900 5.1250.000$645 5%5.160 Program will be held from dance with salsa demo, interview is required liefore and family members of peo- 30 yr FHA 511 jumbo ARM (interest on) 4.8750.000$850 20%4.75030 yr FHA 5.000 1 .000$900 4% 5.520 The Cook County Consolidated Community Development Plan dance lesson and free buffet registration. Tb registei; pie with Alzheimer's Dis- 4.7500.000$645 20% Includes the Community Development Block Grant (CL)BG) Dam.-1 p.m. March 23 and 5/1 ARM 3.7727/1 jumbo ARM 5.0000.000$850 20%4.0665/1 jumbo ARM 5.5000.000$900 20% 5.501 Program, the Emergency Shelter Grants (ESO) Program and the at 6 n.m. March 22 in the call Rainbow Hospice and ease meets at 10:20a.m. 25. This class updates FHA and VA Approved- Call tis for Details Stuart L. Cohen at 847-580-5555 HOME Investment Partnership Program. The area covered by these 94th Aera Squadron Palliative Care Bereave- every second Satúrday at or [email protected]@countrywide,com programs are primarily suburban municipalities under 50,000 In knowïédge of ag-re1ated (B) One Oakbrook T8sTICØ, SWIII2IO, O,khrock Tenice, IL 60181 M8.6760321 (8) 1161 Lake Cook Rd., Sulle I, Outfield, IL60015 60777(C)954Harlem Avenue, Glenviow, IL 60025 population. These programs do not include the CIty of Chicago. changes and Rules of the Ret;au'rant, 1070 S. Mil- ment Support, (847) 692- Central Baptist Vlllag, the Road. Upon completion, au- waukee Ave., Wheeling $8. 8884. Commons Theater Lounge, CoriMuNIr.'BANK PURPOSE: The Cook County Community Development Advisory PARK RwoE 847-384.9221 UNnw HOME LOANS 708-5314317OLENVIEWSTATE BANk 847-729-1900 Council will hold two (2) Public Hearings for the 2009 Consolidated tomobie insurance compa- Call (847) 604-3446. 4747 N. Canfield Ave., Nor- FamiNes nousjsa htlp://www.UHLoans.com http://www.gsb.com Community Development Program Year which begins October I, ñies otTer a discount. Cost ridge. New members are al- 2009. 50+ Jefth Sing$eswill free, 12-step, self-help sup- 30 yr fixed Call for Rates 30 yr fixed is $12, AAR1 members; $14, ways welcome. Call Jessi Call for Rates 30 yr fixed 5.3750.000$1035 20%5.432 meet at 7 p.m. March 22 at -port program for family Call for Rates The approximate amount of funds available for the 2009 Program nonrnembers. Lenth, group facilitator, i 5 yr fixed reti 5/1 jumbo ARM 4,8750.000$1195 20%3.8095/1 ARM 5.7500.000$1035 20%4.363 Year are: $10,000,000 for CDBG, $450,000 for ESG and $5,500,000 Ezra-Haboim, the Nues members and friends who (708) 583-8509. 5/1 ARM Call for Rates 7/1 jumboARM 5.1250.000$1195 20%4.1357/1 ARM 5.7500.000$1035 20%4.638 for HOME, and American Dream Downpayment Initiative CADDI) Slmp4y Ballroomwith Township Jewish Congre- are concerned about the $111,012. 7/1 jumbo ARM Call for Rates Debbie Reynolds at the gation, 4500 Dempster St., . substance abuse or behav- Queen of All Saints hosts 10/1 jumbo AIM Call for Rates 15 yr fixed 4.8750.000$1035 20%4.970 The purpose of the first hearing, March 26, 2009, Is to hear pro- Paramount Theater in Au- Skokie. Dr. Hollis Chalem ioral problems of a loved a weekly meeting for fe- For a personal quote Call Mike Dulla, President Restrictions apply, please Inquire. posais from the non-municipal and emergency shelter grant appii- (modern day Dr. Ruth) will one. Families Anonymous cants regarding their 2009 Program Year applications submitted to rora will be featured from male smvivors of sexual (C) 626 Talcott Rd., Park Ridge, IL 60068' (B) 3 Wesibrook Corp. .Center, Westchester, IL 60154 MB.0008479(C) 800 Waukegan Rd., Glenview, IL 60025 Cook County, and to hear testimony from interested persons or 11 a.m.-5:30 p.m. April 25. speak. Cost is $10. Call meets weekly from noon-i abuse. The meetings are groups. (847) 675-4141 or e-mail p.m. Thursdays at the Park Enjoy the passion and ener- from 7-8:30 p.m. Mondays THE GLEN FINANCIAL, INC. 847-901-0808 30 yr fixed 15 yr fixed 5 yr ARM Each week Brate survey's mortge experts The purpose of the second hearing, May 7, 2009, is for the [email protected]. Ridge Community Church, http://www. TheGlenFlnancial.com to pr&bct wtch way rates will go in comIng weeks: gy of the world's top-ranked in the Benedict Center up, thwn, or stay abo.d the same. Advisory Council to approve the recommended projects for the competitive dancers. Trip 100 Courtland Ave., Park This week ' - - '5.34-J Here Is what they say tNs week (3129-3/189) 2009 Program Year Annual Action Plan Year5 of the New SUPPORT Chapel, 6275 N. lonia. To 30 yr fixed 4.8750.000$999 20%4.928 4:88, Consolidated Community Development Pian. Rate 2; $90 members/$95 Ridge; use the side en- participate in the confiden- 4.6251 .000 Down: (8%) trance on Butler Place. 30 yr fixed $899 20%4.765 Last week guests. Before the show en- Granrents As Care- tin], 12-step program, call 5.4 4.94 5.39 All interested persons, groups and municipalities are invited to There are no dues or fees. 20 yr fixed 4.8750.000$999- 20% 4.947 attend and participate. joy a luncheon buffet at givers,a program spon- Queen of All Saints Recto- Walter Payton's Roadhouse. sored by Children's Home + First names only are used l5yrfixed 4.6250.000$999 20%4.716 Last year - 6.39 - '585 ' é.21 Lip: (23%) Published In Pioneer Press 'y, (773) 736-6060. Addition- 3/I 9/09 (1677973) AF Aid, will otTer grandparents at the meetings to preserve Maine Townshipis asking al meetings are from 7-8:30 Source: Bankrafo.co,n, forrrrore information fsitwankrsfe,ni. Bank,ate rratoraiawr. an opportunity to nicet oth- 'anonymity. This is a non- for assistance in locating p.m. Fridays at St. Juliana (U) 2550 Compass Rd. Sie Li, Glenview, IL 60026 MB 6759906 ages aro based on 100 largest institutions in the top IO markets in the Unted States. er grandparents, share con- professional and nonreli- good, reliable handymen in Parish Center, 7200 Osceola cerns and talk about inter- gious program. Advance the area. If you know of Ave. Call Linda, (773) 271- Unchanged: (69%) esting topics that will help notice is not necessary. Vis- LENDERS, TO HAVE YOUR RATES APPEAR IN THIS FEATURE someone and would like to 2281. them care for their grand- itors are always welcome. submit a name, contact CALL BAN.KRATEIICOM SALES DEPARTMENT @ 800-509-4636 children. Meetings are 10- Call the church office, (847) SourceBiIoatacom, Z1t$ Therese Tully, (847) 297- TEEN CENTER 11:30 a.m. the first Wednes- 823-3164, or contact Fami- 1 ' MÓRTGAGEUPDATE 2510, Ext. 260, and she will day of the month at NUes ilea Anonymous, l-800-736- The Nues Youth Council forward a form to complete. Bankrate.com Public Library 6960 Oak- 9805, or www.fami- is a group of teens from Mortgage rates remain unchanged By Holden Lewis "There's a bunch of assumptions being made by Maine Township,in co- ton St. Free child care is liesanonymous.org. sixth through 12th grade Mortgage rates fell this week, but not by much. Not many data from title companies to track how many people are operation with the Cook available with 24-hoúr no- who provide support and people are applying for home loans. applying for mortgages. The result is an index called the everybody -- by potential borrowers, by lenders, by Butterfly Groupfor B ball of confusion," says County Sheriff's Office, is tice. Meetings are monthly. advice on Teen Center pro- The benchmark 30-year fixed-rate mortgage fell 4 basis MAX. Last week, his index fell 5.1 percent, even as the everyone. It's a great, big, giant reaved Parents meets the for Quicken Loans. One collecting used cell phones Call Linda, (847) 640-9590. gramming develop leader- points,to 5.37 percent, according to the Bankrate.com MBA's application index rose 1 1.3 percent. Ifboth indexes Bob Walters, chief economist second Theday of each rates will drop to 4 GARA to be converted for emer- ship skills and work to national survy of large lenders. A basis point is one- are accurate, then roughly 16 percent of applicants are of those assumptions is that mortgage Life Wansttions Groupis month at 7:30 p.m. in the gency 911 use for seniors. serve the Niles community. hundredth of i percentage point. The mortgages in this applying for loans at two places. percent, so they decide not to refinance now, and wait for : SALE! an ongoing support group St. John Brebeuf ReCtOr Sat Only 9-1. Everything Donate phones at Maine They meet the first and wcek's survey had an äverage total of 0.41 discount and In a weekly report, Descloux writes: "With consumer rates to fall even more. Town Hall. for anyone who, as a gener- 8307 N. Harlém Ave. All be- origination points. One year ago, the mortgage index was psyche traumatized, 20 percent of all homeowners over the "So a lot of people are making assumptions thatgreat must go gofas, Wing Back reaved parents, family and third Thursday of every i al guideline, has been wid- negative equity cliff into the drink, and whole swaths of things are going to happen, when, quite frankly, when you Chrs1 Omelie Set,Sf0-blower SENIOR CENTER month at 5:30 p.m. Stop to 6,39percent; four weeks ago, it was 5.34 percent. owed for one to four years, friends are welcome know the facts, it's less likely than they may think. The 1andMUCH,MUCHmore cheek them out. Call (847) The benchmark 15-year fixed-rate mortgage fell 6 basis potential mortgagors (i.e., borrowers) unable to qualify, the '___'__.:-. meeting 7-8:30 p.m. the whether their loss is recent The NUes Senior Center 375-8949. The Teen Center points, to 4.88 percent. The benchmark 5/1 adjustable-rate MAX may already have passed its highs for 2009." reason I qualify that is, do I definitely know what's going fourth Tuesday of the or many years ago. Call An- somebody in Washington offers free membership to is located at 373 Golf Mill mortgage fell 5 basis points, to 5.34 percent. From Descloux's vantage point, it looks like home sales to happen? I don't, because Niles residents age 62 and month at Rainbow Hospice na LaCorte, (847) 965-2771, Center in Niles. The Mortgage Bankers Association says there 'vas an will stall during the traditional buying seasonthis spring can change the rules tomorrow. So that always has to be older, and their spouses. and Palliative Care, 444 N. or the rectory, (847) 966- homeowners will slow the housing considered. But if you look at the facts, and you look at the II .3percent increase in mortgage applications last week. and summer. Cautious Northwest Highway, Suite 8145. Only center members may The Teen Center iswork- More than two-thirds of those applications came from miirket even more as they insist uponselling their current trends, you start to say I'm not so sure the kinds of things register for classes or trips, 145, Park Ridge. The fee is ing with the Niles Senior that people are hoping for aregoingto happen to them." Midwest Palliative & homeowners who wanted to refinance. homes before buying new ones. Meanwhile, ARMs are o'. purchase tickets. Drop $5per session. Center to fmd teenagers HospiceCareCenter grief Some of those people applied for loans with more than resetting at attractive rates,which reduces the need for One way to look at it is to consider what's happened to There is a beMer waj by the Niles Senior Center, A WiduwedSupport support groups meet at wllllig to help senior citi- one lender, hoping to have their applications approved ARM borrowers torefinance. mortgage rates this year. In Bankrate's weekly index, the 999 Civic Center Drive, zens with leaf raldng, snow 30ye11 fixed has averaged 5.43 percent so far in 2009. In and its as easj as Q Group ¡s an ongoing sup- various locations across its by at least one, even if others reject it. The MBA counts Waiting for less than 5 percent Nues, or call (847) 588- port group that addresses service area. Grief support shoveling and general yard There's another reason that potential borrowers remainthe last five weeks, it hasn't been lower than 5.34 percent 8420, for an application. applications and not applicants, so if one borrower files go towww. ioneer oca corn losses faced by persons, as groups are free; donations work while earning money. five applications, the MBA's index counts it five times. sitting on the fence: the persistentand widespread notion or higher than 5.41 percent. This doesn't seem consistent ---.3,-.- Complete the Niles Teen take mortgage rates down with the theory that the Fed and Treasuiy want to drop SINGLES a general guideline, who are accepted. Call (800) This brings up the question of whether the MBA's index that the federal government will Job Conneetion form avail- by another percentage point. o enter od copj have been widowed less 331-5484 to register. The exaggerates the number of people who are trying to get to 4.5percent or even 4 percent. There is little evidence mortgage rates Young at HeartSingles than two years. It will meet schedule for 2008 able on the center Web site "The underlying premise in a lot of people's thinking is home loans. that the Federal Reserve and Treasuryintend to reduce o enteí OC.)fl()( Club (ballroom dancers of at 7 p.m. on the second and winter/spring includes: At and return it to Mark at evidence that they that interest rates will be taken lower," Walters says. "And How many applicants are there? mortgage rates that much, and less I don't think the facts support that." o erìer pour ciedil cord iritoinajion ail as) will feature a fourth Tuesdays of the 2050 Claire Court, Glen- the center. Information will Paul Descloux, publisher of Mortgage Maxx, uses would be able todo it and keep rates there for long. flot ,vitjInbInr press i),nc.1IIii,oi, Morlgugc dance with the Music Men month: March 24, at Rain- view - Adult Loss, 6:30-8 be shared with the director I.EGJNI): (A) M«.r*pigC IlatrkCr, (II) M.i*zigc gI,,,LCr, (C)linirk, (n) S & L, (E) Credit IJnk',i. "Cal) ror RaICs' l,,cun% uctusi fliC'. 'CI Ir3i,Cf1CcIIe nO of 3/12/09. 0 200') flunkrulc, Irrc. )rtrp/IWWW,barlkrate.C3)fl1 Airirual pervcnhflgc rnte (Al'R,) arc bacd ori fully lndescd n,res for Pioncer Pre oitne cIaiificd acI5 are avsinw,.-, ,.,.....------airrouflis of $435,000.l'oiirts quntCd ),,c)udc dkcouurt and/or orIginatioll. Lock Dayc: 30-60 bow Hospice and Palliative r CC Coirvcni)ons% loans are based on loar, sniounts of $165,000, JunrbO loans arC loiçcl oU (na,, ir y,,ur down puyuirerit is ICsc tharr 2Úor the Ii,,rr,cs vuluc. you will bO ubjccI Io t>rvutc ruorteago Incurance. d31. $eVCfl days a week. Sample ads wifi asiist you from at 8:30 p.m. March 20 at p.m. Wednesdays; Daytime of the center and contacts L,'.Cd, Fees rcriCct charges rCIuIiC It' ItIC AI'R dJUst,,hkraro:rrru-rgagcs (ARMs).Tire APR on your specific Jouir ruty djlfrr frorri the snuirple rh)s tal,),,, AH rairu, fec'i air') oilier irrf,,r,ruiio, um ut,jcCt tt changc without noticu. Birrkratc.g,,. docs not own any SlianCial in,Iitut)un' - trttO flnlsh.Try placing one todiy from our secure sitoPONEEEt PRR the American Ltgion Hall, Care, 444 N. Northwest Spouse Loss, 1:30 p.m. to 3 will be made with residents l"n,,IC hie, dotu not gusrnnlcc the accuracy of llar Infoniratiorr appCariflg above or the availability o) rares a,idIii CCCS (ccs nr 0154)7,000. rrCent lcgilatioii nay cr,at,ICleirdern In c.riuiIr locaijorr, t,, provide rulen U;at arc diffrrrnt fruit, lrose ,how(i in (ho labIo abc ' ° U L O Ç L 3 0 VI C and publish it Online or ¡n any Pioneer Presi newspuper. 9757 Pacific Ave., Ft-ankllii Highway, l'ark fUdge. Cost Or.,lI,Il,companion appearing in thin tablc pay n fcc io appear iii iIi); table. lfyou are scCkirrg s innrlga$eiii liiiiubie, Cliii l35O.5O9-463. 'l'o rOport any li,accuracIe, call888.509.4636.luttp://pIoneerlocaLinICraS.cum (prrvate party advertIsers only) p.m. Fridays; Lvening in need of services. - eOIiII,%,,d rirai you coniuct your lcnde dircctly to dcterni)ne wirst ratcu tray t'a available ro you. 'ri, uppeur 26 Thursday, March 1D, 2009 \pjorieet' Press Publication A Pioneer Press Publication I SPORTS f Thursday, March 19, 2009f'zi

WATER POLO ., ...... 'ji,,. MANA$RIS £DflOt N Maftø . H,'I . Sports mtañh,@pf.øthcaLc.m (MY) 4M-74e1 Demons getsweep, earn firstwins atvarsity Boys BASKETBALL By MATT HARNESS mharnesS@PlOfleeri0Ça.COm Dons'coeback falls sh insectiönal final The MaineÉasj'Jter 1)010 squads made history BY DAN SNALIN .by taking two games from dshalin@pjoneerlocal,com i city rival Maine South Fn- Seniors day at home. . ' ' : Notre Dame did not Club teams the past six have its best shooting years, the wins were the night, and gave up a few pöstseasöú' first as varsity teams. too many easy baskets as In the evening' opener, well, losing to Glenbrook . By DAN SHALIN this winté NataliaBiaieckaprovided North 67-61 in the IHSA [email protected] "Our seniors htive T the fireworks for the even- Class tA Nues North Sec- had a heck of.a'year,the tuaI celebration. The jun- tional final Friday night. When Notre Dame coach said. "It's my sec- 1er attacker scored 12 But the No. 3 seeded goals and assisted another - lost five of its last eight ond season here and . Dons (20-9) showed their regular-season games, they've learned wht the in the Demons' 14-8 win character by fighting back head coach Torn Les ap- expectations are: good over the Hawks. Both from a 12-point, third- pealed to his five seniors hard-nosed defense and South teams are in their quarter deficit and getting to reverse the slide. playing hard all the time. first season at any level. in position to slice the To reinforce the point They won 20 games do- Tied at four at the half, Spartans' lead to one point I that the team's fate was ing that. I'm pretty the Hawks went ahead 7-5 Maine East's Natalia Bialecki fires a shot aqainst Maire South In in the game's final minute. in the hands ofthe quia- proud of them. midway through the third a 14-8 win last week. (Joel Lerner/Staft Photographer) As it had the whole tet, Les began employing "I'm not sure they're quarter. The Demons then night, No. i GBN had a re- an all-senior starting the most talented bas- switched up their offen- Bialecka's scores. 15-5 win. The Hawks led 1- sponse to the late ND run. lineup. This meant ketball players, but sive formation, and "We have a strong of- on Mike Szpak's early The Spartans got a big 9 bringing all-conference they're competitors. Bialecka scored nine in a fense, and the girls corn- goal, but the first-year steal and then hit 6-of-8 Maine East's Michael Mawr (left) looks for a path past Maine South's Mike Sipak on March 11. The junior Shawn Wallace off They play pretty hard row. The stretch spanned municated well for the team was no match for won the matchup 15-5 over the Hawks. (Joel Lamer/Staff Photographer) throws down the Demons the bench. and J think they're more than nine minutes first game," East coach the Demons. - stretch in holding on for The minox shake-up pretty tough." and changed the complex- Megan Kamarchevakul A 6-O run in the second the vin, improving to 23-7 seemed to work as the Next season, the team ion of the contest. said. quarter separated the Dave Zarychta and Sz- O-3. Ryan Simpson scored Evanston today. South, in the process. Dons went on n:playóff will be built around the "That'S what caught us Anna Pieta scored teams and sent East to its pak each scored twice for three times. The South scheduled to play the "We didn't play the Wildkits on Tuesday, wel- run that saw the pro- 6-foot-i Wallace, who led up," said Bialecka, who South's first goàl for a l-O first win of the season. the Hawks, who managed girls dropped a 20-1 dcci- best we've played, but gram reach the sectional the way 'with 21 points. changed positions with herlead and finished with a Chriscanton scored six only one goal in the sec- sion to St. Charles East oncomes New Trier to town part of that goes to final for just the third Friday. Joining him will co-captain Agnes DadeJ. team-best four. KeIIV for the winners, while ond half. Saturàay to fall to l-2. today before visiting (GBN)," said ND head time since 1997. be gritty guard Jake Dadej scored the Gavin scored twice. Michael Mazur added five. The South boys, who East was scheduled to Schaumburg on Friday. coach TomLes. "They The seson came to Everly, who could be team's other two goals, The East boys corn- Goalie Alex Hrnjak made lost 15-4 to St. Rita on play Glenbrook South on blocked some shots an end on Friday with a called upon for more and assisted on seven of pleted the sweep with a 16 saves. Saturday, enter the week Tuesday before hosting Comment: pioneerlocal.com around the basket and we 67-61 loss to Glenbrook balihandling duties as a didn't (always) execute, Glenhrook North's Rauf Hudema (right) moves in to shootover Notre Dame's Douq Wollney (left) North. juñíor, and the ever-im- but part of the reason we during GBN's 67-61 wIn In the Class 4A Hiles North Sectioñal final Friday. (George Pappamichiel/for "I put it in the hands proving junior-to-be ICE HOCKEY didn't was because they Pioneer Press) of our seniors," Les said Quinton Chievous who is did a good job." "They were here last 6-foot-4. The Dons, playing in attempts from behind the helped the Dons make a the lane), which is his year when we got beat in Seniors-to-be Matt their first sectional final Dons plaù to train harderafter playoff struggles arc. game of it down the trademark, and he hit the first round (of the Moser could become the since 2002, were led by The Dons trailed 37-30 stretch. playoffs). They remeni- at Rolling Meadows, but quite a few of them," Les team'S main threat from By DAN SHALIN Bensenville. Catholic League playoff pared. We were not pre- looks to build next year's junior Shawn Wallace's 21 at the break, but opened bored it, and did not Two nights earlier, Di- said. behind the arc, while 6-4 [email protected] Last month, the Ice disappointments with pared. I thought I worked team around current un- Gallagher said the offsea- points. Senior Jimmy Mar-the third quarter with a . Gregorio's big second half Glenbrook South want to go out after the Phil Kerber should see Dons entered three post- them into the Blackhawk them hard enough. But it derclassmenTimVander- son will be more about tin added 13, while seniors mini-run that cut the first game this yeai" - and aclutcli steal and trailed (0-57 and had pos- time in the post. When Notre Dame season competitions hop- Cup. But he did not feel wasn't what the doctor or- meir, Jeff Levar and Alex training than playing Mike DlGregorio and Doug deficit to three. The Spar- basket by senior Dallas session with 30 seconds Each member of the "1 hope they under- hockey coach Chris Gal- ing to make an impact in his team ever recovered dered." Murphy.Junior Ryan games. Woilnoy scored nine each. tans quickly countered group, which featured Moreland - were the keys remaining when ND soph- stand hów hard it is to lagher looks back on the each. But after winning from those defeats. lihe Friars, a team Zanon vill be counted on "Most teams usually go Notre Dame was at its with a surge of their own, all-conference guard in ND'S 64-62 win over No. omore Jake Everfy poked get to (the sectional fi last six months, he sees a their first three in the "Because ofa couple Notre Dame had defeated as a team leader next fall. for games, but I don't best offensively this sea- .and led 51-39 withjust un- Mike DiiGregorlo, 7 Glenbrook South in sec- the bail away. Moreland Jimmy aal), and that we did be- fine 2008-09 regular sea- Founders Cup Metro Cen- key games we had played in two of three meetings Ryan Maize, who shared vant games. I need to son when it was able to der two minutes remain- tional semifinal action. Di- scooped it Up, dribbled the Martin, Billy Hughes, cause our seniors son that petered out come tral playoffs, ND dropped and lost, I tried to instill this season, led 3-O five goaltending duties this work on them, train them work the ball quickly Ing in the third. Dallas Moreland and and get their skills ready," Gregorio started hitting length of the court and worked very hard in the playoff time. six of its final seven that it is a whole new sea- minutes into the game andseason, should take over around the J)eri!fleter un- "They had more runs Doug Woilney, had multi- he said. "Their skills are his jumper in the second laid it in, drawing the foul. ofTseason," Les said. "So,' The long, but ulti- games, and in the process son and a totally new sce- 4-0 after one period. ND nearly full-time in the ti! it fell into the hands of than us in the game," ND'S pie shining moments not at the.level they need half, Scoring 12 ofhis It was Moreland's only the (returnees) are going snately too short cam- was bumped from the nano," he said. "But it did- pulled a goal back, but nets. an open shoote The Dons Billy Hughes said. "They during the team'S foui'- to be. I'll take it on my team-high 17 1)oifltS after bucket of the night, but it to have to work that paign came to an end for playoffs entirely. n't matten We were done. Gallagher said his team Next year's team will struggled to do that for had about four runs, and the break. game postseason run. own as an ex-college coach might have been the hardto get back here.". the Dons (46-17-3) in a 6-1 Gallagher had Tapped out. was never really in the begin taking shape when much ofseetional final, es- we had like, two." After Friday's defeat, to get the kids ready." "We set, ball screens, garne'S biggest hoop. loss to Fenwick March 4 preached to his team "Fenwick played well, game. spring hockey begins in pecially inthe first half Wallace's seven points Les praised the seniors early April. The Ice Dons and (DiGregorio) got some in a Blackhawk Cup sec- about not carrying the they came out hard and The Dons will lose 17 when they had just thi' in the fourth quartei' ' for tuch' contributions will compete in a league Comment: ploneerlocal.com shots from the elbow (of Cemment: pioneerlocaicom Comment: pianeerlocaLcom ond-round playoff game in Founders Cup and the coach had them pre- regulars as Gallagher st .w t, I p p ' ts t t I p ' 't '' I ' p i' st 't p, ''tp u

!_i_ Thursday, March 19, 2009 SPORTS A Pioneer Press Publicatjot1 I\pIOneer pressPublication I SPORTS I Thursday, March 19, 2009 29 . All-Area. North StarsWrestling Team ICE HOCKEY

B ssellcornésupbig,' timeafter time Season ends for Maine in Cup title game By MATT HARNESS By MATT HARNESS MAINEiacs then came outtally in every Blackhawk mharness@pioneerJocaj,co [email protected] of the extended break by Cup game. He finished the tournament with seven. :: I Wîn,,ciko peppering Rockford's n the Disappointment Joseph Panther,but they "I'm proud of every- North Stars' coursed through the failed to get one past the body, especially the sen- area was flli)C iors," Rice said. "It would SkokIi! Maine Township locker Icemen's goalie to even the dominant on i'oom and lingered long af- score. have been good to go out the mats this ter last week's 6-4 loss to After Maine goalie on top, but we fought to .Noneseason than Rockford in the champi- Jack Ricemade two saves,the end." Chris l3rassdfl. onship game of the Black- Rockford upped its advan- Maine reached the title That is why he has been COLD UST hawk Cup tournament. tage to 6-3, scoring two game with a 5-3 win over selected Pioneer Press Glenbard North March 9. State Ouallfiers The title was the top- goals within a minute of North Sthrs Wrestler of the Trailing 1-0 in the first Chris Brassell seeded Icemen'sl3th con- each other. LeBeau's Yean (Maine period, Maine tied the South, 285) secutive in the combined shorthanded goal left the Maine South's big guy score on a goal by Zim- Joe Brewster division. score 6-4, but that was all won his first 37 matches (Maine South merman late in the frame. 185) But once Maine's de- the MAINEiacs mustered and captured champion- down the stretch. The MAINEiacs then Jamal Johnson(Nibs West feated feeling dissipates, ships at the CSL tourna- Maine Township goalie Jack Rice holds his ground es Rocklord's Timothy Santopoalo crashes the "We talked in the powered to a 4-1 lead after 125) ' the MAlNEiacs have geai during a 6-4 loss to the Rockford Icemen In the finals of the ARAI State Tournament In mcnt and at the MaUier Re- locker room about laying two periods on goals by Regional Champs plenty to proud of this Bensenville. (Photo by Brian Valentin/Staff Photographer) gionni. The 285-pounder it all on the line," said Nick karpinskl, Nick Mike Sahrmasel(Nibs season, which was nr- finished second at the Ley- Salemiand Anderson. West, 130) guably the best in pro- glorified ending to their men's supremacy. But No. Showcase Team. "If we LeBeau, whojoins team- den Sectional before going Kevin Pasoand An- Anderson added an- Jake Barack gram histor3 high school hockey ca- 2-seeded Maine was called didn't have all of those, it mates on to place third at State. (Glenbrook other goal in the third for South, 130) "It was a tremendous reers." for 12 penalties and played would have been a totally derson on the all-star "J had my mind set on different game." team. "That's what we did a 5-1 bulge, but Glenbard Chris Brassell(Maine season for all of us," said Ricky Andersonscored at a two-player disadvan- making the finals," he said. at first, but then we stum- North answered with a South, 285) first-year coach Steve the game's first goal on a tage three times through- Rockford went ahead 'But you can't always ex- bled. We didn't hold back, pair to pull within 5.-3. Rice Joe Brewster Glickrnan, whose team fin- breakaway and served no- out the contest. 3-1 early in the second, but Peel to be the winner. It (Maine South held the fort from there, 135) ished 37-13-3. "Of course, ticed to the crowd at The "Penalties killed us," Steve Zimmermanand though." takes a lot to wzestle back Maine South's Chris Brassell looking to Anderson's goal gave earning the win in net. make a move on Devon Smith of LakePark during a sectional match. CURTIS LEHMKIJIIL/ Jeffrey Brown we wanted to send the Edge, in Bensenville, that saidPat LeBeau,one of LeBeau both scored in the when things don't go your STAFF PHOTOGRAPHER i (Evanston, the MAINEiacs were three MAINEiacs selected period, each time bringing the senior - one of 12 for way.', 285) seniors home with a 35 pins and a record of 44-2. opponents in a combined Maine within one. The Maine this season - a Comment: ploneerlocal.Com overtime. tional tournament. «He nev- Tim Gavin(Notre Dame, championship, to have a ready to challenge the Ice-to the A}iAl's Illinois Just how dominant was In his four wins at the 6:02. He recorded another "He lias such a great atti- er let his record get to his 145) the senior? league and regional tourna- pin at the sectional, where tude' said South coach head. He'sjust having fun Ethan James(Evanston, Consider he finished with ments, he pinned all four he lost by two in the final in Craig Fallico after the sec- with the sport he loves." 160) LET US HELP YOU Jamal Johnson(Nibes West FIRST TEAM title and finished third afthe 125) the CSL and second at regionals. state qualifier at sectionals. 130 103 sectional to qualify for State. Marc Hunes Capped career with a 36-5sea- More than hail of his wins were (Notre Dame Matt Sommers, Notre Dame Ended the year 41-7. Jake Barack, Glenbrook South 215) son. by pin. junior sophomore 130 15z Ben Rosen(Nues West, 112) Celebrate! 215 The Don captured a regional Mike Bahrmasej, NUes West 135 Matt Sommers Denis Walsh, Notre Dame Marc Hunes, Notre Dame (Notre junior senior Jim Wallenberg, Notre Dame Dame, 103) championship before bowing out senior Announce Your Special Family Events: early at the sectional to finish Finished fourth in the CSL before Wrestled at 160 in ESCC to urna- sophomore Jim WaUenherq(Notre .1 Advanced to sectional semis be- 25-14. winning theregional. He lost in ment but dropped down a class 140 Dame, 135) fork falling to state qualifier. 112 the sectional opener to a state and finished first at regional. Patrick Conrad, Niles West Denis Walsh(Notre Dame, Took third at ESCC and first at re- Ea'ch.1ff x&9 qualifier to end up 28-9. 152) Ben Rosen, Nues West junior Ended up 1-2 at sectionals to end senior Anno4nceIfleflt 135 glonal. Finished 3312 with20 A Took third at the CSL tourna- season 35-Il. Also had 18 pins. 145 with photo - pins. t, Joe ørewster, Maine South 160 MONEER AWARDS 4 ment and won a regional title. He 285 Tim Gavin, Notre Dame senior Birthdays A Weddings ,c 2.8w : junior Ethan James, Evanston senior 1acli3.1 advanced to the semis of the Chris Brassell, Maine South 152 Newcomer of the Year Annour)ceinent Captured CSL and regional Captured two consecutive post- : sectional, where he lost to a senior Josh Guenther, New Trier Eric Ronnlnq(Nues West) Gmduationswith/without photo 3 5 championships before taking season championships before Anniversaries state qualifier to end his year at senior third at the sectionals to qualify In his rookie season, the 32-8. losing to state qualifier at sec- SECOND TEAM nch Additional I,, for State for a third year in a row. 160 145-pound junior went I l''l 119 tionals to end up 43-4. 103 20-14, earned all-conferenc Special PLit.ç...... : . . 1.O Finished 40-5. 171 Pat Dougherty, Loyola junior Bar & Bat . kA Jared Matfiew, New Trier Alex Gutierrez, Maine South honors in the CSL and qual Retirements 140 Taylor tieuffer, Glenbrook 171 Mitzvahs senior sophomore ified for the sectionals. t Nick Thrner, Glenbrook North South senior 112 Eric Damlos, Notre Dame Second in the CSL and third at senior Runner-up finishes at CSL and senior Comeback of the Year the regional, the Trevian finished Mitchell Copian, New Trier Any orders of two or more towns will receive a FREEprint suitable for framing I CSL champ placed second at re- regional tournaments. Then sophomore 189 Cody Fallico(Maine South) his careerwith a 31-6 mark. glonals to advance to sectionals. went 1-1 at sectionals to end 119 A broken finger from foot- For more Information, contact: 125 sea- Tim Stringer, New Trier junior Ended season 16-5. son 2912. Danny Illioud, Nues North 215 ball delayed thejunior'ssea Jamal Johnson, Nues West 145 Liz Maier at (847) 486-7230 or 189 sophomore son until January, but the senior Stephen Bot-a, New Trier junior CoHn Baer, Maine South senior Bilan RIdqe, Notre Dame junior 125 285 l30-pounder overcame the celebrate@pìoneerIOCaLCOm After taking second in the CSL Carne within a win of qualifying Pair of second places at ESCC Josh SUvei New Trier sopho- discomfort to finish 18-9 Submit your ads on!lne at: www.ploqeerlocal.com "SendUs Your News" tournament, he won a regional Jeffrey Brown, Evanston f9': State alterfinishingflrst in arid regional events. Lost to with 13 pins and advance to s more junior the sectionals. w PIONEER PRESS . 't, I e thxt&ø i 't s ' i ''YÖÌJRLOCAL AInisoere Preoo l'oblicotim,1m 'l'llrIcv,Irly, Mrl'clI Ill, DillIllI 31

Switch to the networkwith'.: ' ' I I ':'.' wortdwde* Ñorth' Shore' Woine&v the best coverage COl4feYeavtce/ More bars in moreplaces Spons,cIvo'nIdoby thcoPfontner I°yead'onrtd, the'ScneooTfaoozoo')ltgovi-qronup

FrCc1a', M#i5;.2oO9 BUY ONE FOR 1o:oOAflt&3:ÖÖp.wzti $4999 foIii/ioIpsn'ohSAaoo'e/SNrrr0i '$iaeoo(SOet GET ONO &CaesTfCrtnohc1Co171Lr ypollid 3'einl1 IOns Nduie, OC- FREE ,IS',n orli 0151 FP& po" lo t. Onm'LN Ke/PlotlioSprn -

yo'e.namted'hy too '1)520 uoncfWifmayta C(to,nubor,o of L03 SHINE' I Ceounearee. Call'847.W4g.46Me Pr 847.250'38MA :2.0 notinirioS SPmsII Tor enore infitrvlom lelo. ..'ollll'UIdllO" liláyr't Cc liaercrl'Iiy Iliz eo,ft'al'eI)r'ape, Olee n'aUree. 'Loavalee, OlInr'pov AI'aovlerp, :D15,15 rl(lplll'aod'O'rtcO. Lake j'p,ezt/Luie 01'aff', L,n,epi,añlrc, Llvcal'e,z,val valez, hldor'lAth'0000 llkeelOfial'oC 0001ra,, Arel-e, 50001e, 01111 'll'lt,oetko COorllOel'oefcareereoo'e

Ol ',0 1 PIoER PRESS SUl$TIMES Mole. E.al°c Ai Matado retamos ta petral Ahle oaR001d tar thom ONoraTe OR ORAR. (Rab ENel/StaTA P000teteMpbeet Taue LOCAL SOURCE GROUP BASEBALL j,iir »IO[(ìLIr' AT) Li1 \'bIr' A $l'OPE NOTICE OF CLASS ACTION SErOLEIIENT Fast impression: Demons FNEE SHIPPING TolrarUrPlmyroOolrk,N.A,CoRnNw.08C4008

IF YOU 0000APLAZR EFUsO ATM BETWEEN OCTOBER30, CORIANO BOSChI 31, 200E rOLlaS PERIOD"). RNA freshman to start at second WORE CAMISAS AFEE FORNE USE OF OlINO RIM, YOU MAT BE A CLASS MEMBER. ThIS OETTLEMENT MAY AFFECT TOUR RIENTRO My MUTT hARNESS "Hob going to hove to IIJ),jonior Nthstao Ueozhetot- PIRE TOnI baa AINE in Ola Cthnaooland area, lIra NOOSE mURS lo cortAn T0o3 Bank lIMO in 0001db, Cfll0090, and NOON IL and 00000000lam000 about the charging of Ions al En ATOO Mo. Total OuEd FTaza Sank undOro law mba to TSS@ p)onyeT I nno I tom he potiovt," Dolney noid, (ta(SS)otod junior At catndtheEleoomnlOfllndalrinosloronl100l0000ydOztateolMOdOnothavapwalodteonoaceo PUza000kdanlOO "Bot I think thin will ho- Noyade (OF). Dotsuey loca- As. razor'S 3101mb buI haz Jaread laasallamenlntthe aaaE. Das Dolnoy heard thy prove his overall goons. He peeting colztribotbono oaraO,olrrIO4r'O Ida seR000ItlotludNSaAoryzAaOhO mas ohar0035leo luroal0550 AIME belzeOn IolobetOA oaoi ana NanTIT, whispers is Oho ofizeoson will hove bobeo mom from hesbor Ateo CoMbats 2003.Theaepaaplaor00001d ClaaaMnmbnrn,"ozd050mnpoT035aliazalawdiayallndtho'CLaaFyrioU"Uzdar Oath., m,,,,5.O101 ta lam, YE TrOAmzTI thora omm Et polpE Ran ra000Er lnaneus Iras Ola ano lathe 15500101 tOut Taza Bando ollo freshnnnsno shoming complete ployer than ho (IB), junior Eddie Contr" 000,Onmola,OO 0,0" OooI.klrOSlc ,,,,rrlo,-,ob,h,Or Not morS or5500,000.20, plas say sOul demaaos Oral cloNa Tambero alTered P1013 honk NOS otalnd that dEInU pronsilbing potentiel. would be at the froshmen and sophomore the GlaNa Palla, UlAla mero 002rnyiRaroOl 0,500 AuonaoNuna Where AIM lEeS Osta Guatona daIno thN ama pEtad oeIl1DB) OOIrsOUUoO r bh0i00' o oaar,0mInLnoO,rucaOl1110rmt 55101uth, 'ro,,. aule,5 ltqu55000.ThemtoO, Taza Bath trou aareedthsslotlluh a0000merl Fund ut $01.500,00. PlAIRe suaIs st f0000, Nob one ta Why zway eve. Matt Perche,,ISP). ans,a,onwaromnoolaor,wm'° anIoNIc tees Not Is sEIend 035,000.10 and PayrTofll n Ola OlEaS tepinaanloauo lt 01,500 00 aro doduElod, Class from promlnb'ongoodzF. MIlker, oso zf the Libe Walker, Stipple will NnRbaroRhoaaodtheplMsdUlngtbsClaonPe1000rldlNrazhaloodateomayRak801lalwonRolattetnentrund IzrnnalneapWtaoaharo, aptaemodmarttotot,00000.Themoatgnlndladzdolno hetomnlawoallonuldm000er ylassmnn, bIte Mamo fiant teamb veterano, played draw os his euperienco to sarl,, n wtkI t, U $1,000.00 pluS any entraI hatm colland and BnrnlntE. So ayOmnya 0011000e S0000EflI 030001g 00001 RaNn a bzneb011 cozoh took o good varsity bio freslonran sea- help the Demone sovigote zlatn toruNo 01,000 00 la eiland Oa050abla. look At CArey EVITaN dur- oIs under Dolnny's diree- one of Oho more demand' ON Ray 22, 2000 attICo am., T000lnlmln Judaa Nolan ml hEll O toalla 1010013E lINEAr Io TNaEI EPIlOGO Ing tryzulo, Dolnyy WOO' tino. Now, the four'yeor ing bmebzll conferenceo Alo nelasmeat FEUDO SUOI NEED TO AHEAD. II SE Snnemeol Is spooned, all Class Remaste mill be bozad by ale nEulIng (adonnaI and noam GNaw, and 0110101e Clona NomIno AL ha azOTad In olalo lennElo LEder the enough to not only offer nlarter is one ob the mont in the stute, New Triar fis' selflemsnt Oyons aspot Inn the var. vabuobly Demonn, able to ished second in 2007, the )jflR,dioththosk. You Nano Olino olml500' siby, hut o playo in bine ploy nearly every pooition, final year nf the two-clam t) E yoa mati o fladEn NOEI praoS share Al We 000100ml TrOU, APIO amulwam 5101,0000E, yOu monI SLRrtiRg linoup ut necond "Hob so imporbost to system. Ike Treobono won aabmN000mpleled CRO 101m, pzalmarlrod by Mazo PIlilo Clase CoLosAl al TOE Wool WaohloglOn, IsEo 700, ua," Doloey sold of the o state tille Is 2000 end +0a50 III So O r dl ClUnaga. ll,0000D.l011b'etnsobmlstlalm 70mwh mean000rr&oes0001nobulemsrolnnomrnedbuavnlea,3 al paar dahW ta SaE 051510001 lot SE ATM loo noEzn 010100 roland 1051E Lowaalt 000rrdoad 001dm Form at "Alot of the Seniors outbieldor/inrlielder/pityher were rasnern'up is 1899, olaz305lanùalwzam.ornallCl000 Cuu000l al 1312) 702.5000 In Maa000Clalm Forro. wery coming up to me and "Especially he0000e wn toe mot poanee laut 00ko Os elI0aunaao asE Yoyaral 001,5,01 salcIne 00,000 aGO °Thoreb such slrosg osOouOaO sal oOa,05 Ooyonu 00 5101e000 naao,a1 lolal0e aNnulions aula 21111Go doa010aollopat3020thlnsooeR000nlysaRaslmrhaolooerala009, EIICWDE RE TROMNETOVAR telling my that (Evans) ore co young He mil he coonpetitbon ho our 0001 leN os0bo O PIPIO 03h11 SErSLONEAT. Itulade yaar lame anO aNdona and mEl 0e 1000110 Class Counsel al INn theol inraoOl,lszooInmnoIlnaaNt000tbboHOOl could hondle it," the sop- able to give goys u break," loagoe," sold Dolocey, a unYau,OoesTe,Oat110b05O15lrrr50101RL1b00b0b0059b0th050b5b0 bUap1011O WasbOolOn, Izas 700. ChIcago, L00002.YzArl000rmuElbEp000'osthodbyNaz4 200ltnbOAo0d. alUorol 10101,11 EaI0TOvI00000 loaSes 1,00100 I,iIolrnillI enth-yeor skipper said, OncmnuLuOlonoIOIlI00070000Sa sOoIul0100dUlOnlI a,,na000ro,o;l iosthonreua Wolloer could oye tune 1993 New Trier groduoto. e,anomarceoo,dslrnlmote,OlO,mOn5,00Tl0r31h1IdTbfbntITboTt0 3) T loa think Sa loldemEnt io allait, you may ob100lth 1151 oolangamamo stahng the spnniTo meollo tntyaar omsucooSrnroucar0zoOa01tuu001005011mdb000rO000b0Tb0b01000inb0M1ub001000fl000,,5000,115,q,yt0000,ce,ceoson0,t5,,na1Gbn0boI0on1hl00unmtro1abo1ziuzTImzOr5OIltIOIO,t,0In0IIoUlzOOao ob nI)E000n and nllna Il orth the Cnarl aloto loath Desloe SteEL COnago, IlOonia 50300 00 01 baloS Rga.N,.2S3 Dolney koows that at every p001tion but Every thon wo go out Ito mcieknOl000rctAOIlhORaOOlsilla0L O,,,,Ilfl,anlnIlIl 00o000,0,,rröt,ortnthnlOalzotobzonbo0obb0o11bnlnotl0luo1 0000TeslaOa0b00000botbancIbobnlmlu,50011a111hiu0015rb0b0b0000001lOiIoultaIOcLI5lO0fl5RtOl0I0ol51bOEsan1lIS0i boloolIsITaaoloE oopoonbba000pyloClsosCO30salaltolWeal000hlnglnn, SnlleIS,Chth000, lLt0502andlnOlanW010lorasN. Evom loas moeh to learn eotoher, center field and a010llu,ani011lIn,10100n Ta lIOSOs 11h50 ,eplO,nII.1001f101Oe o hattIe," ntho,OI010r0000lc a,yonelolsUsi050b0000lfl Il11rzOltOIllol000nAOsOt1001500 oCrai porpIIoaOea a,unoto,ordln,,n1000u'csOI Nal005llar05000,LO, 111 N. ClarlIlt, Oth500, Chioaoo, IL'TOOOl. OT0005rOOSO5 Eo,ùlSIu tuez Iiu,ocrareorlocnn oeaonlorroo lopcllvirl00011011 lolltozh,t0000LOlr ln,mua eod mIght struggle with shortstop. Dolneyb ebb obortu bhe OIllnINrO aNInd'UmrW orplufi ulnuolurobo Llll000lOOrOrrLIthOIO oArstuUO sou lIetI odluc100Tornnlsollb000000lorA bmnIrInOtOOlOnlOOfinIh ForRaroinlarrn0500,nLaOSnre..uorlononlnlnslzl300laOClaonC0000sLanoohapyoelolTh000noumerpda000sy caauasnonlllleoicu100,m00005000lntmtnb0501l000bbe leIE,saeouizNlPlol0000r0010lol00010 0rI1lo00LUoIL'0ai0100lOIdrvai,5 abRIl51 the big jump. He believes Other varsity veto back oorvemOporlvlOod5I0OlINllob5I000ui 0,15005e ocvoIne0InOzm05,00udl51b131l0m051Ub0u CanoErO., 130 W. WoahinglnTSt, 00.700. Chi5000. IL 00002; phonE (012)700.5010. oeaaos ut homo Batordny al0010loloml000coclllaololacll0cu,roaiaonsoo)T/Il0O.voboot,0h0t0at100,0tkb0Om5100rb0m5010110000 ralAYrallol cOle AloI ahUcho ,oeYrOOo 05 atOo,ml, aslu ou 00,1011000 zolaO E0 yalomo Oh dOl 1010301001 IrovOr 1151 Aqu uA 55 00101 001 uobuoA he mil be bettor io the for the Deseoso include ogoiwmt Luther North. aRo,n,uaelaourilo cr51 clouT. oroson ,nnsoa. orsI. Ib AO MOT CANATACT TONE COURT FOR IINFORMATTOM, field than at pIste, st boot IsSISOcO Fr0500t loves 0,0000011 Aenior Ehrt, Rtppte East then hoSto North' 0eyotzItotn01051d1 .,.' r.. . AS IT WILL NOT ME AALE TO ASSIST YOU eorly in the moms. (OF/Pl,senior Doue MitA,, ridge ow Mosdoy, arn6ung TwoStepT music phone exè

ote

: :: 4EPONEFREE1 WREN YOU BUTONE l'OR '89!! : After $50 mail-in rebate that comes as a Visa' Debit Aftè$5QñiI-nreliatàÌhatcóia's .: Cant, New 2-si-. a&mt. plus 3-mo. Unlimited easdge Visa Debit CardsNew 2-yigmts, plus Plan required. $30 act. fee may apply. :3-mo. Unllrñhtedìasyedge Plans requiredr- $30 act tees may apply Personalize your phone with real music tones from Sony Music Box. 'lJsten to over 100 channels ' . of the latest musIc and news while you're on the go. Avaflable in Purple, Orange and Red

ToùchScreen : .

.'. ,99_ : : After$50 màllbìrebate thatcame es' a Visa Debit Card.Requires new 2-yr. agmt. änd Premium Mobile Internet Plan purce: act. fee mayapply,

'SOnyour phoeoron theWeb, Tone Room is a one.stop shop for all your ringtone needs.

U.&Celiular believe in something better

Dlscover the Difference: Put our network, products and customer service to the test for 30 days Change your calling plan at any time duringyour service agreement without signing a new contract Renew your contract and take advantage of new phone pricing before your current contract ends - Let us help you find a location: visit usceflular.comor call 1M888.BUYUSCC

Things we want you to knowfl Offers vatid with Voice Plans of $39,95 per month or higher. New two-year agreement (subject to early termination fee)and credit approval required. A $30 activation fee may apply. 96 Regulatory Cost Recovery Fee applies; this is not a tax or government-required charge. Additional fees, taxes, terms, conditions and coverage areas apply and vary by plan, serviceand phone. Use of service constitutes acceptance of the terms of our Customer Service Agreement. See store for details or visit uscellular.com, 3D-Day Guarantee: Customer is responsible for any usage charges incurred prior to return. Phone mustbe returned undamaged in the original packaging. Promotional Phones sublect to change. U.S. Cellular Visa Debit Card issued by MetaBank pursuant to a license from Visa U.S.A. Inc. Allow 10-12 weeks forprocessing. Card does not have cash accessand can be used at any merchant location that accepts Visa Debit Cards. Card valid for 120 days after issued. Unlimited easyedge Plans start at $9.95 per month.Premium Mobile Internet Plan is$19.95 per month. Application and data network usage charges may apply when accessing applications. BOGO: Buy one handset and get a second handset for free. Mail-in rebate and activation required on each handset. Contract Renewal:Customers who have completed at least 18 months of a two- year agreement are eligible for promotional equipment pricing. See store for eligibility. Umited-time offer. Trademarks and trade names are the property of their respective owners.©2009 U.S. Cellular.