THE MELVILLE

Friday, $1.50 PER COPY GST INCLUDED March 5, 2021 Vol. 95 No. 5 Agreement # 40011922 PROUDLY SERVING MELVILLE AND SURROUNDING AREA SINCE 1929 • WWW.GRASSLANDSNEWS.CA • 1-306-728-5448 Melville embracing recycling program with high success City’s high recycling rate nets rebate of over $50,000

By Emily Jane Fulford Grasslands News

Waste Management – it’s been the hot topic of de- bate and discussion for the last couple of years in the City of Melville. From plans regarding the manage- ment for the existing landfill in a way that would be compliant with The Saskatchewan Ministry of Envi- ronment, to Melville’s involvement in the war on sin- gle-use plastics, to implementing curbside garbage and recycling pickup, to the opening of the new SARCAN facility, the topic of Waste Management was second only to COVID-19 in 2020. Rewind back to winter of last year, there was a lot of speculation surrounding curbside recycling pickup vs. the old way - driving to an ice-covered lot on First Avenue and going through the motions of sorting out recyclables into an array of different collection units, each with its own set of rules, while attempting to remain upright. The City of Melville believed that relieving its citizens of the nuisance process would encourage recycling and reduce waste. The numbers show favorably to that end. New planning manager “The City of Melville implemented a more com- Alex Popoff has been hired as the City of prehensive recycling program in 2020 to ensure that we prolong the longevity of the landfill by effectively 0HOYLOOH·V3ODQQLQJ6HUYLFHVDQG'HYHO- diverting 30 per cent of the waste intake,” says City opment Manager. Alex will look after mu- Manager Ron McCullough. “By implementing a curb- nicipal bylaw regulations and works with side collection program for our recyclables, we are Council to provide information for making eligible for the Multi-Material Stewardship (MMSW) decisions regarding development, zoning program. The MMSW is an organization that over- DQG VXEGLYLVLRQV 6HH UHODWHG VWRU\ RQ sees the Saskatchewan recycling program, which en- page 15. sures businesses selling or distributing packaging and printed paper materials share the responsibility with CHRIS ASHFIELD | GRASSLANDS NEWS municipalities to finance the collection and recycling of household packaging and paper. The Multi-Material Stewardship Western program rate is $27.50 per home per year. This funding will result in an annual rebate payment of nearly $51,507.50 for the City of Melville. the Recycle Coach program, a popular app designed compared to all other communities they provide this Administration has submitted our annual report, and to help municipalities reduce waste by educating the service to,” says McCullough. “We want to thank the the rebate will be issued to the City of Melville within public. community of Melville for embracing the curbside the next few months.” The Recycle Coach app, like many apps, is designed program and making it so successful.” In June of 2020, Ottenbreit Sanitation Services (OSS) as a tracking program that collects data on its users. Just over a year ago in January of 2020, the Govern- deployed 1,873 curbside waste and recycling carts to The City of Melville’s usage is as follows: ment of Saskatchewan released an updated provincial all residences across the city. Needless to say, making So far, The City of Melville has 503 users per 1,000 Solid Waste Management Strategy. The outline pro- the task of recycling easier paid off, as the tonnage of households, this is roughly double the norm, as the av- vided a basic strategy for waste management goals, recyclables collected increased by over 28 per cent. It erage community has 252 users per 1,000 households. both short and long-term, intended to take place over was an extremely solid start to a new program that The interactions are also more than double, with 5,849 the next 20 years. The target: 30 per cent reduction by had caused a lot of stir in its infancy. user interactions logged on the app, compared to the 2030 and 50 per cent by 2040. It’s a plan that may seem “We expect the amount of recyclables to increase average of 2,197 interactions. Needless to say, resi- daunting to the average person but it’s not intended to as we move forward,” explains McCullough. “The dents of Melville spend a lot of time on this app and it be accomplished entirely on an individual to individ- curbside program has been received well by the com- may be indirectly related to the amount of time spent ual level. People don’t always have that much control munity, and the figures reflect this. The monthly recy- online in general. While that may not necessarily be a over what garbage comes into the home and subse- clables collected has steadily increased from July 2020 good thing when it comes to most social media apps, quently out of it, and that is where the stewardship until December 2020 and will continue to do so the the Recycle Coach seems fairly harmless and has the programs come in. longer the program is in operation.” potential to help the environment which puts it a far The province is open to all ideas that will help re- However, The City of Melville does not plan to rest cry ahead of many of the options one has to poke at duce household waste before the point of entry, and on its laurels when it comes to waste reduction. They on a smartphone. that’s where packaging comes in. The Household Pack- plan to use the city’s website as well as social media “Ottenbreit Sanitation Services confirmed that the aging and Paper Stewardship Program Regulations to increase awareness and encourage residents to recy- City of Melville has a high recycling percentage per are in place to govern the distribution of packaging cle more and reduce waste. They also partnered with capita with one of the lowest contamination rates - SEE RECYCLING, 15

• Motor Licence Issuer • Notary Public • Surety • Home/Auto/Farm/Commercial • Blue Cross • GMS • Hagerty

OPEN Monday - Friday 8:30 a.m. - 5:00 p.m. Melville - Springside - Ituna Saturday 9:00 a.m. - 12:00 p.m. Excluding Long Weekends 228 Main St. 306-728-4457 www.melvilleagencies.com @MA1974LTD 2 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Love of the north shines through in her artwork

By Sarah Pacio you’ve seen out there In December, Nind Grasslands News before. I didn’t want to began priming each be like anybody else; I canvas with six coats of wanted my own style, my paint to achieve the de- Artist Monique Nind own way.” sired background. Then is sharing her love of the As she continued to she sketched each scene north and her passion pursue the hobby, her fa- and last weekend fin- for fishing through a ther and others proposed ished outlining them in series of paintings com- she sell some of her work black paint. Over the missioned by the Sas- and she was successful in next few months, she will katchewan Arts Board doing this. Nind desired continue to add colors (SK Arts). to take her art further as and eventually varnish. Nind is an Inuvialuit a career and began seek- “Each painting has a Beneficiary, formerly ing grants to make this story to tell; I want the from Yellowknife, NWT. possible. Last year, she person to not only visual- She moved to Saskatche- applied for funding from ize what I’m saying in the wan nine years ago and the Indigenous Peoples picture, but to feel what’s now lives in Grenfell Art & Artists program going on and get the sen- near her daughter and offered by SK Arts. Her sations of the wind or five grandchildren. application was approved the water glistening – all Painting came natu- and she said it was a the details,” Nind said. “I rally for Nind, having “game changer,” giving want the person to expe- been surrounded by art- her confidence to believe rience that when they’re ists all her life. Her aunt she could succeed. looking at my paintings Mona Thrasher was a Nind chose “The Love or reading the journal.” well-known Indigenous of Fishing” as the theme Nind will complete artist; other friends and for her project, which the project by the end of family, like her mother, will include four paint- May and, depending on sold their artwork or ings accompanied by COVID-related restric- taught art in school. Sup- journals. “One of my pas- tions, the SK Arts will ported by these inspiring $UWLVWLFÁDLU sions in life is to go fish- host a display of the fin- figures and with encour- Self-taught artist Mo- ing every summer,” Nind ished paintings later this agement from family nique Nind from Gren- explained. “It came out year. members, Nind began to fell is expressing her into my artwork; this se- Anyone interested in take a serious interest ORYHRIÀVKLQJWKURXJK ries portrays the stories Nind’s work can contact in creating her own art- of the fishing trips.” her through Facebook. a series of paintings work in 2009. (above) commissioned Nind is self-taught; by the Saskatchewan she watched others and Arts Board. The proj- studied their techniques, Hon. Warren Kaeding PAg. ect will be completed working hard to develop MLA for Melville-Saltcoats Minister of Environment by the end of May. Nind her own unique style also expresses her love using acrylic paints. “I had gone to quite a few Phone: 306-728-3881 [email protected] of the north through art museums, art galler- her other works of art ies over the years and I OFFICE HOURS (right). saw what other people Monday to Thursday 9 a.m. to 4 p.m. were doing,” Nind told 68%0,77('_*5$66/$1'61(:6 Grasslands News. “I wanted to do something different, nothing like

2021 YOUTH OUTDOOR SOCCER PROGRAM REGISTRATIONS ARE NOW OPEN! THE 2021 OUTDOOR SOCCER PROGRAM WILL RUN (TENTATIVELY): From May 3rd - June 28th (No Soccer May 24th) *Dates, times & locations are to be determined* WE ARE HOPEFUL FOR A SOCCER SEASON THIS YEAR. DUE TO THE UNCERTAINTY OF COVID-19 RESTRICTIONS - DATES, TIMES & LOCATIONS FOR EACH AGE GROUP ARE TO BE DETERMINED. WE WILL NOT BE ACCEPTING PAYMENT UNTIL WE ARE CERTAIN 21031mm4 SOCCER CAN GO AHEAD AS PLANNED.

To register please visit www.melville.ca/p/outdoor-soccer-program REGISTRATION DEADLINE IS APRIL 15TH, 2021 AT 4:00PM

If you have any further questions please contact the Recreation Department at [email protected] or 306-728-6860 www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 3 PVSD changing focus on Indigenous education By Emily Jane Fulford order to ensure safety. Regardless of the positive results Grasslands News and outlook, the school division has vowed to continue its efforts to evaluate the impact of the COVID-19 pan- The Prairie Valley School District Board announced demic on student learning. on Feb. 19 that they will be ramping up Indigenous fo- The Resident Knowledge Keeper Program, which tran- cused education moving forward. It was part of their sitioned to the Remote Learning Elder online program, board update created on Feb. 11 to address various key at every school except one, continues to be a success; points the school board has as we approach the end of the Bert Fox Community High School continuing with another school year. the in-person program. Both versions of the program, in-school and online, have been designed to connect stu- “Graduation rates for Indigenous students continue the past number of years. It was also brought to the pub- to trend up. That is one message the Board heard from lic’s attention that the graduation rates for Indigenous dents and teachers consistently with Elders and Knowl- senior leadership during a presentation on the Division’s students also remained significantly higher than the pro- edge Keepers from their community whose goals are to Indigenous Education Strategy. The last year has been vincial average, indicating that the system is working provide guidance, mentoring, and teachings both inside and continues to be, highly impacted by the COVID- thus far. and outside the classroom. 19 pandemic. For that reason, there have been some Reading results in this demographic have remained Action items related to the strategic plan, such as changes to the Indigenous Education Strategy and focus consistent since the fall, another piece of good news for those which include work on culture and language for the 2020-2021 school year.” the board during these troubling times when it would be courses, First Nation-driven partnerships, and anti-rac- The board included in their presentation, updates on expected that numbers would fluctuate due to students ism and oppression education for staff also continue to the number of self-declared Indigenous students enrolled, having to deal with the circumstances surrounding the operate under the Board and have thus far appeared to which they noted has remained at a consistent 1,300 over pandemic and the limitations that had to be imposed in produce positive results. Grain farmers shouldn’t shy away from benchmarking By Peter Manness, MNP two things we must give are time and to be taken into consideration. Trend your management skills. If you are one for Grasslands News money. If our efforts do not generate a also gives us hope if some costs are out of the most profitable producers, does it return, then over the long run, are we of line. If we can hold them in the short change your perspective on how you ap- making good use of our time? It is okay term, it may bring us back into line with proach growth? When ever I bring up benchmarking to give up some profits to devote your the benchmark over time. Farmers are all trying to play the with grain farm clients, I generally get time elsewhere, but how can we make 3. Focus: Focus is the final piece after same game but ultimately no two farms two reactions. The first is from a group an informed decision if we don’t know you understand how you compare from or farmers are exactly alike. By utiliz- of producers that immediately buy into what we are giving up? There is often a profit standpoint and the trend you are ing benchmark information, you can see the idea and want to know how they a concern among producers that one re- on. A farm financial statement is full of what things make your farm successful, compare to other farms. The other group gion is way more profitable than other numbers and it is easy to get caught up how you can continue to achieve that in either think they are already equal to regions and farms can’t be compared focusing on something that isn’t import- the future and what areas to focus on to their neighbors or they don’t want to across broad geographical areas. In our ant. If you aren’t hitting the profit tar- make it happen. find out. Most farmers will spend all Eastern Prairies region, our most recent get, then you can go back to see where Peter Manness, PAg, is a Business day and night talking, reading, and even grain benchmark numbers showed that the problem might be. Are we short on Advisor in MNP’s Farm Management tweeting about farming to anyone and the top 15 producers were spread over 10 revenue? Do we spend too much on in- Consulting group and his contact infor- everyone but they are also fiercely inde- crop insurance risk areas, indicating to puts versus what we get in return? Is it mation can be found below. pendent business people and don’t like me strong management is just as, if not costing us too much in operating costs Peter Manness to talk about the financial health of their more valuable than good land. or overhead? It might not lead to an easy P: 204-727-0661 business. The usefulness of a benchmark 2. Trend: What trend you are on is solution, but at minimum it will give E: [email protected] is not as much a ranking tool as it is just as important as where you are. This you more certainty in how you deploy Twitter: @petermanness a method to help evaluate and direct is one of the greatest benefits of using business decisions. I like to breakdown benchmark data versus historical aver- into three main areas; Profit, Trend and ages or targets. In Western Canada, pro- Focus. ducers have maintained profits by not 1. Profit: I don’t like to say it’s all only expanding acres but by continually about the money but in business it is pushing yields higher. The current trend generally a good place to start. When- is adding 1 bu per acre per year in wheat ever I look at a financial statement, I al- yield and over ½ bu per acre in Canola. We make it our ways start at the bottom of the income We obviously know that costs are rising statement with the profit line. A bench- along with the increase in yield. If we mark can take out the markets, weather understand how our trend compares to business to make and size and show the impact of effort the benchmark trend, it helps us to see and management on a per unit basis (per if we are keeping up on a revenue basis acre for grain farms). Are we generating and managing our costs. A five-year his- yours better a reasonable profit for the size of our op- torical average on machinery costs is eration on a per unit basis. If not, why? useful but you can’t buy a new combine And secondly, does it matter? The only for the same price as in 2016. This needs Farmers sequestering carbon Give credit where credit is due

In today’s business environment, it’s more important than ever to make informed business decisions. That’s why you need an advisor who understands you and your business from a local perspective. National in scope, local in focus, we deliver industry-specific advice and personalized strategies to help keep you competitive and profitable. DR. Robert Kitchen MP Souris-Moose Mountain Moosomin Office | 306.435.3347

MNP.ca 1-866-249-4697 • www.drrobertkitchen.ca 4 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Tourism and small business grants announced

By Elaine Ashfield port Program (STSSP) port Program will pro- Canada, so we applaud curtail operations due to experienced a loss of sales Grasslands News and an extension the Sas- vide much-needed further this announcement as a public health order. Fi- revenue of at least 30 per katchewan Small Busi- assistance for this import- these programs will be nancial assistance in this cent in 2020 when com- ness Emergency Payment ant sector. incredibly helpful to extension includes a pay- pared to 2019. The pro- Several businesses (SSBEP). “While hope is on the tourism and hospitality ment for both February gram will begin accepting benefitted from the gov- Ryan Dale, who is the near horizon with the operators as they struggle and March 2021 of up to applications on March 8 ernment grants as they facility operations man- vaccine roll-out now well through the pandemic,” $5,000 per month that can and the deadline to apply faced uncertainties due to ager and recreation di- underway, this support Hospitality Saskatche- be used for any purpose. is April 30. It is expected COVID-19 and many are rector of Whitewood’s will assist tourism-depen- wan President and CEO “We know getting back the extension will provide hoping to benefit again recreational attractions, dent businesses that still Jim Bence said. “We are to normal is still months approximately $15 million this year as the Govern- confirmed that they had face uncertainty about very appreciative of the away for most businesses in support. ment of Saskatchewan received $7,500 from the 2021 tourism year Government of Saskatch- across the province, so Prior to 2020, tourism last week announced the their grant application to as we continue to work ewan’s steadfast commit- we are pleased the Gov- generated more than $2 renewal of the Saskatche- STSSP last year to help through the challenges of ment to the tourism and ernment of Saskatchewan billion in revenue annu- wan Tourism Sector Sup- offset expenses due to the the global COVID-19 pan- hospitality industry, and is providing additional ally, employing individu- possible losses from the demic.” their willingness to work help by renewing the als in communities right pandemic. When originally with us and continue to Saskatchewan Tour- across the province. LOOK Grenfell’s recreation launched, the program establish a path forward ism Sector Support Pro- For more information department, as well as the provided $14.5 million in in these uncertain times.” gram (STSSP) as well on the STSSP 2, call 1-800- Town of Broadview did financial assistance to The Government of as extending the Small 667-6102, email stssp@ not utilize any funding 761 eligible businesses Saskatchewan also an- Business Emergency Pay- gov.sk.ca, or visit www. HERE! from last year’s program. between August 2020 and nounced an extension of ment (SSBEP) for both saskatchewan.ca/tour- Trade and Export October 2020. The STSSP the Saskatchewan Small February and March ism-sector-support. Development Minis- More information on You just proved even provides financial assis- Business Emergency Pay- 2021,” CFIB Vice-Pres- small ads get noticed. ter Jeremy Harrison tance to eligible tourism ment (SSBEP), which was ident, Western Canada the SSBEP is available stated during the grant businesses in the accom- established to provide fi- and Agri-business Mar- at https://www.saskatch- Contact us today! announcement that modations, attraction and nancial assistance to eli- ilyn Braun-Pollon said. ewan.ca/covid19-busi- “Tourism is vital to our tours, events, and major gible small businesses in “These funds will provide nesses. 1-844-GNG-NEWS economy in Saskatche- event facility sectors. Saskatchewan that have some needed cash flow to Businesses that are DGV#JUDVVODQGVQHZVFD wan, and the renewal of “This level of support been ordered to temporar- help more businesses get non-compliant with pub- the Tourism Sector Sup- is unprecedented across ily close or substantially through the current re- lic health orders will strictions.” not be eligible to receive The STSSP is targeted support under these pro- to businesses who have grams. 306-735-2210 731 - Lalonde St. P.O. Box 129 Correction – Cowessess Solar Whitewood, Sask. An article titled “Cowessess FN installing solar Email: [email protected] S0G 5C0 power panels” was published on page 3 in the Feb- Web Site: www.townofwhitewood.ca ruary 26, 2021 issue. The article incorrectly stated that a federal grant would cover 25 per cent of the SUMMER STAFF TOWN COUNCIL MEETING project. It should have read, “Cowessess will receive approximately $633,000 from the federal grant, which 7KH7RZQRI:KLWHZRRGLVQRZDFFHSWLQJDSSOLFDWLRQV 7RZQRI:KLWHZRRG&RXQFLOPHHWVRQWKHVWDQGUG will cover 75 per cent of the project’s overall cost.” We UHVXPHVXQGHUWKHSRVLWLRQRI6XPPHU6WDIIZLWK 7XHVGD\RIHDFKPRQWKDWWKHWRZQRIÀFH sincerely apologize for this error. SRVLWLRQVZLWK3XEOLF:RUNV5HFUHDWLRQ'HSDUWPHQW 8SFRPLQJ&RXQFLO0HHWLQJ'DWHV DQG2IÀFH$VVLVWDQW 7XHVGD\0DUFK²SP 3OHDVHLQGLFDWHRQ\RXUDSSOLFDWLRQUHVXPHWKDW\RX 7XHVGD\$SULO²SP Planning on Selling DUHDSSO\LQJIRUWKH´6XPPHU6WDII(PSOR\PHQW 2SSRUWXQLW\²3XEOLF:RUNV5HFUHDWLRQRU2IÀFH 0HHWLQJVDUHKHOGYLD=RRP3OHDVHFRQWDFWWKHRIÀFH Some Equipment or $VVLVWDQWµ WRJHWDFFHVVLQIRUPDWLRQ 7KH7RZQZLVKHVWRWKDQNDOOSHUVRQVZKRDSSO\ having a Farm Auction? KRZHYHURQO\WKRVHVHOHFWHGIRUDQLQWHUYLHZZLOOEH RESIDENTIAL LOTS FOR SALE FRQWDFWHG$SSOLFDWLRQVPD\EHPDLOHGGHOLYHUHG Need an apprasial ID[HGRUHPDLOHGWRWKH7RZQRI:KLWHZRRGDWWKH 7KH7RZQRI:KLWHZRRGKDVFRPSOHWHGGHYHORSPHQW IROORZLQJDGGUHVV RI+HULWDJH&UHVFHQWORFDWHGZLWKLQWRZQOLPLWV on assets? Town of Whitewood 7KLVORWGHYHORSPHQWLQFOXGHVSRZHUZDWHUDQG Give our 731 Lalonde Street, P.O. Box 129 VHZHUWRDOOORWV&RVWRIDORWLV Whitewood, Saskatchewan S0G 5C0 Sales Manager, Phone: 306-735-2210 Fax: 306-735-2262 &RQWDFWWKHWRZQRIÀFHDWWRJHWIXOO Trent Guenther, e-mail: [email protected] GHWDLOV a call today GARBAGE / RECYCLING 1-306-621-4739 5HVLGHQWVDUHUHPLQGHGWKDW*DUEDJHRU5HF\FOLQJ &DUWVPXVWEHRXWE\DPRQFROOHFWLRQGD\V

8SFRPLQJGarbage'DWHV Lic 325025 :HGQHVGD\0DUFKDQG www.yacauctions.com 9-26c - Odd 8SFRPLQJRecycling'DWHV :HGQHVGD\0DUFKDQG Easter Egg Hunt Saturday, March 27, 2021

6WDUWWLPHDQGORFDWLRQZLOOEHDVVLJQHG WRSDUWLFLSDQWIROORZLQJWKHLUUHJLVWHULQJ PERSONAL CARE HOME Three locations: /DUVRQ3DUN:KLWHZRRG3OD\JURXQG DQG:KLWHZRRG0XVHXP Private bedrooms/bathrooms $OOIDPLOLHVPXVWUHJLVWHUDKHDGRIWLPH TOWN OFFICE INFORMATION for Singles and Couples. To register please email: Virtual tours provided during COVID-19. :KLWHZRRG7RZQ&RXQFLODQGVWDIIVWULYHWRLPSURYH UHFUHDWLRQ#WRZQRIZKLWHZRRGFD Corinne Pauliuk - Owner/Operator \RXZLOOEHSURYLGHGZLWKDOLQN WKHTXDOLW\RIOLIHIRUWKHSHRSOHZKROLYHDQGZRUN LQRXUFRPPXQLW\:HZHOFRPH\RXUFRPPHQWV $JHV&RQH[XV3OD\JURXQG6WDUWV TXHVWLRQVDQGIHHGEDFN $JHV0XVHXPDQG+RUVHVKRH3LWV 7KH7RZQRIÀFHLVRSHQ0RQGD\WR)ULGD\IURP 306.699.2548 $JHV:KLWHZRRG&DPSJURXQG DPWRQRRQDQGWRSP Located on 28 groomed acres between 3KRQH MUST Pre-register and wear a mask. )D[ McLean & Qu’Appelle Gatherings will be limited to 10 people at a time. (PDLOJHQHUDO#WRZQRIZKLWHZRRGFD website: carehomes.ca/homes/sunrise-country-haven/ www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 5 MP advocates for 3-digit suicide prevention line

By Elaine Ashfield And Whereas existing suicide prevention, and Grasslands News suicide prevention ho- strong social protection, tlines require the user people in Canada can get to remember a 10-digit through the pandemic As the rates of suicide number and go through without an additional continue to rise, Cathay directories or be placed loss of life to suicide. Rec- Wagantall, Member of on hold; ognizing that the impacts Parliament for York- And Whereas in 2022 of COVID-19 will be long ton-Melville, submitted a the United States will term, complex, and may request to Melville mayor have in place a netional take time to fully emerge, and council that is asking 98S crisi hotline; it will be essential to take all municipalities across And Whereas (insert the long view by advo- Canada to consider pass- municipal name) Town cating for the continued ing a motion to bring a Council/Municipality/ expansion of universal national 3-digit suicide City recognizes that it is supports (such as the prevention hotline line to a significant and import- Wellness Together Can- Canada. ant initiative to ensure ada portal and distress The House of Com- critical barriers are re- line), adequate funding mons passed the motion moved to those in a crisis to maintain and enhance introduced by Conserva- and seeking help; elected officials and as ondary outcomes, such as mental health and sub- tive MP Todd Doherty And Therefore Be It leaders, and especially an increased risk of sui- stance use services, and in December 2020: “That, Resolved That (insert mu- during this period of diffi- cide.1 Many believe that amplified monitoring given the alarming rate CATHAY WAGANTALL MP nicipality) Town Council/ culty as a nation, Canadi- maintaining and enhanc- and research to better of suicide in Canada con- Municipality/City en- ans are counting on all of ing the mental health of understand the dynamic stitutes a national health support for the cause by dorses this 988 crisis line us to make a difference. the public throughout a impacts of the pandemic, crisis, the House call on personally signing the initiative; Please consider passing pandemic is just as im- now and in the future. the government to take electronic petition. The and that staff be di- this motion as soon as portant as reducing the immediate action, in electronic petition can rected to send a letter in- possible.” spread of the virus. collaboration with our be signed at: petitions. dicating such support to The brief also states LANDFILL provinces, to establish a ourcommons.ca/en/ the local MP, MLA, Fed- Mental Health brief that economic recession )25748·$33(//( national suicide preven- Petition/Details?Peti- eral Minister of Health, A Policy Brief by the (a consequence of many tion hotline that consol- tion=e-2772 the CRTC and local area :,17(5+2856 Mental Health Commis- pandemics), and the sub- idates all suicide crisis municipalities to indicate • November 1 to April 30 • sion of Canada, COVID-19 sequent rise in unemploy- numbers into one easy The Draft motion our support. Monday to Friday and Suicide: Potential Im- ment, is associated with to remember three-digit reads: “The past year has 9:00 a.m. - 4:00 p.m. (988) hotline that is acces- been a challenging year. plications and Opportuni- higher suicide rates. Saturday 9:00 a.m. - 1:00 p.m. Closed Sunday and Statutory Holidays sible to all Canadians.” Support for 988 Crisis Line Lives and livelihoods ties to Influence Trends in In summary, the brief Minimum Load Charge is $10 Wagantall is encourag- Whereas the Federal Canada also supports the noted “While history have been lost. We have We now Accept: ing continued pressure on government has passed a begun to see the devastat- statements regarding in- demonstrates the poten- the government and the motion to adopt 988, a Na- ing impacts that COVID creased suicides in Can- tial for COVID-19 and the Canadian Radio-televi- tional three-digit suicide has had, through isola- ada. resulting anticipated eco- sion and Telecommunica- and crisis hotline; tion, on the mental health The brief states in one nomic recession to impact section that while re- suicide rates, an increase tions Commission (CRTC) And Whereas the ongo- of Canadians,” Wagantall Published quired to curb the spread is not inevitable. by providing a draft of a ing COVID-19 pandemic wrote in her letter to the Fridays motion for municipali- has increased the demand municipalities. of COVID-19, physical With close attention to JUDVVODQGVQHZVFD ties to consider passing, for suicide prevention “The rates of sui- distancing also has the the risks, the implemen- 1-844-GNG-NEWS as well as promoting services by 200 per cent; cide continue to rise. As potential for negative sec- tation of best practices in Town of Fort Qu’Appelle 136 Boundary Ave. S. - P.O. Box 309 S0G 1S0 Phone: 306-332-5266 Email: [email protected] Website: www.fortquappelle.com Council Comment Council Meeting Kudos to the public works employees on a job well done. This past The next Town of Fort Qu’Appelle Council meetings will be held month they have had to cope with ice, high winds, a short cold snap, on: Thursday, March 11, and Thursday, March 25 at 7:00 p.m. snow events, and an extended power outage. All through the month of January they never missed a beat. THANK YOU! Snow Removal Sidewalk Snow Clearing Please remove vehicles from streets when snow removal is During the winter months, snow and ice on sidewalks can underway. This will allow Town staff to clear snow from streets without obstructions. seriously impair the ability of people to get around safely. For that reason, the Town asks owners or occupants of property to clear sidewalks of snow and ice to prevent injury or inconvenience to Saskatchewan Lotteries 2021-2022 pedestrians following a snowfall. Community Grant Program The Town will be accepting applications until Monday, March 15, Transit Van Operating 2021. Application information and forms are available on the Town The Transit Van began operating again on Monday, Feb. 1, 2021. website: www.fortquappelle.com Please see the Fort Qu’Appelle website or Facebook page for Rules and Procedures. New Transit Van Fares Upcoming Recycling Dates In Town One Way $5.00 Upcoming recycling dates are slated for March 23 and 24 and April Second Stops (per stop) $2.00 27 and 28. Out of Town Less than 25 kms $10.00 from Fort Qu’Appelle, Plus 75¢ per km Out of Town More than 25 kms $20.00 Contact Information from Fort Qu’Appelle, Plus 75¢ per km To ensure you receive all Town correspondence, please make Plus $30.00 per hour sure you provide your correct contact information (phone, email, and Minimum 150 km charge wait time PDLOLQJDGGUHVV WRWKH0XQLFLSDO2I¿FH 6 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

“For the cause that needs assistance; for the wrong that needs resistance; the future in the distance and the good that we can do.” Children’s entertainment drawn into gender equality

This week’s opinion may be making a mountain out of in the Garden of Eden? in the present - just in a different context. Babar still leaves a mole hill but nonetheless I have to comment – bring back Every person - of every gender - is entitled to be recog- his community to educate himself and often returns home Mr. Potato Head and let Dr. Seuss rest in peace for his won- nized. The issues being pushed for should be respect for to enlighten his community on the new happenings in the derful series of children’s books! This gender equality and gender and removing discrimination and not the continual world that may be defined as “civilizing” his fellow people. erasing history to satisfy those that are sensitive to some cry to make everyone and everything appear the same to It’s called education and advancement in today’s world. issues is getting a bit ridiculous. prove the point of equality. Curious George depicting a stereotype of Africans be- Oh, I believe in gender equality, after all I’m a woman The famous Dr. Seuss books are read by millions around cause a white man brought a monkey home baffles me as (that statement made with humor by the way). I also believe the world and applauded for the positive values in many of well. A man brings a pet home in a children’s book is now that some of the happenings and teachings in the past may his works, including environmentalism and tolerance but turned into the premise of opinions on Africa. There were not be the best but that does not mean we should destroy now there has been increasing criticism in recent years issues of slavery and are issues of discrimination against them or bury them and we need to quit making innocent over the way people of colour are drawn in some of his the culture but I don’t believe that Curious George had any things into political issues. most beloved children’s books, as well as in his earlier ad- intention of promoting that. There is a saying that goes something like “We can’t vertising and propaganda illustrations. Oh, and there are Then there is Little House on the Prairie novels where change yesterday or the past but we can learn from it and more ... the author wrote her portrayals of the early days of set- start new tomorrow.” In the 2007 book, Should We Burn Babar?, the author tlement in the country. Stop reading them – they may be By removing the Mr. from the iconic Mr. Potato Head, and educator Herbert R. Kohl contended that the Babar the promoting how people lived inappropriately in those days! you have committed gender inequality against him. He is Elephant books were celebrations of colonialism because So, here’s my comment – there are many versions of our a Mr. and if you don’t like him, then make a Miss or Mrs. of how the title character leaves the jungle and later re- past history. There are many tales put together to portray potato head or just a plain old Potato Head but don’t elim- turns to “civilize” his fellow animals. One of the books, our thoughts, emotions and opinions. Criticizing, complain- inate the Mr. Babar’s Travels, was removed from the shelves of a British ing or destroying the past, the history that has developed Gender equality means that all genders are free to pur- library in 2012 because of its alleged stereotypes of Afri- from years of portrayal of memories, will continue forever. sue whatever career, lifestyle choice, and abilities they want cans. Critics also have faulted the Curious George books Why not put your energies into something beneficial like without discrimination. Their rights, opportunities, and ac- for their premise of a white man bringing home a monkey working with others to educate what the wrongs of the past cess to society are not different based on their gender. So from Africa. were, not by trying to bury things or sensationalizing is- let Mr. Potato Head be himself, unless of course, the means And Laura Ingalls Wilder’s portrayals of Native Amer- sues written for children’s entertainment? Maybe write a behind the outcries to remove the Mr. from this character is icans in her Little House On the Prairie novels have been book how Babar helped his community prosper with his an agenda to make future society gender neutral. faulted so often that the American Library Association knowledge gained elsewhere or how Curious George be- Are we all going to dump out our toy boxes and remove removed her name in 2018 from a lifetime achievement came best friends with an African because they both loved every character that isn’t gender neutral? Is this beneficial award it gives out each year. his pet monkey. Those that only look for the bad will only to us to try to erase a society that consists of various gen- Well, people – all of the issues being criticized may in- see the bad and the good will pass them by. ders since the inception of man (and woman) as portrayed clude tales from the past and they will continue to happen - Elaine Ashfield Pandemic or not, gov’t must be accountable By Murray Mandryk politicians get that more than we Political columnist do because they love to beat their opponents over their heads when accountability doesn’t happen. No government has ever been a That was surely the case when paragon of virtue when it comes to Moe has rightly criticized the fed- being unaccountable to taxpayers. eral government and Liberal Prime And during a global pandemic Minister Justin Trudeau for not de- when governments have to address livering a budget during this pan- deadly health concerns on very demic. short notice, sometimes time-con- But maybe Moe and his current suming protocols of accountability Saskatchewan Party administration have been put aside. need to take a long hard look in the We do elect governments to mirror when it comes to their own make choices and not every choice fiscal accountability during this they make can be make through a pandemic —especially, given the referendum that determines what’s history of their party and its prom- most popular. ises of accountability. In fact, the sharpest criticism That commitment came in the Premier Scott Moe has received form of the Sask. Party’s biggest during this pandemic has been for 2007 election promise that: “A Sas- worth reminding overly sanctimonious New later than usual, meaning there will be that simply following the closed-door ad- katchewan Party Government will Democrats that their love to remind voters much legislative scrutiny by the time the vice of Chief Medical Health Officer provide Saskatchewan people with on the history of PC accountability that the assembly’s sitting ends just before the May Dr. Saqib Shahab who has recom- more transparency and accountabil- last NDP government shared sure had its long weekend. mended closures and lockdowns. ity than any previous government.” own penchant for unaccounted – for back- In the meantime, we will simply be spend- But when it comes to spending There was a reason why the room deals to buy money-losing U.S. dot.com ing money through cabinet decree, including public tax dollars, there can and Sask. Party made such a bold, and to deceive the public on the ownership a recent one to increase spending on the pan- should be very little compromise strong commitment. arrangement of Spudco that lost $36 million. demic to $322.8 million. on accountability. It was a party that rose from the This was also taxpayers’ money. Maybe there’s little nefarious about this, We all should get that. ashes of the old Progressive Conser- But this is precisely why we hold legisla- given that it’s extra money for the Safe Even during this pandemic, vative government — undoubtedly, tive sessions and budgets. School Plan ($40 million), the Saskatchewan you have received itemized bills the least accountable government The Saskatchewan legislature has sat just Health Authority, ($76 million), the Saskatch- on things you have paid for. And in our province’s history if not the eight days — the least in the country — since ewan Small Business Emergency Payment whether or not you can come in history of the entire country. It it passed the 2020-21 budget in mid-July. (And Program ($20 million), tourism ($17 million) close physical contact with your didn’t even pass its last of nine con- you may recall that the Sask. Party govern- and Municipal Grants ($14 million). supplier, you have maintained the secutive deficit budgets that left the ment did try to sneak in a “budget” in March But it’s still our money and spending right to be able to ask why each province in chaos and on the brink with no revenue projections or deficit figure needs to be accounted for in the legislature item on that bill cost as much as of bankruptcy. that turned out to be $2.4 billion.) in a thorough way. it does. Again, no government has ever Now, the Sask. Party government has set Governments should never be allowed to Politicians get that too. In fact, been perfectly accountable. It’s the 2021-22 budget date for April 6 — a month forget that.

SUBSCRIPTION RATES: All subscription expire Dec. 31. Pick-Up Boxes: Prices shown are based on one full year. $37.80 per year Subsciptions will be pro-rated. Mailed in Saskatchewan: Melville Advance, Whitewood Grenfell Herald Sun, Fort Qu’Appelle Times Chris Ashfi eld Tammy Oryschak Michelle Walz Lloyd Schmidt Pat Gattinger Prices include GST. Publisher Accounts Advertising Production Classifi eds $50.40 per year Issued Fridays by Grasslands News Group from the office Make cheques payable to Grasslands News Group at 218 - 3rd Ave. West, P.O. Box 1420 Melville, SK., S0A 2P0 Send e-transfers to [email protected] Mailed in Canada: Ph: 306-728-5448 • Fax 306-728-4004 • Whitewood: 306-735-2230 $70.00 per year

Toll Free: 1-844-GNG-NEWS Electronic Edition: www.grasslandsnews.ca • [email protected] $37.80 per year

Wendy Krobath Emily Fulford Elaine Ashfi eld Sarah Pacio Alan Hustak © Copyright (c) News and advertising content of this newspaper are protected by copyright. Offi ce Assistant Melville Whitewood Grenfell Fort Qu’Appelle 2020 There may be no reproduction of content without permission of the publisher. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 7 Municipal Asset Management Program Communities receive $50,000 for asset management

By Chris Ashfield increasing local asset coast to coast to coast frastructure help smaller Minister for Women and suring communities have Grasslands News management capacity that help municipalities communities to grow, Gender Equality and potable water to internet through investments in in Saskatchewan do what strengthen their econo- Rural Economic Develop- access to park spaces re- activities such as asset they do best: deliver solu- mies and improve quality ment. quires good planning. The Several local communi- management training, tions that work,” said of life for their residents. Minister Jim Carr, 30 projects announced ties are amongst 30 from technology and software Garth Frizzell, President, Through projects like Special Representative today ensure Saskatche- across Saskatchewan that enhancements and infor- Federation of Canadian those announced today, for the Prairies on behalf wan municipalities have will receive funding to mation sharing. Municipalities. our government is help- of Catherine McKenna, the tools and technol- help develop a solid asset “Municipalities of all Five of the commu- ing to ensure that local Minister of Infrastructure ogy necessary to make management foundation sizes are Canada’s build- nities to receive money leaders, especially those and Communities, said well-informed decisions and provide a clear direc- ers. They own nearly through the MAMP fund- in rural areas, have the that the COVID-19 health for the long term. Cana- tion for the foreseeable 60 percent of the public ing includes the RM of tools they need to plan crisis has reinforced the da’s infrastructure plan future. infrastructure that sup- McLeod, RM of Martin, for the long-term and importance of infrastruc- is resulting in thousands The funding, which ports Canada’s economy Village of Stockholm and creating stronger rural ture that supports safe, of projects, creating jobs totals $1.39 million, is and quality of life. With towns of Lemberg and communities now and sustainable and healthy across the country and being provided by the strengthened asset man- Wolseley. Four of the for generations to come,” communities. building stronger com- Federation of Canadian agement practices, they communities will receive said Maryam Monsef, “Everything from en- munities,” said Carr. Municipalities through are making infrastruc- $50,000 with the RM of the Municipal Asset ture investment decisions McLeod receiving $44,838. Management Program based on sound and reli- The RM of McLeod, (MAMP). The program able data. Supported by RM of Martin and Town aims to strengthen local our strong federal-munic- of Lemberg will all use infrastructure planning ipal partnership, FCM is the money to develop an and decision-making by delivering programs from asset management plan while Stockholm will also develop an asset manage- Fenwood Community Centre ment system focusing on water and sewer testing St. Patrick’s Day Supper analysis. The Town of Wednesday, March 17 Wolseley will use their funding for an asset man- Pickup: 4:30 - 6:30 p.m. at the Fenwood Community Centre agement framework and Pre-order ONLY - E-Transfer Accepted – [email protected] system project. Option 1 - Veg. Soup, Irish Soda Bread, Roasted Potatoes, “Rural communities Cabbage and Onions, Corned Beef, Dessert or $ are the backbone of the Option 2 - Veg. Soup, Irish Soda Bread, Shepherd’s Pie, Dessert. 15.00 Canadian economy and Call or Text: 306-730-9643; 306-690-8509; 306-621-1265 among the best places Delivery Available - All COVID protocols must be followed in Canada to call home. Proceeds to the Fenwood Community Centre Smart investments in in-

21021jj0

Join Grasslands News 12,000 weekly readers

SUBSCRIBE TO THE FOLLOWING: ❑ Melville Advance ❑ Fort Qu’Appelle Times ❑ Whitewood/Grenfell Herald Sun

Name:

Address:

Town/City: Prov: ✁ ✁ Help to build a stronger community! Postal Code: Phone:

Email Address: WHY SUBSCRIBE? • Stay informed about your community. Payment by: ❑ Visa ❑ Mastercard Expiry • You support local businesses who support you back. ❑ Cheque or Money Order (enclosed) Signature • The newspaper is the community’s only historical record. Please make cheques out to Grasslands News Group Telephone Orders: 306-728-5448 (ext. 227) • A viable newspaper shows a strong community. • It’s less than buying one cup of coffee per week Forms should be mailed to Grasslands News Group, Box 1420, Melville, SK., S0A 2P0

-$0f<6<#9$8-6ধ32 !90W<#9$8-6ধ32 !2!&!<#9$8-6ধ32 Subscribe TODAY! ‚ŠˆWŒ‡ ‚‹‰W‡‡ ‚Œ¥W‰Ž

CALL US TOLL FREE AT 1-844-464-6397 (EXT. 222) 838!;'&8!;'9(389<#9$8-6ধ3299;!8ধ2+-2!2W‰‡‰ˆ;,3<+,;3'$WŠˆT‰‡‰ˆW  2$£<&'&W 8 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Regional Library News By Elaine Ashfield memorable characters in literature, the you celebrate spring by creating your Southeast Regional Library branch ver- Grasslands News library is encouraging people to use own piece of home decor. The kit comes sus purchasing books or items. their imaginative nature to create daf- with a wood slice, stencil, paint and “Despite being closed for several fodils and rainbows and pieces of home- paintbrush. months because of the pandemic, li- “Spring is the time of plans and Librarian Erica Duncan also reminds brary users in our area saved a total of projects.” – Leo Tolstoy, Anna Karenina made wood decor. you though, “Limited supplies so be $95,243.71 by accessing physical library Just as the quote by the famous All month – pick up a Take & Make quick!” books, DVDs, audio-books and video writer Tolstoy says, Whitewood Library Craft Kit to try out at home. The Chil- The Book Club this month is focusing games!!! librarian Erica Duncan reports. is welcoming everyone to join them in dren’s Program is offering daffodil and a rainbow mobile for children to make. on Brain on Fire: My Month of Madness “In total, Southeast Regional Library pa- their March plans and projects to wel- by Susannah Cahala. New members are All that is needed is glue, scissors and trons saved a combined total of $5.3 mil- come spring. always welcome. While Tolstoy uses his intense imagi- something to color with. lion dollars!!!! And this DOESN’T even “Maximum of five people can meet in native insight to create some of the most The Adult & Teen Programs will help include accessing all the awesome stuff the branch and people are welcome to from our electronic catalogue, so you all ‘zoom’ in too,” Duncan says. If you need actually saved more than this!!! librarian Mal Heard. That includes vir- assistance be sure to let her (librarian) “Just goes to show that libraries are Fort Qu’Appelle Library tual story time for children with Ruth know. still relevant, especially in our commu- By Alan Hustak LaForge each Friday, craft shows and The Southeast Library at Whitewood nities. Want to beat this number for Grasslands News crochet classes on Thursdays. offers many e-resources if you can’t visit 2021? Come visit us in person or online The library now includes an art gal- in person. E-resources are free with to get all the details about what we can lery that will highlight works by local Circulation at Fort Qu’Appelle’s pub- your library card and provide you with offer you FOR FREE!” artists. Its first exhibition features paint- lic library dropped by 40 per cent last such wonderful connections as Hoopla The Annual General Meeting was ings by Sharon Labatt. year because of the COVID-19 pandemic. (movies, music, TV shows, audiobooks), held on Feb. 9 with board members Eva It costs $53,000 to run the library each But while it was closed the library was Libby (eBooks and eAudiobooks), Audio- Davis, Irene Blyth, Julie Merrett, Aaron year. The town pays for its electricity repainted and is open again to 11 visi- BookCloud (eAudiobooks), Creativebug Jorgenson, Crystal Schaan and town and heating bills, but the board depends tors at a time. “Checkouts went down to (thousands of online arts & craft classes), representative Chris Ashfield attending on fundraisers to supplement its pro- about 7,400 from 11,000 in 2019 because PressReader (newspapers & magazines), with librarian Erica Duncan. gramming. we were closed for several months,” said Flipster (magazines), and Tumble Books The library recorded an income of “At the moment Kathy’s Kitchen is regional branch manager James Rich- (interactive children’s books). $8,311 and expenses of $10,203 in 2020 re- selling perogies and cabbage rolls as ards, “But e-books shot up quite a bit.” The Whitewood Library is open Tues- sulting in a yearly loss of $1,892. This a fundraiser. We have other ideas, but It continues, however, to offer a full day (10 a.m. - 1 p.m., 2 p.m. - 5 p.m.), loss was the result of $2,802 in renova- we can’t do much until program of activities for Thursday (5 p.m. - 8 p.m.), Friday (10 tions that took place while the library after COVID” explained a.m. - 1 p.m.) and Saturday (1 p.m. - 5 seniors, adults and chil- was closed for the pandemic. Library Board President p.m.) and follows the Saskatchewan dren on face book and There were 59 programs in 2020 with Jill Whiting. “We have health regulations for COVID-19 for your on zoom. (You can call an attendance of 402 people despite being a five-year strategic plan safety. the library at 306-332-6411 closed from April to June due to COVID to give the library a face To get more information about the li- for the zoom link) This and reopening in August. lift. Redoing the floor is brary’s programs and services, you can month the library is cel- Other focuses for 2021 will be more our next big project and also call 306-735-4233 during open hours, ebrating Dr. Suess, the virtual programming, programs for we will be reaching out email [email protected] illustrator and author of other groups such as long term care res- for sponsors who might more than 60 children’s Whitewood Library AGM idents to provide things such as crafts books who was born on be able to help us pay for The Whitewood Library continues to and audio books. Also being looked at is March 4, 1904. that.” see an increase in the number of items a puzzle and board game exchange, set- “We offer a whole vir- The library also ac- checked out of the library each year. By ting up Little Free Libraries in town and tual program, nothing in cepts cans and bottles to the end of December, there had been adding a virtual story time. house, but the building help raise money. Contri- more than 500 items checked out com- The budgeted expenses for 2021 are itself is open to those who butions can also be made Storyteller Ruth Laforge pared to about 400 in 2019 and 300 in $9,670 with $2,800 in renovations is in- want to check out books by registering through reads each Friday at the 2018. cluded. The library will also budget ap- or use our computers SARCAN’s Drop and Go This means a lot of people saved a lot proximately $200 a year to set aside for and printers,” said chief )RUW4X·$SSHOOHOLEUDU\ program. of money by using the services of the future renovations or repairs.

BOOK YOUR      
    RENTAL
          EQUIPMENT ! !$"$ "#!$#"$!$ TODAY!    $ $
$$ $ •329;8<$ধ32   $ $  $ •'9-&'2ধ!£ • !81   $ $ $ • DIY projects  
 
 316£';'-2='2;38@!;V
 





 )8'*@f8'2;!£9W$!c-2='2;38@
    
 Call or email us for equipment      pricing and availability.
   K
    Š‡¤f¤ŽŒfŠŒŠŒ
       
 >!88'2|)8'*@f8'2;!£9W$! 
       2&-!2 '!&T!90!;$,'>!2
     >>>W)8'*@f8'2;!£9W$!
   
      
         
  
 %'K+!(!)K%*'K,(!)K)KHHH >62E@1D /A=K www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 9 Telemiracle 45 Gene Hauta Bequest pushes total to $5.6 million It’s A Strange World At Concordia University, Aaron Ansuini took By Chris Ashfield ers of Telemiracle and were both The broadcast featured no live an art history class online. He found Professor Grasslands News deeply touched by the stories of audience this year with most live Francois Gagnon to be knowledgeable and in- people facing medical challenges - appearances by remote video. Na- teresting. Searching online for Gagnon’s contact especially the little children. This tional cast hosts were live in-stu- information, Ansuini was shocked to discover that A bequest worth nearly $1 mil- inspired them to plan a generous dio, with physical distancing his teacher had died two years ago. The stu- lion from an Ituna couple helped donation to the Kinsmen Founda- in-place. Content for the show was dent was shocked that the school never thought to push Telemiracle 45 to its third tion to help create a lasting legacy pre-recorded over many months mention that fact to students. Under a collective highest fundraising total ever of help and hope through TeleMira- leading up to the telethon. agreement, Concordia has a 10-year license for any when the annual telethon was held cle. The couple donated $967,278.08, All TeleMiracle proceeds stay faculty member’s work, justifying the use of Gag- on Feb. 27 and 28 in Saskatoon. which accounted for 17 per cent of in Saskatchewan and are granted non’s course after his death. Despite changes and challenges I found this interesting as Valentine’s Day came the funds raised this year. through the Kinsmen Foundation due to the COVID-19 pandemic, the and went. Now, please note, I have never had the There was also a large bequest for specialized medical and mobil- final numbers on the video tote urge to do this in my marriage. An animal shelter from Fort Qu’Appelle resident ity equipment, and assistance with board showed a total of $5,630,215 in Lexington, Ky., is allowing people to get what Douglas Smithson, who was born medical travel. The Foundation re- raised at the end of the 20-hour they call “retripootion” for broken hearts by hav- in Indian Head. Smithson, who was ceives over 1,000 applications for event. With this year’s generosity a World War 2 veteran that served ing the names of people’s exes inscribed inside of added, the total raised by TeleMir- assistance from Saskatchewan res- litter boxes that are used by its cats. For just $10, in the Royal Canadian Navy from idents each year. acle since 1977 is now over $145.7 1942 to 1945, was an avid fan of anyone can symbolically get back at their former One of the many highlights of million. the Saskatchewan Roughriders partners by having cats take a dump on their this year’s show were the 75 tal- “The generosity of Saskatch- and loved TeleMiracle. Following exes’ names. The promotion ap- ented Saskatchewan performers ewan people is amazing and it his death in 2019, just 20 days shy propriately named “Dups for who appeared throughout the tele- showed again this year in their of his 97 birthday, he left a gift of the Dumped.” On Facebook, thon and on the Countdown to Tel- support of TeleMiracle,” says Tel- $21,518.84 for Telemiracle. the service is proclaimed this eMiracle pre-show, streamed live eMiracle 45 Chair Brian Angstadt. Other large bequests during way. “Cats can be spiteful “Once again, TeleMiracle brought the telethon included one for on telemiracle.com. Not only did creatures, and trust us, they our province together and the im- $367,915.70 from William Stewert of these acts showcase the breadth are more than happy to take a pact of these donations will be felt Melfort as well as two $50,000 ones of talent from every corner of the #2 on your former #1.” across Saskatchewan during these from Harlow Gough of Welby, near province, they also raised money In an effort to get his times when residents need it the Spy Hill and Hazel Bernhard of for the telethon – which was once street plowed of snow, a most”. Madge Lake. George Wilson of the again matched by Nutrien, who Ukrainian man called The only two years exceeding Insinger district also left $10,000 to presented their donation of $100,000 police and told them this year’s total were in 2018 when Telemiracle. live by remote video just before the that he murdered his $7.15 million was raised and in 2012 Due to COVID-19, TeleMiracle end of the broadcast. mother’s partner. The city when $5.9 was raised. The telethon 45 changed to a new format that TeleMiracle reminds those that of Chernihiv in northern Ukraine was blanketed has raised $5 million or more in 10 was blended with old traditions made pledges during the telethon to in about two feet of snow when the call came in. of its 45 years. with new technology. This year’s honour them by mailing their do- The unidentified man even told the police to come The highlight of this year’s final tote board total included the nation to Box 83000, Saskatoon SK, with a snowplow or they would not be able to get event was a massive bequest from proceeds of TeleMiracle’s first-ever S7K 9S1. Planning begins shortly to his house to investigate. Apparently, he under- Walter and Gene Winniski from online 50/50 raffle, which generated for TeleMiracle 46, to take place in estimated the situation as the police simply drove the Ituna district. The couple, who total tickets sales of $726,120 with 2022 in Regina. Details leading up to his house in an SUV, finding everyone alive and began their own farm after mar- the winner taking home half of the to next year’s show will be posted well. The man admitted his ‘lie’ and was fined 119 rying in 1959, were faithful watch- jackpot total. at www.telemiracle.com hryvnias ($5 CDN) for false reporting. It is rumoured that about 50 former Republican officials are upset enough to consider forming what would be a major third American politi- RE-OPENED cal party. It would serve as a counter to a GOP Melville Community Works TO THE PUBLIC! “under the thumb of a wannabe autocrat”. I don’t know enough about the strengths and weaknesses • Thrift Shop open - Tuesday and Thursday 12 - 4 p.m. of the two-party system to comment too much on • Gift Shop open - Tuesday and Thursday 1 - 3 p.m. this center-right party that would focus on adher- • Kidsville opening to be determined ence to the Constitution and rule of law. During Trump’s time in office, it was pretty clear that • Canadian Mental Health Association - Melville Branch “large portions of the Republican Party are radi- - Meeting 1st Wednesday of every month 7 p.m. calizing and threatening American democracy.” • Magic Moments Playschool is currently full and accepting names for www.prairiecoop.com Some believe the GOP is “irredeemable”, and the 2020 - 2021 school year wait list. Please contact Chantel Fahlman www.facebook.com/prairiecoopretail others believe that the Republicans will only be for more info at 306-730-6272 or via Facebook messenger. Sponsored by Prairie Co-op a force with Trump at its helm. The breakaway party is being called the Trump Party right now. The seven House Republicans who voted to im- peach Trump have been abused since the hear- ing. The Pennsylvania GOP censured Pat Toomey for voting ‘guilty’. One Republican Party official grumbled, “We did not send him there to vote his conscience... we sent him there to represent Store us.” I guess they need reminding that Pennsylva- nia went blue for Biden. Ten members of Adam Kinzinger’s pro-Trump family disowned him, call- For everything OUTDOOR! ing him “an embarrassment to God.” A Bavarian court found a folk singer guilty of violating Germany’s strict child-labor laws for having his 4-year-old son perform onstage with him during an evening concert. Angelo Kelly, 39, See our store today! was fined $3,600 after his son William, sang “What a Wonderful World.” In total, William was on Start you next outdoor adventure stage for about a half-hour, but it was considered “work by the Youth Labor Protection Act.” Kids >-;,<9R';T$!16-2+T)9,-2+T ages 3 to 6 can take part in musical performances under German law for up to two hours a day, but ,<2ধ2+9<66£-'9!2& W only with official approval, and only between the hours of 8 am and 5pm. £939''<9(38!££3(@3<8>-2;'8 Police stumbled upon a drinking gathering >'!8!2&>380>'!82''&9W in Lancashire, England with the unusual grouping of 10 people and two sheep. Cops say the “bizarre find” came while cracking down on restricted gatherings as the COVID-19 lockdown continues. There was a full working bar, pool, and foosball tables along with a large television. The report clarified that 10 fines were handed out to those individuals. “It’s not known whether the startled sheep were fined.” A British woman, who pretended to have cancer in order to make money from Good Samaritans, has been sent to jail. Nicole Elkabbas, 42, who used to consult for high-end department store Har- rods, made more than $70,000 U.S. from nearly 702 Lalonde St., Whitewood, SK 700 people via a GoFundMe campaign. Elkabbas allegedly used the cash to pay off gambling debts and go on trips. She was shocked when sentenced 306-735-2560 to two years and nine months in prison. Keep reading between the lines… 10 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Vaccination booking coming; local outbreaks announced

By Elaine Ashfield thing we found out is those lists aren’t ment-procedures-and-guidelines/ mined a notification of the broader pub- Grasslands News complete,” Livingstone said. This led to emerging-public-health-issues/2019-nov- lic is required to inform individuals who the decision to move to the self-booking el-coronavirus/covid-19-vaccine/ may have attended a location or business system. vaccine-delivery-phase #how-to-get-im- to immediately self-isolate and seek test- People will be able to book an appoint- “We’re not going to miss people. We munized. ing.” ment for their COVID-19 vaccine in the will make sure that we don’t and once The rate of vaccinations continue to The following three key criteria deter- near future. This will include the people you are qualified, you qualify for vacci- depend on the number of vaccine doses mine whether the local medical health of- in Phase 1 who are eligible and have been nation throughout the entire time frame, becoming available to the country and ficer deem a PSA necessary: all contacts questioning why they have not received including Phase 2.” the province each week. cannot be notified within 48 hours, there a call or a notification for vaccinations. is a resulting increased risk to the pub- At present, those 70 years old and older Both online and phone booking will be Is COVID in your community? available when the new system is com- lic, and the direction is needed for public eligible for a vaccine are being contacted Cases of COVID-19 have declined pleted in the upcoming weeks. members in attendance to immediately by age according to government vital slightly in Saskatchewan but still appear Saskatchewan Health confirmed with self-isolate as a result of this increased statistics and health information. Then to have the highest number per capita Grasslands News that if people would like risk,” read the statement. last Thursday, CAO Scott Livingstone provincially. As vaccines slowly trickle to check their health card registration in- Public alerts are posted on the Saskatch- announced the government will instead into communities, medical health officers formation, they can go online to: www. ewan Health Association website at https:// transition to self-booking for seniors eli- continue to remind people not to disre- ehealthsask.ca/residents/health-cards/ www.saskhealthauthority.ca/news/public- gible under Phase 1 of the province’s vac- gard the public health orders that con- Pages/Update-or-Replace-a-Health-Card. health-alerts/Pages/default.aspx. cination plan which could be happening tinue to be in place. Outbreaks listed on the site for the aspx or the phone number is: Toll Free: as early as next week. COVID-19 is everywhere and self-mon- last week in February include: Esterhazy 1-800-667-7551 (Canada and US). Until the self-booking system is up and itoring is as important as ever. Residents - Industrial Scaffold Services, Mosaic K1 Information regarding the vac- running, eligible people will continue to will not be hearing or reading of public Mine Site, listed Feb. 25, 2021 and Kah- cination process in the province is be contacted. service announcements (PSA) when a kewistahaw Gas and Convenience Store available at www.saskatchewan.ca/ “We had been using lists that have case of COVID-19 is confirmed in a public listed Feb. 20, 2021, both as workplace government/health-care-administra- been generated through vital statistics place. The announcements are placed on outbreaks. Ochapowace remained listed and health card registration, and one tion-and-provider-resources/treat- the SHA website for people to check and at the end of February as well as a com- the media to pick-up from there. munity outbreak that had been desig- Saskatchewan Health states that these nated on Feb. 10, 2021. “COVID-19 PSA alerts … will only be Outbreaks remain listed until offi- issued at the direction of local medical cially declared over by an SHA Medical 2-7<' ;'19 health officers when they have deter- Health Officer. 38 ='8@32'R House fire and spray paint mischief

Sgt. Travis Adams RCMP and EMS responded to a snow- Melville / Ituna Detachment mobile accident near Grayson. The lone rider of the snowmobile transported to Melville hospital for observation. Reporting period: Feb. 24 to March 3 Mischief/Theft/Assault/Fraud Melville and Ituna detachment dealt A security company contacted the with 56 occurrences over the past week. RCMP to report Melville Fire was at-       tending a fire at a residence in Melville. Fresh wildflower honey. Available in various sizes. Traffic     The homeowners were not home at the  During this time, Melville and Ituna time and no injuries as a result of the Avon products of all kinds: bubble bath,    detachment responded to 29 reported oc- fire. The interior of the residence had perfume, creams, all your favourites. Pampered Chef products and gift baskets. currences or traffic stops that resulted spray painting mischief. RCMP con- {       in 14 Charges and 10 Warnings. tinue to investigate. Vacuum bags and accessories. Water colour paintings. RCMP responded to a single vehicle A woman contacted RCMP to report   Һ    collision at a business in Ituna involv- a hit and run to her 2016 GMC Canyon  W Handmade Jewellery. ing power lines. No injuries resulting of while parked at a business in Melville. A selection of handcrafted earrings. the accident. RCMP continue to investigate.           Assorted Bison meat products: burger, sausage and Natural, minimally processed honey. jerky. Available in various sizes.  Z  Contractors and Home   Handmade Tree of Life Hangers and necklaces., Flavoured honey and honey sticks. night lights and home decor.  Һ           Vacuum bags andfilters. Directory Headbands, touques.    Crystal jewelery.     Local producer of eggs, flax & wheat for baking or    cooking, wheat bags for muscle discomfort. Live edge wood sign decor. Carved and handpainted. Custom orders available.    J&V ELECTRIC Local author who lives in the Melville area. Adult     andchildren’s books including: “Touched by Eterni- Custom made mats. ty”. Jamie Sebastian Made for home or commercial use.    Owner/Journeyman   Men’s and women’s sports wear. TREE SERVICE Box 2388, Fort Qu’Appelle, SK S0G 1S0 Ladies, men’s and children clothing lines.    [email protected]  Z   Handcrafted jewelery. 306-331-8742 - 306-331-8732 3062I¿FH Handcrafted wooden vehicles, jewelry boxes.     Fort Qu’Appelle, SK 306-331-8827 Cell   Toys and more, mini figurines. Variety of handmade goat soaps. www.whitingtreeservice.ca Serving Fort Qu’Appelle and area for over 25 years        Z Assorted handcrafted driftwood decor, gift ware Homemade jellies available in small jars or gift packs. and furniture. Great for the cabin, office or home.       Wreaths, wall hangings, purses, scarves.      Personal care products. Eco friendly home, bath, FlatLand  Z     body and spa products, just for you. Hats and mittens. Plumbing & Heating     117 - 3rd Ave. West, Melville, SK           Elastic silicon key chains. Necklaces, Christmas decorations, ashtrays. 306-728-5493   ž,'#8!2&9@3<023>W        Whitewood, SK. ž,'9'8=-$'@3<;8<9;W Author of “An Exodus to a Land of Promise”. 2-Ply face masks, ear savers, wallets Phone: 306-735-4328 ž,'=!£<'@3<&'9'8='W    c   and dream catchers. Assorted lip, cosmetics and body care products. Mon., Tues., Wed. & Fri. 9:00 a.m. to 5:30 p.m.      [email protected] Thurs. 9:00 a.m. to 6:00 p.m., Sat. 9:00 a.m. to 3:00 p.m.    Beaded Swarovski jewelery. Hand designed decor and clothing.         Large variety of wears. Clothing, mittens, neck Giftware and outdoor decor for any season. warmers, masks, handbags and more.   Z     Һ    Premium scented natural wax candles. Large selection of your favourite Watkins products. Assorted scents. Whitewood, SK   Enviro-friendly products for home cleaning and personal care. Located in the Melville Advance OPEN: Monday to Friday 218 - 3rd Ave. W., Melville, SK 9 a.m. to Noon and 1 to 4:30 p.m. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 11 PVSD begins budget process for 2021/2022 By Patricia Hanbidge By Sarah Pacio support this increase. Grasslands News Work within local school facilities Chores for early spring! has included pandemic-related modifi- cations and equipment deliveries. This The Prairie Valley School Division  31'ধ1'9-;9''19;,!;>-2;'89!8' 23;<9'W,''?68'99-32968-2+$£'!2f<6-9 £32+W,-9>-2;'8>-;,;,'$3£&>'!;,'8 +'2'8!££@1'!2;;3#'(38@3<8+!8&'2g (PVSD) Board of Education met last included the acquisition and installa- ;,!;£!9;'&!132;,!2&>-;,23$,!2$' #<;(381'g-;-9(38'='8@6!8;3(1@ month to share updates on activities tion of washers, dryers, and plexiglass requested by various schools. The di- 3(;!0-2+3ø(38>!81'8$£-1!;'9T-;1-+,; 6836'8;@R ;-99<$,!+8'!;(''£-2+;3&-9f within the division and discuss plans have been a long one for many. However, vision recently received shipments of 639'3($£<ħ'8R for the future. 23>;,'&!@9!8'+'ষ2+£32+'8!2&;,'  (@3<9ধ££,!='23;&32'@3<8968-2+ water fountains, bottle-filling stations, At the meeting, the Board granted 1'8$<8@-21!2@£3$!ধ329-932;,'6£<9 68<2-2+g@3<9ধ££,!='!£-ħ£'#-;3(ধ1'W the request of Wolseley SCC to create boot racks and lockers that will be in- 9-&'3(A'83R,!;;,!;1'!29-9968-2+-2 8@23;;31-99;,-9$,38'!9;368<2' independent councils for Dr. Isman stalled in a timely manner. Escalated 32;,'>!@R £!;'8-2;,'@'!8-923;-&'!£(38139;3( Elementary School and Wolseley High sanitization measures and disinfection  ;-9;,'£!9;$,!2$';3+';6£!22-2+32 3<8>33&-'9W,'8!6-&+83>;,3(968-2+ School. The Board believes in the value procedures continue throughout all fa- >,!;-9+3-2+;3,!66'2-2@3<8+!8&'238 >-££'29<8';,!;!2@>3<2&9$!<9'&#@ of each school being served by its own cilities. £!2&9$!6';,-9+83>-2+9'!932g'96'f 68<2-2+>-££,'!£3='87<-$0£@;,<98'&<$f SCC, recognizing the unique needs of In 2020, PVSD schools displayed $-!££@-(@3<!8'+3-2+;3#'1!0-2+!2@ -2+!2@$,!2$'3(&-9'!9';8!29('8W'f each school community. Next steps in- ingenuity and creativity in providing 8!&-$!£$,!2+'9;3@3<896!$'W (@3<£-0' 1'1#'8;,!;-;-923;!+33&-&'!;3&3 ;39;!8;@3<83>29''&9T@3<1!@,!='!£f $!;$,<668<2-2+#<;-29;'!&;3&3!£-ħ£' clude making a request to the Ministry students with meaningful graduation 8'!&@38&'8'&;,'1386'8,!69!£8'!&@ #-;'!$,@'!8W323;8'13='138';,!2 of Education for approval. celebrations. Schools are already con- !8'>!;$,-2+;,'1!+-$3(ধ2@£-ħ£'9''&9 32';,-8&3(;,'$!236@-2!2@+-='2@'!8W As anticipated, reading, achieve- sidering how to safely execute cere- #'$31-2+6£!2;9;,!;>-££+8!$'3<8+!8f  (@3<,!='!2@;8''9389,8<#9;,!; ment and credit attainment results monies later this year in a way that &'29$31'!@W 2''&13=-2+T;,'2!9£32+!9;,'93-£-9 have been negatively impacted by the is compliant with provincial health  (@3<!8'8'!&@;3+';+!8&'2-2+T;,'2 23;;33>';#<;-9(<££@;,!>'&;,'2;,-9 pandemic. Learning gaps arose from orders and possible COVID-19 restric- -;1-+,;#'ধ1';3'!9'-2;3;,'+!8&'2f -9!+33&ধ1';3&3;,-98!;,'8#-+$,38'W interruptions to optimal learning con- tions. -2+$,38'9W8@23;;33='8&3-;!££!;32$' ,'#<&9,!='23;@';#<89;9313=-2+ ditions. For the remainder of this year The number of self-declared Indig- !9+!8&'2-2+1<9$£'9,!='#''28'9ধ2+ !2@;,-2+!;;,-9ধ1'>-££#';,'£'!9;8-90@ and next, Administrators and Learning enous students enrolled remains con- (38;,'£32+T$3£&>-2;'8W (@3<,!='23; ধ1'3(!££W'ħ'8@';T!2@;,-2+@3<13=' 0'6;<6@3<86'8932!£6,@9-$!£);2'99 >-££,!=';,''2ধ8'+83>-2+9'!932;3+'; Support Teams throughout the divi- sistent at about 1,300. Graduation rates 9-2$'(!££T;,'2&3@3<89'£(!(!=3<8!2& 8''9;!#£-9,'&W sion are prioritizing efforts to support for Indigenous students continue to primary years’ readiness and reading >380-2;3+!8&'2-2+9£3>£@W!0'<9'3(  !0'@3<8£!>2!8'!9-(;,'@!8'&8@ trend upward within the division, and ;,39'£3='£@1382-2+9!2&'='2-2+9+3-2+ '23<+,W ;-9!1!A-2+,3>;,-991!££$,38' skills, essential outcomes in curric- remain significantly higher than the (38!#8-90>!£0l>,'8';,'-$',!91'£;'&m 8'!££@968<$'9<6;,'£!2&9$!6'W ;9''19 ulum, and credit attainment for high provincial average. (3££3>'&<6#@931'9-16£'9;8';$,-2+ ;,!;;,'+8!99!8'!9;<82+8''23='82-+,; school students. COVID-19 concerns remain ongo- '?'8$-9'9WWW<9-2+3($3<89';,39'9!1' 32$';,'@,!='931'3(;,!;;,!;$,8'f September’s initial enrollment of 400 ing but the board has participated in 1<9$£'+83<69@3<>-££<9'!££9<11'8 13='&W ;-9!#-;'!8£@;3('8ধ£-A'>-;, students in the Remote Learning pro- learning opportunities and provincial long in the garden. $32='2ধ32!£-238+!2-$('8ধ£-A'89!9;,!; gram was reduced to 360 by January 1. planning sessions to prepare for edu-  9;,'923>8'$'&'9!2&;,'93-£&8-'9T >-££'2$3<8!+'(!9;+8''2+83>;,;,!;-9 As the second semester began, this rose -;-9!+8'!;ধ1';3$£'!2<6;,'#38&'89W 9<9$'6ধ#£';3£!;'968-2+(839;9W cation situations post-pandemic. In again with approximately 70 students !0'!>!@!2@&'!&6£!2;6!8;9T&-+3<;  !@$£39'!ħ'2ধ32;3!2@9''&£-2+9 February they worked with a member transferring to Remote Learning. Lap- !2@3ø'2&-2+&!2&'£-329;,!;9''1;3#' @3<,!='+83>-2+-29-&'W (@3<,!=' of NACTATR (North American Center tops and hotspots are being provided to !£8'!&@93+8''2#<;;!0'931'ধ1';3 9;!8;'&@3<89''&9>-;,3<;!&&-ধ32!£ students as necessary. Additional pro- for Threat Assessment and Trauma Re- 632&'8>,!;-9$31-2+<6W )2&;,!;'!$, £-+,;9!2&,!=';,'19-ষ2+32!>-2&3>f vincial funding enabled PVSD to hire sponse) and later provided Traumatic 968-2+ +';!('>9<868-9'9W,-2+99''1 9-££@3<>-£££-0'£@,!='23ধ$'&;,'1 ;3#'9683<ধ2+-26£!$'9>,'8'@3<$!2Z; 8'!$,-2+(38;,!;9<2W8@;3+-=';,'1!££ a full-time Learning Supports Teacher Events System Training to senior staff 7<-;'8'1'1#'86£!2ধ2+931';,-2+R  ;,'£-+,;6399-#£'!9-(@3<)2&;,'1 and a part-time Social Worker for stu- and school-based administrators. Budget development for 2021-2022 is +<'99;,!;-9>,!;>'$!££![968-2+ 8'!$,-2+(38£-+,;;,'9''&£-2+9>-££#'£'99 dents in the Remote Learning program. #32<9\R 9;832+!2&138'9<9$'6ধ#£';39;8'99'9 underway and further information will They will assist with curriculum adap-  ;-9!£93!+33&ধ1';3ধ&@<6;,' £-0'&-9'!9'W tations and mental health needs. be presented at the PVSD’s next board +!8&'29,'&38+!8!+'W,';'16'8!;<8'9  !66@68-2+R Increased internet connections at meeting on March 10. However, the !8'>!81'23<+,;,!;-;-923;!238&'!£ !2#-&+'-9;,''!& 38ধ$<£;<8-9;>-;,8$,-& schools meant the main internet con- provincial budget, and with it the di- ;3#'3<;9-&'(38£32+'86'8-3&93(ধ1'W 38ধ$<£;<8'W -2&<9!;>>>W38$,-&,38;W$31U nection for the division periodically vision’s funding package for next year, !0'!£330!;@3<8;33£9T$£'!2;,'1<6T #@'1!-£!;-2(3|38$,-&,38;W$31U32(!$'#330 reached full capacity. A request to will not be released until early April. 9,!86'2;,'1!2&+';8-&3(>,!;@3<&3 |38$,-&,38;!2&32-29;!+8!1!;†38$,-&,38; increase bandwidth from 1 Gbps to 2 This delay may require adjustments to Gbps was approved in November and various timelines for staffing and key Sasktel has upgraded infrastructure to planning for the 2021-2022 school year. LOOK HERE! You just proved even small ads get noticed. Call us toll free: 1-844-GNG-NEWS DGV#JUDVVODQGVQHZVFD

LANE REALTY ESTERHAZY - DFUHV%XQJDORZZVKHOWHUHG\DUGOLYHVWRFN IDFLOLWLHVYDOOH\WRSRJUDSK\ NEW - JEDBURGH -  DFUHV  FXOW  DVVHVV \DUGVLWHZZHOO FDWWOHVKHOWHU1:RI-HGEXUJK KIPLING -DFUHV·V%XQJDORZZDGGLWLRQDQGDWWDFKHG JDUDJHRQ+Z\*RRGHQ6KHG Һ    MELVILLE DFUHVFRPPHUFLDOO\]RQHG·[·VKHGOR cated adjacent to Melville! MOOSOMIN - DFUHVôVWRUH\ZVKHOWHUHG\DUGFRPPHUFLDO EXLOGLQJRQ+Z\ NEUDORF DFUHVWDPHKD\EDODQFHSDVWXUHYDFDQW   {   \DUGVLWHLQ4X·$SSHOOH9DOOH\ NEW - SALTCOATS DFUHVFXOWDVSOLD VHVVEXJUDLQVWRUDJH WHITEWOODDFUHVô6WRUH\OLYHVWRFNIDFLOLWLHVZEDUQV TXRQVHWVKHG WHITEWOOD -DFUHV  DFUHSDUFHOVRQHZLWKYDFDQW KRPHZHOOSRZHU 712 Lalonde St., Whitwood, SK – 306-735-4328 For all of your buying or selling needs.... Contact: DOUG JENSEN: 306-621-9955 OR JASON BEUTLER: 306-735-7811 515 Main Street, Kipling, SK – 306-736-5328 !&1-2|*!;£!2&6£<1#-2+W$! WITH OVER 39 YEARS IN THE BUSINESS PH: 306-569-3380 EMAIL: [email protected] www.lanerealty.com 12 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News 3 tips when reading CALEB VILLAGE Melville’s finest !££f-2$£<9-='8'ধ8'1'2;$311<2-;@ 680-7th Avenue East, Melville, SK nutrition facts labels INDEPENDANT LIVING SPECIAL PROMOTION ON NOW!

Much about trips to the grocery store has more than one serving size per meal, and that can changed since many adults were children. Many affect just how much of each ingredient, including SAVE $900 grocery stores are considerably larger than they ingredients like sodium that can be harmful if con- were as recently as 20 years ago and now sell ev- ˆ#'&83319<-;'9TŒŽ‹97WđWT‚‰ˆŽŒW‡‡£3$0'&-2 sumed in excess, a person is eating. (38@3<8)89;Š132;,9W8-$'-9‚‰‹ŽŒW‡‡!đ'868313ধ32W erything from traditional grocery store fare to 2. Pay attention to calorie count. clothing to items one might expect to fi nd in a Nutrition labels contain calorie counts, which hardware store. can help people maintain healthy weights. Being Another aspect of grocery shopping that has at a healthy weight has been linked to a reduced changed over the years is the groceries them- risk for various conditions, including type 2 dia- selves. Nutrition labels have been around for de- betes and cardiovascular disease. Nutrition labels cades, though today’s labels contain considerably list calories per serving, so people trying limit more information than they did in years past. As a their calorie intake to lose weight or maintain a result, many shoppers, even those who make sure healthy weight should pay particular attention to General Manager: Tracey Schuman to read product labels before placing items in their this information. shopping carts, may not know exactly what they’re 3. Let percent daily values guide you. buying. 306-728-2035 The AND notes that percent daily values, which Nutrition labels can be complicated, and ingre- Call for your personal tour and are listed as “DV” on food labels, help consumers dients that are benefi cial for some consumers may determine how particular foods fi t into their daily complimentary lunch! be harmful to others. Seniors and people with ex- isting medical conditions should always discuss meal plans. These values are based on a 2,000 cal- their diets with their physicians, asking if there orie per day diet, though some people may need are specifi c foods they should avoid or seek out. more or fewer calories than that. In addition, some In addition, the following three tips, courtesy of people may need more than the 100 percent recom- the Academy of Nutrition and Dietetics, can help mended daily value of a given nutrient. Consum- consumers understand nutrition labels and make ers should discuss their specifi c needs regarding sound choices. calorie and nutrient intake with their physicians. www.calebgroup.ca 1. Read the serving size information. For those advised to heed the daily values recom- Serving size information on nutrition labels mendations, ingredients that are listed at 5 percent indicates both the recommended serving size and DV or less are considered low, while those that are the number of servings contained in the package. 20 percent DV or higher are considered high. The Mature Living The AND recommends that consumers compare AND recommends aiming low for ingredients like the portion size they actually eat to the serving sodium, saturated fat and cholesterol, while high Watch for our next feature, April 2 size listed on the label. Some people may consume in vitamins, minerals and fi ber can be benefi cial. PICK YOUR LIFESTYLE

&KRRVHWKHOLIHVW\OHWKDWʹVWKHULJKWοWIRU\RX RU\RXUIDPLO\PHPEHU9LEUDQWLQGHSHQGHQW OLYLQJDQGVXSSRUWLYHDVVLVWHGOLYLQJDW

We’ve got what you’re looking for. Call or visit our website to book a virtual tour.

Riverbend Crossing Yorkton Crossing Memory Care Community Retirement Community 2235 Heseltine Rd, Regina 348 Morrison Dr, Yorkton 306-347-7773 306-782-0005

EspritLifestyle.com Independent Living Assisted Living | Memory Care

Photo taken prior to COVID-19. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 13

Healthy eating options at 50 and beyond

“Let food be thy medicine” is a aging due to factors like lack of variety quote attributed to Hippocrates, the in diet and reduced food intake. Eating ancient scholar considered to be the a variety of foods can provide all of the father of modern medicine. The saying nutrients people need to stay healthy relates to the notion that what people as they get older. Certain foods may be put in their bodies can heal and/or particularly helpful. prevent certain conditions. • Brain-friendly foods: Foods such For seniors with medicine cabinets as avocado, leafy vegetables, sunfl ower full of over-the-counter and prescrip- seeds, blueberries, and salmon are tion medications, the idea of relying good sources of vitamin E, antioxi- predominantly on food to promote op- dants, omega-3 fatty acids, and other timal health may be tempting, and var- nutrients that may help ward off de- ious foods can be particularly useful to mentias like Alzheimer’s disease, ad- the 50-and-over demographic. vises Sonas Home Health Care. According to the World Health Or- • Anti-infl ammatory foods: Foods ganization, poor diet is a major con- rich in omega-3 fatty acids may help tributor to many of the diseases that prevent infl ammation that can cause affect older people. Poor diet has been cancer and rheumatoid arthritis. connected to the development of diabe- Aging.com says foods that are high tes, and degenerative diseases such as in omega-3 fatty acids, like salmon, high in micronutrients, including a trointestinal tract thicken and diges- osteoporosis also may be linked to the should be consumed at least twice per variety of important vitamins that are tive contractions that push waste along foods ones eat. The National Council week. for Aging Care says micronutrient de- • Fruits and vegetables: Fresh, essential for all components of health. may slow down and become fewer. fi ciency is often a problem among the canned or frozen produce tend to be The Academy of Nutrition and Dietet- Foods rich in fi ber can promote proper ics advises eating dark green vegeta- digestion by moving food through the bles, such as leafy greens or broccoli, digestive tract mor easily. High-fi ber and orange vegetables, such as carrots foods also may help naturally reduce How to approach diet after a and sweet potatoes. blood cholesterol levels. • Energy-boosters: Choose whole • High-iron foods: Without enough grains that can provide sustained en- iron in the body, a person may feel diabetes diagnosis ergy by way of healthy carbohydrates tired and lethargic from a reduced pro- over processed grains. duction of hemoglobin, which carries • Bone-friendly foods: Calci- oxygen in the blood from the lungs Diabetes affects hundreds of millions sential for people with diabetes. um-rich foods, such as milk, yogurt to the rest of the body. A lack of oxy- of people across the globe, and more • Vegetables: Broccoli, carrots, and cheese, can prevent calcium from gen in body tissues from anemia can and more people are being diagnosed greens, peppers, and tomatoes are ex- being leached from the bones, which be serious, says the National Council with this often preventable disease amples of nonstarchy vegetables that contributes to conditions like osteopo- for Aging Care. Tofu, spinach, lentils, every year. make great additions to everyone’s rosis. pumpkin seeds, and fortifi ed breads According to the World Health Or- diet. These vegetables can be especially • Digestive system-friendly foods: and cereals are high in iron. ganization, 108 million people across benefi cial for people diagnosed with di- The digestive system slows down as Smart food choices can help seniors the globe were living with diabetes in abetes, as can starchy vegetables like 1980. In 2019, the International Diabetes potatoes, corn and green peas. the body ages, as the walls of the gas- live long and healthy lives. Foundation estimated that 463 million • Fruits: Diabetes patients can in- adults between the ages of 20 and 79 clude oranges, melon, berries, apples, were living with diabetes. Perhaps even bananas, and grapes in their daily diets. KRAUSECARE PHARMACY more troubling is that the IDF estimates • Grains: Whole grains should make that, by 2045, 700 million people will be up no less than 50 percent of diabetics’ living with diabetes. daily grain intake. Opt for whole-grain A diabetes diagnosis can be scary. breads, pastas, cereals, and tortillas. The IDF reports that people with diabe- • Protein: Lean cuts of meat, chicken tes have an increased risk of developing or turkey without the skin, fi sh, and an assortment of serious health prob- eggs are some examples of healthy pro- lems, including diseases that affect the tein sources that diabetes patients can heart, eyes, kidneys, nerves, and teeth. include in their diets. Nuts and peanuts; Poor diet is a common contributor to dried beans and certain peas, such as diabetes. So it’s natural that newly diag- chickpeas and split peas; and meat sub- nosed diabetes patients typically want stitutes like tofu can make for healthy to know how they can alter their diets protein sources as well. so they can begin to overcome their • Dairy: When purchasing dairy disease. That’s a good place to start, as products, stick to nonfat or low-fat the National Institute of Diabetes and milks, yogurts and cheeses. Digestive and Kidney Diseases notes A diabetes diagnosis can be scary. If that eating well and being physically poor diet contributed to such a diagno- active can help people prevent or delay sis, committing to eating healthier can problems associated with diabetes. The help people effectively manage their NIDDK notes that eating a variety of disease and possibly avoid some of its healthy foods from all food groups is es- more negative consequences. IDA KrauseCare Pharmacy is family owned and Ready For Spring? operated by Nicole and Steve Krause of Fort Qu’Appelle SK. Enjoy these beautiful grounds, without doing the work. 1200 ft2 2 BR Services include prescription dispensing, compliance packaging, medication counseling and reviews, chronic Apartments for Immediate Possesion. disease management, injections and compression stocking îWWLQJVDQGQRQVWHULOHFRPSRXQGLQJ Heritage Community CALL OR STOP BY TODAY ! Living 1-306-332-1222 Active Adult Apartments 310 Broadway St. W. Fort Qu’Appelle Grenfell, SK www.heritagecommunity.ca Business Hours: For Inquiries Contact: Monday to Friday 9 a.m. to 5 p.m. Trevor Rempel 306-229-3523 and Saturday 9 a.m. to 1 pm. www.steelcreekdevelopers.ca [email protected] 14 March 5, 2021 Melville Advance Grasslands News SGI to issue rebates; average payment of $285 per vehicle Crown also enhancing benefits for most seriously injured customers

Provincial proportion of vehicle premiums paid in the previous remaining in a position to protect customers from sig- Grasslands News three years. Details are still being finalized, but it’s nificant rate hikes going forward. Even with issuing expected the average rebate will work out to approxi- the rebate, the RSR will meet industry standards to mately $285 per vehicle or approximately 26 per cent of protect against unexpected cost fluctuations. SGI will pass on roughly $350 million in earnings an average annual premium in Saskatchewan. Rebate cheques will be issued in May and sent to the people of Saskatchewan by issuing one-time re- The Auto Fund, which all Saskatchewan vehicle through the mail to customers who have paid Auto bates to all registered vehicle owners, and also im- owners pay into via their insurance premiums, main- Fund premiums in the past three years and are res- proving injury benefits for its most seriously injured tains the Rate Stabilization Reserve (RSR). Maintain- idents of Saskatchewan. Customers are encouraged customers. ing a healthy balance in the RSR protects customers to verify that their mailing address is up to date by “The Saskatchewan Auto Fund Rate Stabilization against sudden rate fluctuations due to unexpected visiting www.MySGI.ca to confirm or by contacting Reserve is in a very strong financial position due to cost pressures. The RSR is one of the reasons that SGI their local motor licence issuer. very strong investment returns and – to a smaller customers enjoy, on average, the lowest rates for basic degree – fewer collision claims due to the COVID-19 auto insurance in Canada and have not experienced pandemic,” Minister Responsible for SGI Don Morgan Enhanced Benefits for Most Seriously Injured Customers significant rate increases, despite the rapidly rising said. “As a result, SGI will pass on these earnings cost of repairing today’s modern vehicles. SGI is also implementing two significant enhance- to the people of Saskatchewan by issuing rebates to The amount in the RSR is heavily impacted by the ments for customers who receive long-term injury ben- all registered vehicle owners and by improving injury performance of its well-diversified investment portfo- efits as a result of being injured in vehicle collisions. benefits.” lio. After losses last March, in the early days of the 1. Customers who require assistance with daily Rebates to be Issued to Vehicle Owners this Spring COVID-19 pandemic, the RSR experienced strong in- tasks (i.e., dressing, bathing, cooking, cleaning and yard care) will see the maximum payments for those The provincial government has approved the one- vestment earnings over the past fiscal year, especially services increase to better reflect current market time rebate of $285 million. The amount each customer in the last quarter. This allows SGI to absorb the rates. This is expected to benefit more than 1,100 SGI receives will vary, and it will be calculated based on a one-time cost associated with issuing rebates, while customers. 2. SGI customers who receive income replacement benefits from SGI and Canada Pension Plan (CPP) will International Women’s Day no longer have income benefits from SGI reduced by their CPP payment. It is standard industry practice to reduce insurance benefits by the CPP payment. SGI Celebrating the right for women to vote is leading the industry by eliminating this practice, to the added benefit of our most seriously injured cus- tomers. It is estimated that this will benefit approxi- By Alan Hustak awareness of women’s is- the so called “famous as a delegate to the Sas- mately 200 people. Grasslands News sues, like birth control. five,” who fought to have katchewan Grain Grow- Even though the federal women recognized as per- er’s convention in 1913 government named her sons, but she helped pave led to a special “Wom- Violet Clara McNaugh- a person of national his- the way for their fight.” en’s Congress,” and an ton, the suffragette who SaskEnergy warning toric significance, she McNaughton’s insis- organizing committee for helped start the Saskatch- isn’t as well known as tence on being recognized a women’s section, and ewan Equal Franchise with Violet as secretary League which secured the she sparked the forma- of telemarketing scam right for women in the tion of the Saskatchewan province to vote in 1916 is Equal Franchise League, featured in an hour-long which was primarily re- virtual video presentation sponsible for gaining the produced by the Western franchise for women. In Development Museum to 1919 she became president mark International Wom- SaskEnergy is warning of a potential telemarketing of the Interprovincial ens’ Day on March 8. scam targeting its residential customers. Council of Farm Women Because of Mc- SaskEnergy has received reports that individuals and, in that post, became Naughon’s persistence, claiming to be associated with either SaskEnergy, a prominent national Saskatchewan amended or the federal government, are contacting customers feminist leader. She was the provincial Election regarding their eligibility for various rebates, includ- elected to the board of the Act on March 14, 1916 to ing: carbon tax, furnace replacement and equipment SGGA in the early 1920s give women the right to maintenance. These callers are not associated with and was important in the cast ballots for the first SaskEnergy, and are not offering rebates on behalf of Saskatchewan and na- time in the 1917 provin- SaskEnergy. tional Progressive move- cial election. McNaugh- SaskEnergy rebates are not offered through solic- ments and helped write ton was also one of the itation or door-to-door sales. All SaskEnergy rebates the platform for the Pro- first female journalists in are offered through participating SaskEnergy Network gressive Party, an agrar- the country who worked Members only. For more information about SaskEn- ian reform movement for the Western Producer ergy current rebates and programs, and a list of qual- which elected six mem- for 25 years. ified Network Member companies, please visit www. bers to the Saskatchewan “She isn’t as well saskenergy.com. legislature in 1921. known as she should be,” Anyone who has received calls of this nature should She was 88 years old said Amber Parker, the make a report to the Financial and Consumer Affairs when she died in Saska- WDM’s education and Authority (FCAA) of the Government of Saskatchewan toon in 1968. public program assis- at 1-306-787-5645 or 1-877-880-5550 (menu option #1). It costs $17 to register tant, “It’s not just about If you have provided personal financial informa- for the program which be- Violet, but it talks about tion, including bank account or credit card informa- SASKATOON LIBRARY | GRASSLANDS NEWS gins streaming on March the fight for the rights Right to vote tion over the phone, you should report the matter to 1. of farm women and all Violet Clara McNaughton helped secured the right local police, as well as immediately contact your finan- Register at WDM.ca/ the work she did to raise cial institution. for women in the province to vote in 1916. violet You could get YOUR NEWSPAPER a bigger refund NEEDS YOU!

You rely on us to provide you with the news that matters most to you, with the Climate Action and it’s our privilege to deliver it. In a sea of misinformation and fake news, we’re proud to offer you credible, verifi ed facts reported to you Incentive credit. by our team of qualifi ed journalists. However, in order to keep bringing you the coverage and stories you’ve come to count on, we need your help.

Subscribe for a full year now, and gain access to the news you need — anywhere, anytime — in our print or digital edition. SUBSCRIBE NOW! CONTACT US TODAY! Subscribe for a full year to For more info, contact: gain unlimited access to our 148 3rd Ave E, Melville SK S0A2P0 print or digital edition (306)728-4358 80 hrblock.ca $37 for pick-up or online subscriptions. Not everyone receives a refund from claiming any tax credit. Amount cannot Call for prices on mailed subscriptions. be guaranteed and varies based on each individual tax situation. 1-844-GNG-NEWS (ext. 227) | [email protected] www.grasslandsnews.ca Melville Advance March 5, 2021 15 New development officer introduced at council

By Councillor Andrew Rondeau ing development, zoning, and subdivisions. Among $30,000 under budget. for Grasslands News other things, Mr. Popoff will work with developers and Following the Confidential Committee of the Whole stakeholders to assist in the construction and comple- portion of the meeting, there was only one recommen- tion of projects, and issue permits. Welcome aboard, dation that we had to pass as a motion, which was to Melville’s regular meeting of council on March 1 Alexander! approve a bid on a property that had been tendered out was dominated by updates from Andrew Fahlman, Di- Director Fahlman shared a report regarding Mel- due to unpaid municipal taxes. rector of Public Works. ville’s Traffic Calming Initiative, detailing data from During our Workshop meeting, Council discussed First on the agenda was to take the recommenda- the school zone radar signs that were erected in the the idea of creating a servicing cost and development tions from the February 16th Workshop meeting and summer of 2020. Overall, we have seen a nine per cent strategy for new construction and development, as our pass them as motions, making them official. There reduction in speed violations in these areas, which current policy is outdated and inadequate. The pur- were only two items: one of which extended the terms is significant when considering the hundreds of thou- pose of such a policy is to have a formula to share of Library Board appointments to two years, and the sands of cars that pass these signs. Statistical data the costs for services like sewer and water for new second cleared a bunch of items from the list of re- shows that nine of 10 pedestrians survive if hit by a construction, or development such as paving access ferred items that is always on the Workshop meeting vehicle travelling at 32 kilometers per hour. Only half roads for new development. The hope will be to save agenda. survive if hit by a car going 48 kph, and when a car both money and headaches in the future. Administra- We dealt with two pieces of correspondence. The going 64 kph hits a pedestrian, 90 per cent of those tion will provide a more detailed report to Council at first was in response to a letter from Cathay Wagan- collisions are fatal. a future meeting for more discussion. tall, our Member of Parliament. Council passed a Finally, Council approved a request for a new wheel Finally, Council denied the German Heritage’s Club motion directing administration to send letters to Pro- loader to replace our existing 25-year-old loader. We request for tax abatement due to lost revenue as a re- vincial and Federal elected officials in support of a had approved up to $280,000 for this purchase in the sult of COVID-19. Lynsey Swanson, the City’s Direc- National 988 suicide and crisis hotline. Mental health 2021 budget and after a competitive tendering process, tor of Finance, provided a report with the Provincial is always important, and the COVID-19 pandemic has Public Works will soon have a new Cat wheel loader in Government’s criteria for what businesses and entities exacerbated the situation for thousands of Canadians. their shop, at a total cost of $246,498.34 when including receive tax-free status and Council elected to go with Hopefully a National hotline can be established to pro- the trade in value of the old one. This is more than the same standard. vide immediate assistance to those who need it. The second piece of correspondence that was pre- sented was an application for a home based vacuum cleaner repair business, which we also unanimously approved. There are many such small businesses in Melville and they provide all kinds of services for our City seeks volunteers for boards relatively small community! It was then time for Mr. Fahlman to take over. He By Emily Jane Fulford board this year. She was the first and the last. The Van presented Council with the monthly Water Distribu- Grasslands News Advisory Board’s two one-year terms, the Regional tion Report, and Melville’s water remains compliant in Park’s five positions, the Recreation, Culture, and Lei- all categories. He also provided the results of the an- sure Youth position as well as the whopping eight Ser- The City of Melville is once again struggling to find nual Water Quality and Compliance Report. Because vices Advisory Board openings all remain untouched. enough volunteers for certain positions in the city and the new water treatment plant does not take surface The call-out for volunteers resulting in crickets. it was addressed at the council meeting which took water from the reservoir, we are no longer required place on Tuesday, Feb. 16, just after the long weekend. to test for certain contaminants. Our reverse-osmosis City Council adopted a VISION that set an excit- filtered water greatly exceeds provincial standards for ing and challenging picture of the kind of community UPCOMING EVENT purity. it intends Melville to be: “Melville will be a City of Director Fahlman introduced Council to the City’s choice by maintaining a clean, safe and welcoming new Development Officer, Alexander Popoff. A plan- community, with sustained growth through citizen in- ning and development officer is well-versed in the pro- volvement and employee dedication.” vincial Planning and Development Act and municipal “Every year, Administration posts advertisements bylaw regulations, and works to ensure Council has to the public to volunteer for the City of Melville the necessary information to make decisions regard- Boards and Commissions,” said City Manager Ron McCullough. “The City again did not receive enough applications to fill all vacancies.” Recycling popular in the city Not enough; an understatement. The lack of vol- - continued from front page unteers for the particular positions the city has been trying to fill is remarkably high given how included [email protected] and printed paper to Sas- their annual report to the the public is to take part in the community, and it’s an katchewan households Multi-Material Steward- issue that pre-dates COVID-19, although the pandemic 1-844-GNG-NEWS by businesses. In March ship Western program cannot have helped matters much in that regard. of 2021, the Ministry of and is expecting to re- Out of the five one-year term positions open with 1-844- 464-6397 Environment plans on ceive the rebate within the Melville Public Library Board, only a single one www.grasslandsnews.ca releasing a discussion the next few months. was filled when Jennifer Kyeongsuk Jeong jumped on paper, hopefully in digital form to avoid irony, re- garding the development of the program. “The City of Melville launched its commercial front-end service in No- vember 2020,” said Mc- Cullough. “OSS delivered 120 Commercial Waste bins and 113 Commercial Recycling bins through- out the commercial dis- trict. Jeniffer Stein and Yvette van Zyl visited the business community in February to discuss the Waste and Recycling Program and the new fee structure that will take effect on March 1, 2021. The majority of the feed- back from the business 21031ds0 community was very pos- itive. Everyone confirmed they were satisfied with OSS’s service and liked the convenience of hav- ing a commercial bin. They also provided train- ing to all administrative staff to effectively assist with any queries or com- plaints.” For now, the city plans to continue to educate the community on its long-term plan to reduce waste and subsequently keep the current Landfill operational for as long as possible. The City of Melville has submitted 16 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

Back-to-back Scotties win for Team Canada Maryfield’s Val Sweeting played as third for Kerri Einarson and Team Canada

By Travis Longman Rink and Team Saskatch- were on Team Alberta, Grasslands News ewan fell to Team WC3 Team Manitoba, Team after another close loss, Ontario and Team Can- When the Scotties 9-8. ada. began, 18 teams had The final draw of the Laura Walker and dreams of winning the playoff round meant that Team Alberta played event. Kerri Einarson’s only the final three teams Team Canada after de- rink won the event in would be standing, while feating Team Manitoba in Twice victorious 68%0,77('_*5$66/$1'61(:6 2020 and were Team Can- five teams were sent a close playoff match. The Team Canada, 2021 Scotties Tournament of Hearts champions, from left, front, ada this year. Val Sweet- home. winner of the Alberta/ ing of Maryfield was also Maryfield’s Val Sweet- Canada game would Kerri Einarson, Val Sweeting, Shannon Birchard, Briane Meilleur. Back, alter- on Team Canada. Sweet- ing and Team Canada earn themselves a trip to nate Krysten Karwacki, coach Heather Nedohin. ing was not the only had 10 wins and moved the championship game curler from Maryfield at on to the championship against Rachel Homan onships at the Scotties! ice. [We] capitalized on the event. Rachel Erick- round. They could earn and Team Ontario. Championship Game Result They defeated the Rachel our opportunities when son went as an alternate a direct bye to the final Team Canada and Move over Betty Homan rink from On- we got them. It’s a pretty for the second wild card with a win over Jennifer Maryfield’s Val Sweeting White, we have some team, skipped by Macken- Jones of Team Manitoba defeated Team Alberta to new Golden Girls! Kerri tario with a score of 9-7 to amazing feeling to win zie Zacharias. in their evening match. advance to the champion- Einarson, Maryfield’s capture their second con- back to back titles. [I’m] At the end of Round Team Saskatchewan ship game against Team Val Sweeting, Shannon secutive Scotties Tourna- so proud of my team- Robin Play, eight teams had the chance to play Ontario; a rematch of last Birchard, Briane Meil- ment of Hearts. mates and myself for giv- were left: Team Canada, spoiler on Feb. 27 if year’s final where Einar- leur, Krysten Karwacki “It was a great game,” ing it our all this week.” Team Ontario, Team they could defeat Rachel son knocked off Homan and Heather Nedohin Einarson says. “My team The next curling ac- Manitoba, Wild Card 1, Homan and the 9-2 Team in an extra end to capture of Team Canada made played amazing, and we tion begins on March 5th Wild Card 3 and team Ontario. Ontario is 9-2; the title. it back-to-back champi- got a good handle of the when the Brier begins. Saskatchewan. their spot in the final 3 After finishing first in was not guaranteed, but their pool, Chaelynn Kitz with a win and a Canada and Team Saskatchewan loss they would finish Deadline approaching to remove ice shacks battled Maryfield’s Val first. Kitz and the Ander- Sweeting and Team Can- son rink were defeated ada on Feb. 26; they were by the Homan rink by a With ice fishing season winding dence or property. Litter must also least 2.5 cm high. defeated and went on to score of 7-2. down, anglers are reminded that all be removed when ice shelters are Information about fishing in play Team WC3 next. Un- After seeing Saskatch- ice fishing shelters south of High- removed from the ice. the province can be found in the fortunately, the Anderson ewan eliminated, all eyes way 16 must be removed by March If shelters are not removed, Saskatchewan Anglers Guide and 15. owners may be prosecuted and online at www.saskatchwan.ca/ Shelters in areas north of High- the structure and contents may be fishing. way 16 must be removed by March moved off the ice and confiscated. If you suspect wildlife, fisheries, 31. Anyone travelling on the ice forestry or environmental viola- Every year, ice fishing shelters should take extreme caution. Slush tions, please call Saskatchewan’s are abandoned on the ice. When indicates that ice is eroding from toll-free Turn in Poachers and the ice melts, these can pose a dan- above and below at an advanced Polluters (TIPP) line at 1-800-667- ger to boaters, water-skiers and rate. Changing temperatures can 7561 or #5555 for SaskTel cellular others enjoying our lakes. Pieces cause thermal cracks and pressure subscribers. Violations can also be of abandoned shelters can also ridges, which are indicators of un- reported online at www.saskatche- wash up on shore, causing environ- safe conditions. wan.ca/tipp. mental hazards. Ice fishing shelters must have You may be eligible for cash re- Structures must be moved to a the owner’s complete name, ad- wards from the SaskTip Reward location where they can be loaded dress and phone number on the Program. Callers can remain anon- and transported to the owner’s resi- outside in legible letters that are at ymous.

$57,000 $81,500 $89,000 $102,000 $116,500 Vacant Lots,, Melville,, SK 105 Piller Rd, $44,900 MLS® # SK834819 251 Agripark Rd, $49,900 MLS® # SK837675 249 Agripark Rd, $49,900 MLS® #SK837676 214 Louis St, Neudorf 278-2nd Ave, Goodeve 211 May St, Neudorf 302-8th Ave W, Melville 156-6th Ave E, Melville MLS® # SK836001 MLS® # SK836001 MLS® # SK840126 MLS® # SK840506 MLS® # SK837605 House | 4 bds, 2 bths House | 2 bds, 1 bths House | 4 bds, 2 bths House | 3 bds, 2 bths House | 2 bds, 2 bths

$129,500 $139,500 $179,000 $187,000 $215,000 REGINA REALTY Tammy Wandy LOCAL AGENT 325-5th Ave W, Melville 228-8th Ave W, Melville 707 Railway Ave, Neudorf 214-8th Ave W, Melville 620 Main Street, Melville [email protected]@gmail.com MLS® # SK839779 MLS® # SK841331 MLS® # SK840127 MLS® # SK841501 MLS® # SK841525 306-501-98281-9828 House | 3 bds, 2 bths House 2 bds , 1 bths House | 4 bds, 3 bths House 3 bds , 2 bths House | 5 bds, 2 bths

$225,000 PR CE DROP NEW $269,900 $275,000 $749,900 Serving LISTING NOW $239,900$ Melville, Yorkton & Area!

227-680 7th Ave E, Melville 375-10th Ave W, Melville 13-2nd Ave N, Yorkton 109 Piller Rd, Melville ¥Š$3ধ!;T'£=-££' MLS® # SK842356 MLS® # SK834787 MLS® # SK834795 MLS® # SK834817 MLS® # SK834738 Condo | 2 bds, 1 bths House | 4 bds, 2 bths House | 4 bds, 2 bths Commercial House | 4 bds, 3 bths www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 17 Sports Column – Darcy Gross NHL’s best? We’ll have to wait until summer Gross Misconduct Canadian hockey fans are blessed with the best of power lies. Meanwhile, keep those red lights flashing in the four National Hockey League divisions. Those who NHL rinks across Canada. It’s been fun. can’t get enough of puck play are offered televised ac- • Jack Finarelli, at sportscurmudgeon.com, on Urban tion almost every night, and most of it features teams Meyer being hired as coach of Jacksonville Jaguars: “In Do the Jays have what it takes? in the Scotia North Division, where the likes of Connor his seven years at Ohio State, Meyer’s teams lost a total Last baseball season, an affair hyphenated by McDavid, Auston Matthews, Mark Scheifele, Johnny of nine games. If his first year with the Jags results in COVID-19, the Toronto Blue Jays proved to the rest Gaudreau and Brock Boeser frolic and make life miser- the Jags losing fewer than nine games, he might be the of the league that they belong, but are they one of able for goaltenders. Coach of the Year in the NFL.” the top teams in baseball as the 2021 campaign ap- While the high-scoring games featuring explosive of- • RJ Currie of sportsdeke.com: “An ESPN talking proaches? fences are exciting to fans, it’s difficult to look into a head called one of Rob Gronkowski’s nightclub partying It’s difficult to say, partly because these guys crystal ball and see what will transpire videos, ‘Just a man living the American didn’t have to put up with the rigours of a full, 162 once divisional champions are deter- dream.’ Which in Gronk’s case appears game schedule and partly because they’re just so mined this summer and crossover playoff Sports Column to be life, liberty and the pursuit of darned young. action begins. By Bruce Penton happy hour.” They finished up last year by playing in the For instance, how will the high-scor- • Chris Calarco, commenting on a American League wildcard series, being swept out of ing, wider-open play of the Canadian Facebook page for Buffalo fans, after the postseason in two-straight games by the Tampa champion compare to a tighter-checking, the Sabres got shut out at home for Bay Rays. lower-scoring team representing, say, their fourth straight loss: “I bought a Blue Jays brass must have some belief that this the MassMutual East Division, where cardboard cutout to honour my aunt club can go places, since they actually opened the Boston Bruins, Washington, Philadel- who passed away. Can I come pick it wallet and signed one of baseball’s top free agents in phia, Pittsburgh and the Islanders are up so she doesn’t have to watch this the off season, George Springer. battling it out for supremacy? How will any more?” Springer, who cut his teeth with the Houston As- it work against the winner of the Dis- • Dwight Perry of the Seattle Times: tros was probably the most coveted position player cover Central Division, where the two “The NBA issued warnings to the Lak- available. Florida teams, the Panthers and Tampa ers’ LeBron James and Kyle Kuzma for The guy has great hands with the bat, hits with Bay Lightning, and Carolina appear to be the division’s violating the anti-flopping rule in a game against Mem- power to all fields and knows the strike zone as well as any other player in the majors. powers? And how about the Honda West Division, where phis. Hey, if the league is really all that worried about He’s also fast, but that hasn’t really translated Vegas and surprising Minnesota are off to great starts? flops … disband the Timberwolves!” into Springer being a base stealing threat, rather it The unique scheduling of this COVID-19 season cre- • Patti Dawn Swansson, aka the River City Renegade, helps him track down balls in the outfield. He makes ates a lot of mystery as to where the power actually lies. on whether melting ice that caused the Vegas-Colorado few mistakes on the defensive side of the game. Because teams play only within their division — and outdoor game at Lake Tahoe to be delayed eight hours If he has a weakness, it’s that he’s prone to nag- won’t meet any other team until this summer’s playoffs cost the NHL some money: “(If it did) they can just take ging injuries that can keep him off the field for ex- — the NHL’s overall power rankings are impossible to it out of the slush fund.” tended periods. determine. • Swansson again, on Mike Babcock returning to his He’ll more than likely bat lead-off for the Jays. For instance, how would the first-place Toronto Maple roots by agreeing to be head coach of the University of Another newcomer, Marcus Semien, will proba- Leafs (16-4–2 on Feb. 27) fare against the Panthers (13- Saskatchewan Huskies: “How fitting that an old-school bly be in the two hole for Toronto and the mediocre 4-3)? Maybe Florida’s record is glittering because they coach would return to his old school.” fielding shortstop will probably find himself playing play an extraordinary number of games against weak • Good idea from Bob Molinaro of pilot online.com second base now that’s he’s a member of the Blue teams, such as Detroit and Nashville. On the other hand, (Hampton, Va.): “Any NBA player who complains that a Jays. the Leafs overload on Ottawa, Vancouver and Calgary colleague was snubbed in the All-Star selection process 2019 was Semien’s best year in the majors, pound- and have padded their win totals as a result. must name the player he’d remove from the team.” ing 33 homers and batting in 92 runs while hitting Where do the Boston Bruins stack up in the overall • Comedy writer Alex Kaseberg: “There has never at a .285 clip. scheme of things? The Bruins were 11-5-2 on Feb. 27 and been any money in underestimating Tiger Woods. If Last season, he never really got out of the gate, in a near dead heat with Washington and three other anyone can come back from this, it is him. Having said hitting a measly .223 with seven circuit clouts in 53 teams. The weaker teams in that group — the Rangers, that, if Tiger Woods ever drives a car himself again, his contests. New Jersey and Buffalo — have been instrumental in manager should go to jail.” Obviously, Toronto fans would rather see 2019 the leaders’ gaudy record. Headline at Fark.com: “Patrick Mahomes welcomes Semien as opposed to the newer model. How would West-leading Vegas (11-4-1) fare if the first child, Sterling Skye Mahomes, expected to play Bo Bichette gets the number three slot for the Golden Knights faced a road trip taking them to, for against Tom Brady in about 20 years.” Jays and he’s very talented when it comes to putting example, Toronto, Boston, Philly, Tampa and Florida? • Janice Hough of leftcoastsportsbabe.com, on the the bat on the ball. We’ll never know. sun wreaking havoc on the NHL outdoor games at Lake While Bichette has yet to play anywhere near a Things will get interesting in late May or early June Tahoe: “So add to 2021 insanity … a major professional full slate of games, he’s hit .307 in 75 contests over when each division determines its own champion and sporting event postponed because the weather was too the last two years. the four survivors get together to fight over the Stanley good?” He’s hit 16 homers during that time, driving in 44 Cup. It will take us that long to discover where the true Care to comment? Email [email protected] runs and stealing eight bases. Bichette is a decent player with the glove and possesses great range. Left fielder Teoscar Hernandez should be the cleanup hitter and if he can find his groove, he’ll Sandra Schmirler’s legacy drive in a ton of runs. Vladimir Guerrero Jr. will be the fifth place hit- lives on at Scotties tourney ter and could find himself spending a lot of time as the squads designated hitter. By Travis Longman Junior looks to be in the best shape of his life Grasslands News and perhaps he’ll earn some time at third base, be- cause he has made some pretty spectacular plays in the field already. Almost 21 years after her death, Sandra Cavan Biggio, the third of the second genera- Schmirler’s legacy continues to live on. tion major leaguers suiting up for the Jays – both Sandra Schmirler Day is the first Sunday Bichette and Guerrero also have fathers who knew of the Scotties Tournament of Hearts. there way around the ballpark – might end up being The Sandra Schmirler Foundation set a in some sort of platoon with Semien and could even fundraising goal of $500,00 for this year’s end up as DH once in awhile. event. Not only did they reach that goal, Outfielder Lourdes Gurriel Jr. could provide they had smashed the previous record and some power out of the number seven spot in the finished with over $700,000. Jays lineup and if he plays the way he’s capable, Sandra Schmirler was from Biggar, Sas- he’ll move closer to that cleanup spot. katchewan and was the first woman to skip The guy is a pure hitter and he also has power to her team to Olympic gold in curling when spare. He’s one of the more intriguing members of the sport got full medal status for the 1998 the Jays, at least in this scribe’s estimation. Olympics in Nagano, Japan. Tragically, Add another guy who can hit bombs to the mix Schmirler never received the opportunity in Rowdy Tellez and you’re looking at a solid one to defend her title, as she lost her battle to through eight, before the team’s weakest hitter, cancer on March 2, 2000. catcher Danny Jansen rounds out the Blue Jays bat- In 2001, the Sandra Schmirler Founda- ting order. tion was created to honour her legacy. The To say there’s a lot of promise in Toronto might foundation is to raise money to support and be overstating the obvious, but they’ve got to do it buy equipment for newborn intensive care in games that mean something. units across Canada. The funds raised also This is probably one of the best lineups the Jays provide scholarships to junior curlers. have been able to piece together since Jose Bautista “I think it’s an awesome opportunity to was knocking tape measure shots into the upper deck all over the league. fundraise for an even better cause,” Sas- This season the Jays look to have a fairly strong katchewan second Chaelynn Kitz says, “ I pitching staff, as well, anchored by starter Hyun-Jin know quite a few people that have needed Ryu, a guy who has some of the best command in the equipment so I love it!” “Just an amazing cause, wonderful foun- baseball. 68%0,77('_&+5,6$6+),(/' The rest of the starters have some upside, but dation, named after a wonderful woman, Perfect crib hand they’ll need a bit of luck to get the games to the and as you saw Sunday, the Canadian curl- Dave Peter of Whitewood surprised himself while play- arms of a capable bullpen. ers have hearts as big as the Scotties, “ says ing cards on Feb. 20 by scoring a rare but perfect 29 These guys are young, they’re competent and Quebec skip Laurie St-Georges. “Thank hand during a game of Cribbage Wars, a standard crib they’re confident. you all for your donations in these difficult game but twice as challenging. The perfect crib hand times.” It won’t be long and we’ll be able to see just what ZDVKLVÀUVWHYHU7KHRGGVRIVFRULQJDKDQGLQFULE they’re made of. Schmirler’s legacy continues to grow; Play ball! not only did Schmirler win Olympic gold, are 1 in 216,580. she had a heart of gold as well. 18 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Grenfell minor ball preparing for spring By Travis Longman out through the school $5 per registrant if they Grasslands News as well as the Grenfell register during our early Minor Ball Association’s bird times,” Thomlinson says. Spring is just around Social media accounts. As we all know, times the corner; soon the snow Forms can either be given are uncertain due to the will melt and with that to Thomlinson or emailed ongoing COVID-19 pan- it’s time to start thinking to grenfellminorball@hot- demic. “If the season is about ball season. That is mail.com and etransfer cancelled due to COVID, exactly what Tyler Thom- fees. full refunds will be of- linson, President of Gren- The boys will be play- fered. Thomlinson adds, fell minor ball is doing. ing baseball while the “The only change would Registration for the up- girls play fastball but be if the season gets coming minor ball season the Junior Gems (kids stopped after we begin, we begins on March 8 and born in 2015-2017) is co-ed would determine a partial runs for two weeks. t-ball. Fees start at just refund. Certain fees such Registration will go $45 for the younger ages as Baseball Sask and Soft- from March 8 to the and up to $65 for the older ball Sask registration are 22. Forms will be going ages. “Athletes can save fixed non refundable costs paid at the beginning of the year.” Last year was a com- plicated year for some minor ball teams. By the time teams were allowed to do anything it was July. Most towns can- celed ball altogether be- cause it was holiday time. Finding players and field- ing teams proved to be challenging. The Jr Gems t-ball program lost over half of their athletes but were able to have a few practices in July. All of the other age groups that were able to put teams Minor ball 68%0,77('_*5$66/$1'61(:6 together struggled to find opponents. Thomlinson +RSLQJWKDWEDOOZRQ·WEHFDQFHOHGWKLV\HDU*UHQ- is optimistic this season fell minor ball is looking forward to the spring with will be different, but only registration running from March 8 to 22. time will tell. Directory

Fisher & Schmidt Miller Moar Grodecki Kreklewich & Chorney CHARTERED PROFESSIONAL ACCOUNTANTS – www.millerandco.ca /DZ2IÀFH MELVILLE OFFICE – 306-728-4525 FORT QU’APPELLE OFFICE – 306-332-6651 128 - 4th Ave. East, Melville, SK 32&!@;3 8-&!@¥VŠ‡!W1W;3ŒVŠ‡6W1WTˆŒŒfŠ8&='W W '&2'9&!@ŽVŠ‡!W1W;3ˆ‰332Tˆ‰‰316!2@='WW !=-&W 83&'$0-TT-2!ħ'2&!2$' &0LFKDHO)LVKHU4٘ ESTERHAZY OFFICE – 306-745-6611 INDIAN HEAD OFFICE – 306-695-2303 8!2&='W Š‰Œ '&2'9&!@ˆVŠ‡6W1W;3‹VŠ‡6W1W, 8-&!@¥VŠ‡!W1W;3‹VŠ‡6W1WT‹‰‡!-2;W +RQV 32&!@;3 DUQHW)LVKHU%$* ٘ //%&ROODERUDWLYH/DZ\HU GRENFELL OFFICE – 306-697-3558 !=-&W 83&'$0-TT-2!ħ'2&!2$' 32&!@;3 8-&!@¥VŠ‡!W1W;3‹VŠ‡6W1WTˆ¤'9132&;W BALCARRES OFFICE – 306-334-2923

'$'&2'9&!@ˆ‡V‡‡!W1W;3‹V‡‡6W1WT!£$!88'93>2ă -2!ħ'2&!2$' UDQW6FKPLGW//% !88@W-££'8TTT* ٘ Wednesday and Thursday £!-8W!2!'9''£'TTT-2!ħ'2&!2$' Michael Fisher & Garnet Fisher Grant Schmidt 306-728-4581 306-728-5481 WHITEWOOD OFFICE – 306-735-2385 ITUNA OFFICE – 306-795-3190 <'9&!@;3 8-&!@ŽV‡‡!W1W;3ŒV‡‡6W1WT‡!£32&';W Melville and Esterhazy Melville <'9&!@ˆ‡V‡‡!W1W;3‹V‡‡6W1WT3( ;<2!ă$' !8@W8'0£'>-$,TTT-2!ħ'2&!2$' )9,'8£!>|9!90;'£W2'; 93£!>|9!90;'£W2'; !=-&W,382'@TT-2!ħ'2&!2$',<89&!@ ;!8ধ2+!; GARY MOORE LL.B. Balcarres $10*/week Barrister, Solicitor, Notary Public Agencies Ltd. Box 610, 616 Main St., Phone 306-332-4666 1-800-563-4608 Broadview, SK S0G 0K0 Off ering a wide selection of products and expertise 122 Company Ave. S., Fort Qu’Appelle, SK *Must be prepaid, plus 0RQGD\)ULGD\DIWHUKRXUVE\DSSRLQWPHQW • Personal Insurance • Commercial Insurance For all your Insurance needs! • Specialty Products • Agri-Business GST, based on 12 SUB-OFFICE: Representing: • SGI Canada • Wawanesa • SMI • Wynward Insurance Company :KLWHZRRG7KXUVGD\DIWHUQRRQ 216 Main St. Balcarres, SK • Germania Mutual • Aviva • Oasis • Intact 132;,9!&='8ধ9-2+W )ODWODQG3OXPELQJ%XLOGLQJ Phone: 306-334-2401 Fax: 306-334-2705 • HUB Life and Financial Services $480 plus GST Email: [email protected] • Portage Mutual • Group Medical Services CALL FOR APPOINTMENTS: • Red River Mutual and Many More. www.balcarresagencies.saskbrokers.com • Saskatchewan Blue Cross 306-696-2454 or 306-696-6704 • SGI Motor License Issuer GRASSLANDS BOCK & COMPANY DIRECTORY LAW OFFICE NEWS GROUP PATTY WELCH LYNNETTE BOCK, B.A., J.D. Publishers of the Melville Advance, &RQVXOWDQW ADVERTISING Fort Qu’Appelle Times and the 0DSOH6WUHHW32%R[ Phone: (306) 728-4998 $ ,-;'>33& 8'2('££ '8!£&<2 WK$YH(DVW0HOYLOOH for only 10* / week (VWHUKD]\6.6$; EDFNGRRUHQWUDQFH 0XVWEHSUHSDLGSOXV*67 3DWW\:HOFK#,*FD PHONE: (306) 745-3952 Time... to think about keeping the family dream home, 5HJXODUUDWHLVSOXV*67SHU\HDU FAX: (306) 745-6119 1-844-464-6397 no matter what (PDLOERFNODZ#VDVNWHOQHW 7UDGLWLRQDOPRUWJDJHOLIHLQVXUDQFHLVGHVLJQHGVSHFLÀFDOO\WRUHWLUHRQO\WKHEDODQFH Grasslands News Group Ext. 230 RZLQJWRWKHPRUWJDJHOHQGHULIVRPHWKLQJKDSSHQVWR\RX,QYHVWRUV*URXSFDQVKRZ \RXKRZDQLQGLYLGXDOSODQWKDWSXWV\RXLQFRQWUROFDQKHOSHQVXUHWKDWLQWKHHYHQW %UDQFK2IÀFH GHDWKGLVDELOLW\RUFULWLFDOLOOQHVV\RXUIDPLO\FDQVWLOOOLYHLQWKHLUKRPH 1-844-464-6397 /HWXVVKRZ\RXKRZEXLOGLQJLQVXUDQFHLQWR\RXUSODQFDQSUHVHUYHÀQDQFLDOVHFXULW\ Rocanvile, Friday Afternoons !&9|+8!99£!2&92'>9W$! Œ7UDGHPDUNVRZQHGE\,*0)LQDQFLDO,QFDQGOLFHQVHGWRLWVVXEVLGLDU\FRUSRUDWLRQV ext 230 Phone: (306) 645-4552 www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 19 Eighteen teams vying at Brier

By Travis Longman form really well,” Lay- wan skip Matt Dunstone down on my first slide!” Grasslands News cock says. “I’m trying says. “Having the Scotties Fournier says. “We have not to focus too much on on all last week has made been locked out from a specific outcome, but it easy to be excited for practice before today! This year’s Brier isn’t if we perform as well as when it’s our turn to go.” Seriously - after this just the biggest of all time, I’m expecting, I know it “As for expectations, crazy season we are just it is shaping up to possi- will be a great outcome. super hard field, so hard trying to play well and bly be one of the deepest see what happens. I think and best of all time as This is easily the best to predict any of that. our experience will serve well. From coast to coast prepared we have been However we fully expect us well.” there are teams that feel for a Brier in the three ourself to be competing There will be no fans they have a shot to win it years I’ve been with this by the end of the week. all. Eighteen teams will team. Knowing as far in Goal is to win it - plain at the event in Calgary. be playing for the coveted advance as we did that and simple!” “Bah - we are from Que- championship. we’d be in the Brier re- Heading east, Brad Ja- bec. We are used to not Brad Gushue will ally allowed us to focus cobs will once again be having fans!” Fournier be team Canada at this on peaking for this one Northern Ontario; John jokes. “Seriously - it year’s event in Calgary. event versus trying to Epping returns as team sucks. The fans add so He is looking for his peak for provincials then Ontario. Team Quebec much to the atmosphere. fourth career champion- get to that same level has a familiar face as The Brier is more than ship in his 17th appear- again a few weeks later.” well, although it has been a curling tournament. It ance at the event. Looking at the three since 2018; Fournier will won’t be the same - but it Steve Laycock is team prairie provinces, Bren- be making his 2nd ap- is what it is.” British Columbia at the dan Bottcher represents pearance. He is laid back Prince Edward Island Brier. He has come close Alberta; Matt Dunstone is ahead of the upcoming will be represented by to capturing the tankard team Saskatchewan and Brier but mentions there Eddie McKenzie; Nova in the past and is hun- Jason Gunnlaugson will could be some challenges Scotia is Scott McDonalf; gry for more success this be team Manitoba. especially after a long James Grattan is team year. “My expectation is “We are looking for- layoff. “(One of my goals New Brunswick and Greg that we are going to per- ward to it.” Saskatche- is to) Ummm...not fall Smith will represent New- foundland and Labrador. Up north in the terri- tories, Greg Skaug will It all starts HERE! represent North West 150 Territories. The Yukon GIVE BLOOD will be skipped by Dustin Mikkelson and Peter 68%0,77('_*5$66/$1'61(:6 Mackey is team Nunavut. Skater competes the gift of DONORS This year, for the first Hunter Beutler, 13, competed in the Saskatche- time ever, three Wild wan Virtual Cup on the February 27th weekend Needed Cards will be competing. DQGÀQLVKHGZLWKDWKLUGSODFHVWDQGLQJ+XQWHU Mike McEwen, Kevin Koe has been skating competitively for several years and the legendary Glenn in Virden under Coach Patricia Hole. This year, her Howard round out the time in Virden was cut short due to COVID-19 and field. she skated part of this season in Whitewood. She The Brier begins on passed her Silver Bronze test and all of her Silver Friday, March 5 and goes Bronze dances. Blood Donor Clinic until March 14. Tues., March 9 3:30 p.m. - 7:30 p.m. Melville Community Works 800 Prince Edward St., Melville, SK Wellness, Beauty and Holistic DONORS ARE REQUIRED TO: • Be between the ages of 17 and 71 years if they are a regular donor. Directory • Be between the ages of 17 and 61 if they are a first time donor. • Be in general good health, a minimum of 110 lbs. YOU ARE REMINDED TO: Yorkton Hearing Services #18 First Avenue North, Yorkton, Sask. S3N 1J4 • Please eat something before donating. • Bring Identification with full name and signature or full name and photo. Your ears deserve an audiologist! This advertisement is sponsored by these businesses PERSONAL CARE HOME • Hearing Tests • Hearing Aids • Repairs • Batteries Private bedrooms/bathrooms for Singles and Couples. • Custom Molds St. Peter’s Corinne Pauliuk - Owner/Operator Phone: 306-782-1793 306.699.2548 www.yorktonhearing.com 135 - 3rd Ave E. website: carehomes.ca/homes/sunrise-country-haven/ Jacquie Mvula Hospital M.S., R. Aud. Melville 306-728-5625 Located on acreage between McLean & Qu’Appelle

Kreklewich & Chambers Law Office Simply Divine ‡&OHDQ&HUWLILHG&DEV %DUULVWHUV 6ROLFLWRUV²0HOYLOOH6DVN 1RQVPRNLQJYHKLFOH Call 306-728-5468 Phone 306-728-2772 Tammy Oryschak 306-730-5748 306-720-0789 508-7th Ave. West, Melville, SK Prairie Co-operative Ltd. Online: mytiber.com/tammyoryschak Facebook: 728-4556 Tiber River with Tammy Oryschak 156 - 2nd Avenue East - Melville, SK

For all your denture needs: Caleb Village Melville Grasslands 680 - 7th Ave. East News Group Tru-Fit Denture Clinic 306-728-2035 306-728-5448 2130B Broad Street, Regina, Saskatchewan S4P 1Y5 Book your appointment: www.blood.ca 306-352-2552 1-888-236-6283 CALL COLLECT “Doing a smiling business for over a decade and a half” 20 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

WEEK OF MARCH 7 TO 13, 2021

THE LUCKIEST SIGNS THIS WEEK: ARIES, TAURUS AND GEMINI ARIES At work, you’ll be happy to take on a new group of clients inte- rested in your products and ser- vices. The abundance of work will also get you thinking about CROSSWORDS PUZZLE NO. 064 Copyright © 2018, Penny Press starting a new project. TAURUS ACROSS 50. Fragments 20. Small cut A getaway may be planned at 53. Gear 22. Shed tears 54. Seafood item the last minute. You might also 1. Corrosive 24. Floral necklace 5. Fat 56. Pipe type consider going to work in an- 25. “My ____ True Love” other region so you can enjoy 9. Say yes to 57. Differently new and more enriching expe- 12. Fair 58. Musical group 27. Kind of ballet shoe riences. A training course will 13. Govern 59. Tiny 29. Motoring nuisance prove beneficial. 14. Rowing blade 60. Colorized 30. Commandments’ 15. Full of feeling 61. Pew number GEMINI 17. Mine find When faced with a need for 18. More competent 31. Once held change, you’ll be guided by the 19. Tough part of a steak 33. Collections 21. Commotions little voice in your head that en- DOWN 35. Volcano’s output courages you to live a life of 23. Fellows 38. Flipped passion and adventure. Doing so 24. House site will allow you to broaden your 26. Negative 1. On a cruise 40. Remarked horizons. 28. Between fourth 2. Hair tamer 43. Recently and sixth 3. Keeps apart 45. Hay storage places CANCER 32. Rams’ mates 4. Was overly fond 46. Developed You’ll slowly come across the 34. Long scarf 5. To’s opposite 47. Enrage right information to take your 36. Petition 6. Air-breather’s organ 37. Map feature 48. Eye rudely life in a new direction. You’ll find 7. Startle yourself full of enthusiasm and 39. Road bend 49. Medicinal quantity 8. Creed joy as you plan for the future. 41. As well 51. Cambodia’s continent 42. Coal unit 9. Plunder LEO 44. Stop 10. Aristocrat 52. Injection At work, you’ll have to negotiate 46. Earned before 11. Birch, e.g. 55. Color of Rudolph’s with a few different groups to expenses 16. Branding tool nose reach an agreement following a tense situation. You’ll likely play a role in your community or work union. VIRGO Professionally, you’ll experi- ence success when dealing with a group or the government. In terms of your health, you’ll be sur- prised by the treatment you re- ceive to resolve a long-standing problem. LIBRA You don’t always enjoy being in the spotlight. However, when you accomplish a major feat, it’s normal to want to receive ap- plause and be the focus of every- one’s attention for a while. SCORPIO You’ll start seriously looking into finding a new home or buy ing a house. Your children will bring you a moment of great happi- ness. SAGITTARIUS You’ll be extra chatty this week and always know what to say to get a laugh. A well-timed joke on your part may defuse a tense situation at work or at home. CAPRICORN You might start compulsively shop ping. You’ll also feel a strong urge to get moving and experi- ence new things. Be careful not to drain your bank account. AQUARIUS It’s important that you take Palatschinken (Crêpes) FAVORITES enough time to rest so that you can start the week off on the Submit your favorite recipe to [email protected] right foot. You’ll need all the 8Í6'-9;,' 8'2$,>38&(38[6!2$!0'W\8Í6'9!8'&'£-$!;'T#!ħ'8f#!9'&!2&9!=38@389>'';$8'!ধ329;,!;$!2#''!;'2!;=!8-3<9ধ1'93( sleep you can get to be efficient and up to the task at hand. ;,'&!@W8Í6'91!@#''2/3@'&!;#8'!0(!9;)££'&>-;,(8'9,#'88-'9T38!9!&'99'8;#<89ধ2+>-;,!£<9$-3<9$8'!1W!8-3<9$<£;<8'9,!=';,'-8 3>2=!8-!ধ32T-2$£<&-2+;,'!=!8-!28'+-323( '81!2@W!£!;9$,-20'2!8' '81!2c<9;8-!2$8Í6'=!8-'ধ'9W PISCES You’ll be very creative. You’ll li- DIRECTIONS: kely draw inspiration from dif fe-     rent cultures or ways of life to Yields 5 1. Whisk the eggs using a han&>,-90-2!1'&-<1#3>£<2ধ££-+,;£@#'!;'2W&&9!£;T=!2-££!'?;8!$;l-( create a masterpiece. As fatigue <9'&m!2&!#3<;ˆŠ$<6l¥‡1£m3(;,'1-£0l/<9;'@'#!££m!2&9ধ8<2ধ£$31#-2'&W creeps up on you, you’ll start to j‰£!8+''++9 ‰W&&*3<8!2&>,-90<2ধ£@3<+';!9133;,#!ħ'8W,'#!ħ'89,3<£&#';,-$0!2&;3<+,93@3<$!2 plan a vacation to get away from jˆ$<61-£0l¥*W3AT‰‹‡1£m #!8'£@>,-90-;W&&!£-ħ£'3(;,'8'1!-2-2+1-£0-(-;-9;33,!8&;39ধ8W<169,!='23$,!2$'-2;,-$0 it all. jˆ$<6!££6<8639'*3<8 #!ħ'89W lŠfˆc‰3ATˆŠ‡+m ŠW 8!&,-£'>,-90-2+W jˆ‹;'!96332)2'9!£; ‹W '!;!2¥f-2$,l38£!8+'8m2329ধ$06!23='81'&-<1,'!;W&&ˆ‰;'!96332#<ħ'8l383-£m!2&968'!& jˆ‹;'!96332=!2-££!'?;8!$; -;$!8'(<££@>-;,!96!;<£!;3$3!;;,'#3ħ313(;,'6!2'='2£@W,-9-9-1638;!2;U3;,'8>-9'T;,' l36ধ32!£T31-;(389!=38@ #<ħ'8>-££&-9;<8#@3<>,'29>-8£-2+;,'6!2(38 )££-2+9m &-9;8-#<ধ2+;,'#!ħ'8W j<ħ'8T+,''382'<;8!£ ŒW3<8ˆŠ$<6#!ħ'8l(38!2¥f-2$,6!2T138'(38£!8+'8 ;!9ধ2+3-£(38$3!ধ2+;,' 6!29m-2;3;,'$'2;'83(;,'6!2!2&9>-8£;3968'!& 6!2 '='2£@W2$';,'#3ħ319-&'-9+3£&'2-2$3£38T*-6-; j68-$3;/!1(38;,')££-2+ >-;,!96!;<£!!2&$330;,'3;,'89-&'(38!#3<;ˆŒ j32('$ধ32'8Z99<+!8(38 9'$32&9W 2='8;32;3!6£!;'h;,'#83>2'&9-&'9,3<£& &<9ধ2+ ;3<$,;,'6£!;'T@3<9,3<£&9'';,'6!£'9-&'W,-9>!@ ;,'2-$'f£330-2+9-&'>-££#'3<;9-&'>,'2@3<83££-;W ¤W'6'!;>-;,;,'8'1!-2-2+#!ħ'8T!&&-2+ˆ‰;'!96332 3(#<ħ'8c3-£(38'='8@$8Í6'W (;,'#!ħ'8;,-$0'293='8 ধ1'T!&&!£-ħ£'1-£0W 3<$!20''6;,'8'!&@32'9 >!8132!6£!;'-2;,'3='2!;£3>;'16'8!;<8'W W68'!&'!$,!£!;9$,-20'>-;,68-$3;/!1l383;,'8 )££-2+m!2&83££-;(83132'9-&';3;,'3;,'8W<9;;,' !£!;9$,-20'2>-;,$32('$ধ32'8Z99<+!8!2&9'8='>-;, !(380!2&96332l;,'963329'8='9!9!02-('mW ZZZJUDVVODQGVQHZVFD 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV 0DUFK 21 Neighbourly Advice According to ED - Ray Maher Quit boxing with one hand tied behind your back

Ed, my old neighbor We know Jesus went of Nineveh that in 40more and change our evil ways. humbled himself and be- fasting are the first and in Saskatchewan, feels into the wilderness to fast days, God would over- In the Church Sea- came obedient to death foremost weapons against church people hide be- for 40 days and nights. turn their city, the peo- son of Lent, we seek to even death on a cross. the forces of evil. hind religious words, At the end of his fasting, ple believed God’s word become one with the at- (Philippians 2:5-8) Matt Fradd has said liturgical seasons and Jesus was tempted by the to them. They declared a titude of Jesus, who as Pope John Paul 11 has that prayer without fast- traditions that are smoke devil to use His authority fast from the greatest to God’s Son made himself said that Jesus himself ing is like boxing with and mirrors to others. He as the Son of God for his the least. They did not nothing taking the very has shown us by His own one hand tied behind tells me that if I’m fasting own purposes rather than eat, or drink and they all nature of a servant, He example that prayer and your back. and praying as a Chris- His Father’s objectives called to God in repen- tian, the fasting isn’t for Him. tance and turned from working because I’m not Jesus was sent to save their evil ways. getting any thinner. sinners, not to glorify God had compassion I admitted to him that Himself. Fasting can help on them and did not bring Melville’s Churches I would have to undergo us understand God’s will destruction upon them. a total fast (no food or for our lives. God’s will (Jonah Chapter 3) Welcome You drink) for 40 days and for us is more than for Lent is 40 weekdays nights to accomplish a our personal pleasure and from Ash Wednesday to 0HOYLOOH$QJOLFDQ/XWKHUDQ(FXPHQLFDO %(7+$1<(9$1*(/,&$/ significant weight loss. advantage. Easter observed as a pe- &RPPXQLW\0$/(& 0,66,21$5<&+85&+ Fasting isn’t a church In the Old Testament, riod of prayer and fast- * * * WK$YH: 4XHHQ6W²&KXUFK2IÀFH3K weight loss plan. fasting was often a way ing, repentance of sins, $//6$,176·$1*/,&$1&+85&+ 0DUFKNo Service Corner 6th Ave. E. & Main St. 0DUFKWorship Service 10:30 a.m. For Christians, fasting of expressing grief over and self-denial that we &KXUFK2IÀFH is essentially giving up one’s sins and humbling might grow closer to God 673$8/·6/87+(5$1&+85&+ 0(/9,//(3(17(&267$/&+85&+ food (or something else) oneself before God. It was UG$YH(2IÀFH3K 115 - 11th Ave. W. for a period of time. In a sign of repentance and 2IÀFH+RXUV0RQ7KXUVDPQRRQ 3DVWRU'RXJ%UDXQ²2IÀFH3K the New Testament, fast- a way of asking God for VALLEY ALLIANCE 3DVWRU.LP6KHUZLQZZZVWSDXOVPHOYLOOHFD HPDLOPSF#VDVNWHOQHW www.facebook.com/melvillepentchurchsk ing and prayer are a way forgiveness and mercy. 0DUFKDP3DULVK:RUVKLSDQG6XQGD\6FKRRO CHURCH Fort Qu’Appelle 0DUFK,Q3HUVRQ6HUYLFH DW6W3DXO·V of growing closer to God. Fasting in the Old Testa- 3OHDVHMRLQXVRQ)DFHERRNDW0HOYLOOH3HQWHFRVWDO&KXUFK AOO6DLQWV·UHPDLQV&/26('IRULQSHUVRQZRUVKLS

We fast to focus on God ment might be done indi- Sunday service 10:30 a.m. 6W3DXO·VUHPDLQV23(1IRULQSHUVRQZRUVKLSZLWKDPD[LPXP and His word and His will vidually or as a call for Service is also available on YouTube and will be capacity of 30 people. All services can be streamed live on *22'6+(3+(5'/87+(5$1&+85&+ for us. everyone to fast. livestreamed. Please call the church at 306-332-5807 Facebook page Sunday mornings. WK$YH:²3K In Matthew 6:16-18, In the book of Jonah, for information regarding COVID-19 regulations Sunday morning live streams start at 10:50 a.m. 3DVWRU'RXJ6FKPLUOHU facebook.com/gslcmelville Jesus said, “When you when he told the people or check our website: valleyalliance.ca 0DUFK 10:30 a.m. Online Worship Service fast, do not look somber ),56781,7('&+85&+ 5th Ave. E. & King St. 0DUFKSP&RQÀUPDWLRQ&ODVV &RPS6WXGHQWV as the hypocrites do, for 2IÀFH+RXUV 7:00 p.m. Midweek Lenten Devotional Online 0DUFKSP&RQÀUPDWLRQ&ODVV 6W+HQU\·V6WXGHQWV they disfigure their faces Mon., Tues., Thurs., 9 a.m. - 12 noon to show men they are fast- 3K 5HY%ULDQ0HH3K 67*(25*(·68.5$,1,$1 ing. I tell you the truth; ZHEVLWHÀUVWXQLWHGPHOYLOOHRUJ &$7+2/,&&+85&+ they have received their 0DUFK 11:00 a.m. Worship with Communion, Rev. B. Mee Corner of 3rd Ave. E. & Manitoba St. reward in full. But when 0DUFK Worship Service with Sharron Bodnaryk Fr. Basil Malowany EDVLOPDORZDQ\#JPDLOFRP² you fast, put oil on your 0DUFK Annual Meeting Following Church Service WHITEWOOD AND AREA 0DUFK 7XHVGD\ 6:30 p.m. Stations of the Cross face, so that it will not be 0DUFK 7XHVGD\  6:30 p.m. Stations of the Cross obvious to men that you KNOX WAPELLA CHURCH 7+(5,9(5&+5,67,$1&(17(5 Please (A Church with a Caring Heart) 1RWH3DULVKLRQHUV0867UHJLVWHUKRXUVLQDGYDQFHIRU are fasting, but only to PRESBYTERIAN CHURCH OF THE NAZARENE each service. Contact 306-728-3813. Services - 10:00 a.m. Service – 11:00 a.m. 3rince Edward St. (Melville Comm. Works) your Father, who is un- Rev. Seon Ok Lee Sunday School – 10:00 a.m. 3K3DVWRU7LP2HKOHU seen, and your Father, 67+(15<·6520$1 NEW LIFE 6XQGD\ 10:00 a.m. Doors Open – 10:30 a.m. Worship Service ST. JOSEPH’S ROMAN &$7+2/,&&+85&+ who sees what is done in COMMUNITY CHURCH 3UHUHJLVWUDWLRQLVZHOFRPHGEXWQRWUHTXLUHG CATHOLIC CHURCH 0DLQ6W²2IÀFH3K More information available online at: secret, will reward you.” Worship Service ~ 10:30 a.m. 5HV3K²WK$YH: *March Saturday Mass Website: www.melvilleriverchurch.org Wed. ~ Kids Club ~ 3:30 - 5:00 p.m. )DWKHU$QGU]HM6RZDOMI Held at New Life Church 5:00 p.m. )DFHERRN3DJH#PHOYLOOHULYHUFKXUFK 5HFRUGHGVHUYLFHVZLOOFRQWLQXHWREHSRVWHGRQOLQH 6DWXUGD\0DVV: 7:00 p.m. 6XQGD\0DVV 10:00 a.m. (Ages 5 - 10) LOOK! Fri. ~ Youth Group ~ 7:00 p.m. ST. JOHN’S LUTHERAN (Ages 11 & Up) CHURCH, WAPELLA 0(/9,//(%$37,67&+85&+ =,21/87+(5$1&+85&+ Pastor Doug Lancaster *No Services until futher notice th Ave. W. (Lutheran Church - Canada) WK$YH:²&KXUFK2IÀFH3K You just proved even EVANGELICAL MISSIONARY 2IÀFH3K3DVWRU-RQ3HWWLQJHU (PDLO]OFSDVWRU#P\DFFHVVFD small ads get noticed. Sunday School – 10:30 a.m. ST. MARY’S 6XQGD\6HUYLFH7LPHV 9:30 and 11:15 a.m. Website: www.zionlutheranmelville.com Sunday Service – 10:30 a.m. ANGLICAN CHURCH 3UHUHJLVWUDWLRQLVUHTXLUHG 6XQGD\0DUFK 11:00 a.m. Worship Service 1-844-GNG-NEWS Friday Youth Bible Study – *Services Online services can be found at: Church of the Lutheran Hour heard Sundays at 9:00 a.m. 6:00 p.m. CANCELLED www.melvillebaptist.com RQ&-*;5DGLR

TYMIAK’S MONUMENTS & GRAVE SURFACING CO. Granite, Bronze, Marble Monuments, Grave Covers, Vases, $UWLÀFLDO)ORZHUV&HPHWHU\,QVFULSWLRQVDQG&UHPDWLRQ8UQV GRANITE, MARBLE, • Monument Sales )8//<*8$5$17(('²/,&(16('$1'%21'(' BRONZE MONUMENTS 6HH2XU Second Inscriptions • Lettering on /DUJH'LVSOD\ Vases, Cremation Urns Monuments & Markers 529 Main St. South, /LFHQVHGDQG%RQGHG Box 476, Ituna, Sask. S0A 1N0 CAROLE ARMSTRONG Directory Ph. (306) 795-2428 'HQQLV7HPSOH 306-332-1335 Serving Surrounding Areas Since 1960 or 306-728-8197   

Tubman Funeral Home Check our pricing – You will be Cremation and Funeral Services glad you did! Family Owned and Operated Located at 5th Ave. W and Main St., Melville, SK Denton Keating “Treating Your Family like a part of 210 Claude Street Did You Y Know? K ? If you have h a prearranged funeral plan with another funeral Ours for 4 Generations” P.O. Box 351, Wolseley, SK S0G 5H0 Tel.: 1-306-698-2557 home you have the right, by law, to transfer that plan to any other funeral  1-800-667-8962 home in the province, often at no charge to you. Fax: 1-306-698-2559 Raymond and Crystal Bailey, Honoured Provider Dignity Memorial® Call us for details! Don Klus and Len Varga [email protected] Authorized agent for Canada Purple Shield / Familyside. Elden Conley LFD / LE / CCT - Owner / Manager Authorized Agents for www.tubmanfh .com ZZZEDLOH\VIXQHUDOKRPHFRP Summit Memorials Ltd. FORT QU’APPELLE – 306-332-0555 WOLSELEY – 306-698-5000 266 Boundary Ave. N. 900 Front Street Matthews Funeral Home Melville’s only locally-owned funeral home. %UDQFKRI¿FHLQ:KLWHZRRG %XULDODQGFUHPDWLRQVHUYLFHVJULHIVXSSRUW FHPHWHU\PHPRULDOVQRWDU\SXEOLF 0HOYLOOH²:KLWHZRRG Mark and Gaylene Matthews and staff www.conleyfuneralhome.ca RAYMORE – 306-746-1000 116 Main Street PDWWKHZVIXQHUDOKRPH.ca Like and follow us on facebook for the latest obituary updates. 22 CLASSIFIEDSMarch 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News ONE AD, THREE NEWSPAPERS: All classified ads appear in the Melville Advance, Fort Qu’Appelle Times and Whitewood/Grenfell Herald Sun

Vern Jordens Olga Emily Weger For Sale by Tender Notice to Creditors Obituary Aug. 3, 1936 - Feb. 10, 2021 Obituary April 2, 1927 – Feb. 16, 2021 FOR SALE BY TENDER NOTICE TO CREDITORS Olga Weger of Melville, and RM 154 Elcapo, SK. In the estate of Eileen It is with great sadness 1(:6(: Margrethe Hodges, late of Melville, that we announce the pass- formerly of Neudorf, passed 6::1(: Sask., deceased. ing of Vern Jordens on away Tuesday, Feb. 16, 1921 NW 06-16-04 W2; SE 06-16-04 W2 All claims against the above estate, Will sell altogether or in differ- duly verified by statutory declaration Wednesday, Feb. 10, 2021, at the age of 93 years. ent parcels. Highest or any tender and with particulars and valuation of at his home in Whitewood, Olga Emily (nee Schmidt), not necessarily accepted. Tenders security held, if any, must be sent to SK. beloved wife, mother, grand- close Monday, March 22, 2021. For the undersigned before the 5th day PRUHLQIRUPDWLRQFDOO of April, 2021. “Sonny” was born Aug. mother and great-grand- or submit tender to: Sandra Ocrane, Executor 3, 1936, to Joseph and Julia mother, was born on April 2, [email protected] 5-4p     Willowbrook Road NW Jordens at their home near 1927, on a farm near Neudorf, Airdrie, AB T4B 0L5 Sinnett, SK. His childhood Sask. Olga passed away at 5-2p Melville on Tuesday, Feb. 16, Farmland was spent on the farm in In the Estate of Vern Appel, the Poplar Grove district. He 2021, at the age of 93 years. WANTED TO RENT – Farmland late of Melville, in the province of joined the Armed Forces just before his 18th birthday and 6KHZDVFRQ¿UPHGRQ$SULO near Melville. Cash rent. Prefer 3 - 5 Saskatchewan, deceased. year term. 306-631-1586. 51-8p NOTICE TO CREDITORS EHFDPH RQH RI WKH ¿UVW SHDFHNHHSLQJ JURXSV WR VHUYH LQ 1941, and was married to Bill All claims against the above the Suez Canal Crisis in the 1950s. Following that, he con- Weger on Dec. 8, 1946, both at Zion Lutheran Church locat- Estate, duly verified by statutory ed just outside of Neudorf, Sask. declaration and with particulars and WLQXHGVHUYLQJDVDTXDOL¿HGPDLQWHQDQFHPHFKDQLFZKHUH Home for Sale valuation of security held, if any, he excelled to become top mechanic in the company’s three Olga was one of nine children. She was predeceased by must be sent to the undersigned plants in Calgary. We are proud of the recognition of his in- her parents, Joseph and Katherine (Yeadon) Schmidt; her before the 11th day of March, 2021. FISHER & SCHMIDT tellectual capabilities. He eventually returned to Whitewood husband, Bill; her siblings, Edward (Winnifred), Ernie (Vio- LAW OFFICE to live with his father, Joseph. let), Walter (Lillian), Evelyn (Johnny) and Gordon (Gladys); Barristers & Solicitors and by her daughter Bonnie in 1958. Box 2980 Vern was predeceased by his parents, Joe and Julia; his 128 - 4th Ave. East two sisters, Loretta and Jean; and two brothers, Leonard Olga is survived by her sisters, Marjorie, Adeline and Melville, Sask. and Joseph (Buddy). Clara. She is also survived by her children, Darlene (Rog- S0A 2P0 He is survived by two sisters, Eileen and Angela (Ed) er), Wayne (Janice), Garth and Kelly (Cathy). She had three 4-2c Mihalicz, and numerous nieces and nephews; a daugh- grandchildren, Sarah (Douglas), Gerad and Carson, and two great-grandchildren, Ava and Rhett. HOUSE TO BE MOVED for sale. 30 ter, Charlotte; granddaughter TC; and great-grandchildren x 30, 1-1/2 storey, 3 bedrooms, 3 Notice Sage and Willa. Mom took her schooling at Neudorf School. Mom and EDWKURRPV  IRU PRUH information. 5-3p NOTICE May the Lord wrap him in the light of God’s presence Dad ran a successful farm in the Qu’Appelle Valley for 43 Annual meeting of the and give him peace. years before they built their retirement home in Melville in Summerberry North Conservation & Arrangements were entrusted to Matthews Funeral 1990. Mom had the ability to balance her time between run- Development Area Authority. Real Estate Notice is hereby given that the Home, Melville and Whitewood. QLQJWKHKRXVHKROGDVVLVWLQJRQWKHIDUPSOXVDOZD\V¿QG Annual Meeting will be on Tuesday ing plenty of time for her husband and children, church, golf LAKE LOTS FOR SALE: Chorney 0DUFKDWSP6KRXOG\RX and social activities. Beach, Fishing Lake. 55 x 135 fully wish to participate please contact 'HEUD DW  DQG  LQIRU Mom enjoyed cards, bingo, the occasional trip to the ca- serviced with electrical, natural gas and water. For more information mation material will be emailed to you in advance. sino, some voluntary work at the thrift shop, and coffee with contact Peter at 306-229-0251. Location of meeting will be friends and neighbours. In addition, she enjoyed baking determined once we have confirmed homemade bread and many types of desserts which were numbers in attendance. Masks and For Rent social distancing as per provincial always available when company dropped by. Mom and Dad COVID regulations required. had many travel adventures, including spending 12 winters ABERNETHY HOUSING Authority Secretary-treasurer in the southern U.S.A to get away from the cold weather. has one 2 bedroom seniors suite 5-2c Debra Pekrul Elvina Yathon and two 1 bedroom duplex apts We would like to thank the staff at St. Paul Lutheran NOTICE Obituary Jan. 24, 1922 – Feb. 23, 2021 available for rent. For more informa- Home and St. Peter’s Hospital for looking after Mom during Annual meeting of the Tetlock tion contact Anne Marie Moulding, Conservation and Development the last two months. KRXVLQJPDQDJHUDW Time Area Authority No. 25. Our lives will be much emptier without her but fuller 2-12tfc Take time to laugh, Notice is hereby given that the it is the music of the soul. because of her. God blessed us because Olga was in our FOR RENT – Balcarres Housing Annual Meeting will be held on lives. She will be very missed. Authority has a 1 bedroom seniors 7XHVGD\ 0DUFK   DW  SP suite available for rent. For more local time. Should you wish to par- Take time to think, A private funeral service was held for Olga on Friday, information contact Anne Marie ticipate, please contact Debra at it is the source of power. Feb. 26, 2021, at Matthews Funeral Home, Melville, with 0RXOGLQJDW   DQG  LQIRUPDWLRQ the Rev. Doug Schmirler presiding. Memories of Olga’s life 52-12tfc material will be emailed to you in Take time to play, advance. were shared by sons Kelly and Garth, and recorded ver- FOR RENT – 1- and 2-bedroom Location of meeting will be it is the source of perpetual DSDUWPHQWV LQ 6TXLUH·V &RXUW sions of Olga’s favourite hymns were played in tribute. In- determined once we have con- youth. Melville. Appliances included. Phone firmed numbers in attendance. terment took place in Christ Lutheran Cemetery, Neudorf.   RU Masks and social distancing as Arrangements were entrusted to Matthews Funeral  WIS Take time to read, per provincial COVID regulations it is the foundation of wisdom. Home, Melville. required. Secretary-treasurer Take time to pray, Auctions 4-2c Debra Pekrul it is the greatest power on QUICK SOLD AUCTION earth. Serving Southeast Saskatchewan. Let us help you sell your items, get- Province Wide Take time to love and be loved, ting you the best possible price in it is the road to happiness. the least amount of time. Items will get Canada-wide coverage with our FORAGE SEED FOR SALE: Take time to give, Online auction. Organic and conventional: Sweet Specializing in antiques, vintage Clover, Alfalfa, Red Clover, Smooth LWLVWRRVKRUWDGD\WREHVHO¿VK Memorium Wanted - Class Photo and collectible items of all kinds. Brome, Meadow Brome, Crested Certified personal property ap- Wheatgrass, Timothy, etc. Star City, These words are from a slip of paper that Mom always had SUDLVHU'RQ·WWKURZDQ\WKLQJDZD\ SK. Birch Rose Acres Ltd. 306-921- ALMASI – In loving memory of our LOOKING FOR a class photo from with her. It was the way she lived. until you talk to us. 9942. dear son and brother, Scott, who 0HOYLOOH·V 0LOOHU 6FKRRO  Free consultations call Loved always – Elaine, Margo, Tony, Donna and families. passed away March 5, 2006.  *UDGH  ZLWK WHDFKHU 0UV RU AgPRO Seeds buying HEATED There is a bridge of memory Til. Preferably with students names. quicksoldauctions.com CANOLA. TOP PRICES PAID IN Photo to include Rhonda Smith. From here to Heaven above, 3/ SK FOR 15-100% HEATED. On That keeps him very close to us 3KRQH  51-8p farm pickup, prompt payment! Price 5-2nc ,W·VFDOOHGWKHEULGJHRIORYH  LQTXLULHV    RU HPDLO We hold him close within our [email protected] hearts And there he will remain, Livestock ADVERTISEMENTS and state- What’s happening To be with us throughout our lives ments contained herein are the sole responsibility of the persons or enti- Until we meet again. HOLLINGER LAND & CATTLE HELP STOP THE ties that post the advertisement, –Lovingly remembered and sadly 9th Annual Bull and Female Sale, SPREAD OF FAKE and the Saskatchewan Weekly missed by Mum, Dad and Dean. Tuesday, March 23, 1 p.m. at the NEWS! Newspaper Association and mem- in your area? 5-1p ranch, Neudorf, SK. With guest con- The global COVID-19 bership do not make any warranty WALDBAUER – In loving memory signor, Nu-Horizon Angus. Offering pandemic means as to the accuracy, completeness, of Doris, Oct. 12, 1929 - March 2, 60 Black Angus yearling bulls, plus Send your events to: learning how to truthfulness or reliability of such 2003; Ed, Feb. 18 1919 - Feb. 28, purebred females and select pens SPOT fake news has advertisements. For greater infor- 1994; Myron, Jan. 30, 1951 - Jan. of commercial open heifers. For never been more mation on advertising conditions, [email protected] or 28, 1988. more information or a catalogue, important. SOHDVH FRQVXOW WKH $VVRFLDWLRQ·V Gone but not forgotten for all contact Chad at 306-331-0302 or Blanket Advertising Conditions on WKH\HDUVDQGWLPHVZH·YHVKDUHG T Bar C Cattle Co. at 306-220- Protect yourself [email protected] our website at www.swna.com You will always be with us in our 5006. To view the catalogue online with media literacy hearts and memories. go to: www.BuyAgro.com in 4 simple steps. PROVINCE-WIDE CLASSIFIEDS. –Forever loved and missed, Brian Watch and bid online at: Reach over 550,000 readers weekly. Watch the video at 306-728-5448 and family; Linda and family; and www.DLMS.ca (PL#116061) Call this newspaper NOW or 306- SPOTfakenews.ca Norma. 5-1p 3-5c 649.1405 for details.

CLASSIFIED RATES 1 week: $12.00 • 2 weeks: $18.00 • 3 weeks: $24.00 • 4 weeks: $28.00 1-844-GNG-NEWS (based on 25 words or less) Additional weeks: $2.50 • Deadline: Tuesdays at 12 noon Email: [email protected] www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 23

Whitewood Community Benefits Raffle Dale’s Painting 306-728-4392 602 - 8th Ave. W.

Benefits Raffle funds distributed Melville tfn/2nd By Elaine Ashfield divided to organizations Recreation - $500, White- Throughout the year Grasslands News to help them operate their wood Ministerial Associ- there are 48 weekly draws worthy projects. ation - $500, Whitewood for $50, 3 quarterly draws The funds from the School (nutrition pro- for $500 and a final draw Eleven groups will 2020 raffle were donated gram) - $500 and White- for $1500 for one lucky benefit from the funds to Whitewood Minor wood Library - $300. ticket holder. donated to them from the Hockey - $1000, White- Raffle tickets are sold Whitewood Community wood Figure Skating at the beginning of each Benefits Raffle. Currently accepting Club - $1000, Pipestone year and there are only Heavy Duty Mechanics CERTIFIED SEED The community raffle applications for KidSport - $1000, Wiggles 250 tickets sold at $50.00 required: WHEAT is managed by the White- CROP HAIL & Giggles - $1000, White- each. Late model, clean CAT, GO EARLY, PINTAIL. wood Historical Museum ADJUSTERS wood Legion - $1000, JD equip; winch, dump, OATS & Heritage Centre and for the 2021 hail season. Whitewood School (play- gravel trucks, and AC JUNIPER, AC MORGAN, each year, the proceeds trailers. Both camp and (July - October) ground) - $1000, Harmony AC M , DERBY, from the ticket sales are shop locations; R & B USTANG Club - $500, Bird’s Point Semi-retired or retired provided SO1 SUPER OAT. this job is for you! BARLEY Wage negotiable. Competitive salary, all AMISK, BUSBY, CONLON, HIP/KNEE Clean drivers abstract expenses & mileage a must. CDC AUSTENSON, Replacement? paid, health spending Send resume and account and pension CDC MAVERICK, Other medical work references to: plan. We provide CERVEZA, SUNDRE. conditions causing Bryden Construction extensive training using PEAS TROUBLE WALKING )V_(YIVYÄLSK:R our industry leading AAC PEACE RIVER or DRESSING? :,(" crop hail adjusting (VERY EARLY YELLOW), Fax: 306-769-8844 The Disability Tax program. CDC HORIZON (FORAGE), Credit allows for ,THPS! brydenconstruct@ Email: POLISH CANOLA, $2,500 yearly tax xplornet.ca [email protected] SPRING TRITICALE for application form and credit and up to www. mastinseeds.com $50,000 Lump sum brydenconstruction job overview. andtransport.ca 306-569-1852 ext 170. 403-556-2609 refund. Apply NOW; quickest refund Nationwide! Providing assistance during Covid. BELIEVE IT? WANTED Canadian Prairie Pickers Expert Help: Don’t fall victim to DEAD OR ALIVE 1-844-453-5372 sharing fake news are once again touring the area! about COVID-19 online. Paying Cash For Coin Collections,

Learn the four Silver & Gold Coins, Royal Can. Mint Sets. simple steps that Also Buying Gold Jewelry will help you We purchase rolls, bags or boxes of silver coins SPOT fake news online. $ $ PAYING HIGHEST PRICES $ To arrange a free, discrete in-home visit call Watch the video at Bonded since 1967 SPOTfakenews.ca Kellie at 1-778-257-8647

Available Immediately Whitewood Housing You work hard to build your Authority has onebedroom senior suites for rent. Units supplied business. Don’t make people with heat, appliances, private parking and sewer/water. Personal >380,!8&;3)2&@396!6'8W Ph: 306-735-2517

Email to: [email protected] or call: 1-844-GNG-NEWS (Ext. #230)

STILL OPEN FOR BUSINESS We are still here to serve you, at a social distance of course! RENOVATIONS & BOBCAT WORK • Concrete driveways, walks & garage pads installed Contractors and Home • Paving stone driveways & walks installed • Paving stones releveled Free estimates, 24 hour emergency service • Yard clean-up Danny Currie, Journeyman Electrician Directory [email protected] Brian Gordon Fort Qu’Appelle, SK 306-331-6588 echoelectric.ca Locally owned and operated serving fort qu’appelle and 1-306-530-4550 surrounding area call or email today!

-LP·V5RRÀQJ Pole Buildings Home - Kitchen - Bath +RW5RRÀQJ6KLQJOLQJ Everything for your home under one roof. 6QRZ5HPRYDOIURP5RRIV ‡7UDFNKRH‡'R]HU‡/RDGHU • HARDWOOD • CARPET • LAMINATE • LUXURY VINYL )5(((VWLPDWHV ‡*UDGHU‡6NLG6WHHU • TILE • AREA RUGS & MORE ‡+\GUR‡9DF7UXFN‡%DFNKRH Jim Anderson ‡7UXFNV *UDYHO /RZ%R\  ‡6SHFLDOL]LQJLQEDVHPHQWVVHZHUDQGZDVWH ‡&RPPHUFLDO UHVLGHQWLDOIDUPVGXJRXWVHWF 110 - 3rd Ave. W., Melville, SK | 306.725-5432 | 1.877.728.5432 Cell: 1-306-621-6372 carpet1melville.com 12 Livingstone St., Yorkton, SK | 306.782.6556 | 1.888.782.6556 MLPVURRÀQJ#OLYHFD 306-740-7805 or 306-745-7226 carpet1yorkton.com Melville, Sk Whitewood, SK Photos for illustrative purposes only. ©2017 Carpet One Floor & Home. All Rights Reserved.

DO YOU NEED “We specialize in all your building needs” Mr T’s Plumbing Invoices, Business 197 Victoria Ave. We’re here to HELP! and Heating Fort Qu’Appelle Your Success is Our Success. Todd Th rossell Cards or Any Kind Journeyman Plumber Licensed Gas Fitter of Printing? HOURS Your support makes our community Mon. - Fri. 7 a.m. - 5 p.m. stronger by shopping locally! 813 Desmond St., Sat. - 8 a.m. - 4 p.m. P.O. Box 296, Contact: Grenfell, SK Grasslands News 1-306-332-2833 We take pride in servicing S0G 2B0 and serving our community! Ph.: 1-306-697-2727 1-844-464-6397 ext 229 Cell: 1-306-697-7749 www.friestallman.com [email protected] 24 March 5, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Two people warned about the misuse of dialing 911

By Sabrina Bailey a $910 ticket for driving for assault, assault with down the road. One of Fort Qu’Appelle Detachment 160km/h in a 100km/h a weapon and uttering the individuals was ex- zone. threats. tremely intoxicated de- Reporting period: Members executed Police were unable spite being on no alcohol Feb. 23 to March 1 three warrants from to locate the suspect in- conditions. He was ar- Fort Qu’Appelle de- other police services volved in a break-in. The rested for breaching his tachment dealt with 101 while attending a call of subject walked in through order. occurrences over the past a truck stuck in an alley. an unlocked door and An incident in a drive- =$5$//2<'_*5$66/$1'61(:6 week. Crimes Against the took some shoes. thru is still being inves- Traffic Mischief tigated. Moose sighting Two abandoned ve- Person/Property Police are looking for Two individuals were 7KHSRODUYRUWH[WKDWZH·YHH[SHULHQFHGKDV hicles were reported on Members attended a a youth who has been warned about misuse of been hard on wildlife who have been coming Hwy. 10 and 210. Officers call of a possible domes- spotted in people’s yards. 911 this week. The first RXWRIWKHZRRGVLQWKH4X·$SSHOOH9DOOH\WR had no success contacting tic assault. It was deter- The activities have been called the emergency line forage for food. Zara Lloyd photographed the registered owners so mined that the relatively reported as suspicious. to find out if he had court two bull moose and one cow on Hwy. 99 near new relationship had a the next day. The second they were towed due to While conducting pa- Muscowpetung First Nation. being a road hazard. history of violence. The trols members noticed called to find out if he had A driver was issued male is facing charges two males staggering warrants for his arrest.

PUBLIC NOTICES 5(62579,//$*(2)%,5'·632,17 NOTICE 1

Notice of Preparation of Assessment Roll $Q\SHUVRQZKRZLVKHVWRDSSHDODJDLQVWKLVRUKHUDVVHVVPHQWRUFODVVLILFDWLRQLV UHTXLUHGWRILOHKLVRUKHUQRWLFHRIDSSHDO $IHHZLOOEHFKDUJHGUHIXQGDEOH 1RWLFHLVKHUHE\JLYHQWKDWWKHDVVHVVPHQWUROOIRUWKH5HVRUW9LOODJHRI%LUG·V3RLQW LIVXFFHVVIXO E\0D\WKZLWK IRUWKH\HDUKDVEHHQSUHSDUHGDQGLVRSHQWRLQVSHFWLRQLQWKHRIILFHRIWKH The Assessor, $VVHVVRUGXULQJUHJXODURIILFHKRXUV 5HVRUW9LOODJHRI%LUG·V3RLQW Mondays & Tuesdays, P.O. Box 1019 March 5th to May 4th, 2021 Whitewood, SK S0G 5C0 $E\ODZSXUVXDQWWRVHFWLRQRIThe Municipalities ActKDVEHHQSDVVHGDQGWKH 'DWHGWKLVWKGD\RI0DUFK DVVHVVPHQWQRWLFHVKDYHEHHQVHQWDVUHTXLUHG $OLWD6WHYHQVRQ$VVHVVRU NOTICE 2 Notice of Intention to Alter the Boundaries ‡ 6XUIDFH3DUFHO1XPEHUORFDWHGLQWKH6( WKHLUUHDVRQIRUWKHLURSSRVLWLRQRQRUEHIRUH0RQGD\ RIWKH5HVRUW9LOODJHRI%LUG·V3RLQW õ VHFWLRQ  7RZQVKLS  5DQJH  :HVW RI WKH QG 0DUFK   DW  SP $ ZULWWHQ REMHFWLRQ FDQ EH Meridian; and, ILOHGZLWKWKHPXQLFLSDODGPLQLVWUDWRUDWWKHIROORZLQJDG 3XUVXDQWWR6HFWLRQRIThe Municipalities Act 2005, ‡ 6XUIDFH 3DUFHOV    GUHVV 3XEOLFQRWLFHLVKHUHE\JLYHQWKDWWKH5HVRUW9LOODJHRI    DQG  OR 5HVRUW9LOODJHRI%LUG·V3RLQW %LUG·V3RLQWLQWHQGVWRDSSO\WRWKH0LQLVWHURI*RYHUQ FDWHG LQ WKH 1( õ VHFWLRQ  7RZQVKLS  5DQJH  P.O. Box 1019, Whitewood, SK S0G 5C0 PHQW5HODWLRQVWRDOWHULWVERXQGDU\ :HVWRIWKHQG0HULGLDQDVVKRZQRQ6NHWFK´$µ%HORZ (or at [email protected]) 7KH SURSRVHG DOWHUDWLRQ LQYROYHV DGGLQJ WR WKH 5HVRUW Reason for Alteration: Public Meeting: 9LOODJH RI %LUG·V 3RLQW DQG ZLWKGUDZLQJ IURP WKH 5XUDO 7KHUHDVRQWKH5HVRUW9LOODJHLVSXUVXLQJWKLVERXQGDU\ &RXQFLOZLOOKROGDSXEOLFKHDULQJRQ0DUFKQG 0XQLFLSDOLW\RI)HUWLOH%HOW1RWKHODQGVOLVWHGEHORZ DOWHUDWLRQLVWRSURYLGHIRUIXWXUHUHVLGHQWLDOFRPPHUFLDO DWWRSPDWWKH5HVRUW9LOODJH2IILFH%HFDXVHRI DQG VKRZQ LQ EROG GDVKHG RXWOLQHG RQ 6NHWFK ´$µ WKDW DQGOLJKWLQGXVWULDOJURZWKDQGGHYHORSPHQWIRUWKH5H WKH&29,'SDQGHPLFZULWWHQVXEPLVVLRQVWR&RXQ IRUPVSDUWRIWKLVQRWLFH VRUW9LOODJH FLO SHUWDLQLQJ WR WKLV SURSRVHG ERXQGDU\ DOWHUDWLRQ DUH Affected Lands: Public Inspection: VWURQJO\HQFRXUDJHG:ULWWHQVXEPLVVLRQVPXVWEHUH ‡ 6XUIDFHSDUFHO1XPEHUORFDWHGLQWKH6( $Q\SHUVRQPD\VHFXUHLQIRUPDWLRQFRQFHUQLQJWKHSUR FHLYHGE\0RQGD\0DUFKE\SPHLWKHUE\ õVHFWLRQ7RZQVKLS5DQJH:HVWRIWKHUG0H SRVHG ERXQGDU\ DOWHUDWLRQ RQOLQH DW UYELUGVSRLQWFD RU HPDLORUGHSRVLWHGLQWRWKHPDLOVORWDWWKH9LOODJH2IILFH ridian; E\ FRQWDFWLQJ WKH 5HVRUW 9LOODJH 2IILFH ORFDWHG DW  $Q\RQHZLVKLQJWRPDNHDUHSUHVHQWDWLRQUHOHYDQWWRWKH ‡ 6XUIDFH3DUFHO1XPEHUDQG &XUULH $YHQXH EHWZHHQ WKH KRXUV RI  DP WR  SP SURSRVHGDOWHUDWLRQPXVWGRVRE\SKRQH3OHDVHFRQ ORFDWHGLQWKH1(õVHFWLRQ7RZQVKLS5DQJH 0RQGD\DQG7XHVGD\H[FOXGLQJVWDWXWRU\KROLGD\V7KH WDFWWKH9LOODJH2IILFHEHIRUH0RQGD\0DUFK :HVWRIWKHUG0HULGLDQ RIILFHFDQDOVREHUHDFKHGE\SKRQHDW  SP WR VFKHGXOH D WLPH VORW LQ ZKLFK &RXQFLO ZLOO ‡ 6XUIDFH 3DUFHO 1XPEHU   SKRQH\RXGLUHFWO\WRKHDU\RXUFRQFHUQVRUVXJJHVWLRQV  DQG  ORFDWHG LQ WKH $Q\SHUVRQZKRZLVKHVWRREMHFWWRWKHSURSRVHGDOWHU 'DWHGDWWKH5HVRUW9LOODJHRI%LUG·V3RLQW6DVNDWFKH 1:õVHFWLRQ7RZQVKLS5DQJH:HVWRIWKHUG DWLRQPD\ILOHDZULWWHQREMHFWLRQZLWKWKHPXQLFLSDODG ZDQWKLVWKGD\RI)HEUXDU\ Meridian; PLQLVWUDWRUE\PDLORUE\SHUVRQDOGHOLYHU\VWDWLQJFOHDUO\ $OLWD6WHYHQVRQ$GPLQLVWUDWRU ‡ 6XUIDFH3DUFHO1XPEHUORFDWHGLQWKH6( õ VHFWLRQ  7RZQVKLS  5DQJH  :HVW RI WKH QG Meridian; ‡ 6XUIDFH 3DUFHO 1XPEHU  ORFDWHG LQ WKH 6: õ VHFWLRQ  7RZQVKLS  5DQJH  :HVW RI WKH QG0HULGLDQ ‡ 6XUIDFH3DUFHO1XPEHUDQG ORFDWHGLQWKH6(õVHFWLRQ7RZQVKLS5DQJH :HVWRIWKHQG0HULGLDQ ‡ 6XUIDFH3DUFHO1XPEHUDQG ORFDWHGLQWKH1(õVHFWLRQ7RZQVKLS 5DQJH:HVWRIWKHQG0HULGLDQ ‡ 6XUIDFH3DUFHO1XPEHUORFDWHGLQWKH6( õ VHFWLRQ  7RZQVKLS  5DQJH  :HVW RI WKH QG Meridian; ‡ 6XUIDFH 3DUFHO 1XPEHU  DQG  ORFDWHGLQWKH6(õVHFWLRQ7RZQVKLS5DQJH :HVWRIWKHQG0HULGLDQ ‡ 6XUIDFH 3DUFHO 1XPEHU  DQG  ORFDWHGLQWKH6:õVHFWLRQ7RZQVKLS5DQJH :HVWRIWKHQG0HULGLDQ ‡ 6XUIDFH3DUFHO1XPEHUORFDWHGLQWKH6( õ VHFWLRQ  7RZQVKLS  5DQJH  :HVW RI WKH QG Meridian; ‡ 6XUIDFH 3DUFHO 1XPEHU  DQG  ORFDWHGLQWKH1:õVHFWLRQ7RZQVKLS5DQJH :HVWRIWKHQG0HULGLDQ www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 25

ASSESSMENT ROLL 2021 New president for Grenfell Legion VILLAGE OF ABERNETHY Submitted Legion headquarters. gion service dog program was sworn in as the Grasslands News Without these grants, the that purchases and trains new president for 2021. 1RWLFHLVKHUHE\JLYHQWKDWWKHDVVHVVPHQWUROOIRUWKH branch would have seen service dogs for veterans; Out-going president, Don 9LOODJH RI $EHUQHWK\ IRU WKH \HDU  KDV EHHQ SUH an operating loss for the and one to the Legion Kirkham, thanked ev- SDUHGDQGLVQRZRSHQIRULQVSHFWLRQDWWKHRIILFHRIWKH Grenfell Legion 2020 fiscal year but is now Wellness Program, which eryone for their support DVVHVVRU IURP  DP WR  SP RQ WKH IROORZLQJ Branch met on Feb. 24 GD\V7XHVGD\:HGQHVGD\DQG)ULGD\0DUFKWR0D\ in a position to survive primarily provides help during his term as pres- to review activities from  for those suffering from ident and extended con- the previous year and the pandemic. PTSD. gratulations to Cecil for appoint a new president. The poppy campaign $ E\ODZ SXUVXDQW WR 6HFWLRQ  RI The Municipalities At the conclusion of Act It was the first regular in 2020 generated more in his upcoming tenure as KDVEHHQSDVVHGDQGWKHDVVHVVPHQWQRWLFHVKDYH meeting in many months donations than ever be- the meeting Cecil Leech president. EHHQVHQWDVUHTXLUHG fore. This money directly and was well attended, $Q\ SHUVRQ ZKR ZLVKHV WR DSSHDO DJDLQVW KLV RU KHU with social distancing benefits veterans and the Legion appreciates all the DVVHVVPHQWLVUHTXLUHGWRILOHKLVRUKHUQRWLFHRIDSSHDO and other health guide- ZLWK 7KH $VVHVVRU 9LOODJH RI $EHUQHWK\ %R[  people of Grenfell who do- lines carefully followed. $EHUQHWK\6.6$$E\WKHWKGD\RI0D\ Committee reports nated by wearing poppies were minimal since most or buying wreaths and 'DWHGWKLVWKGD\RI0DUFK events have been sus- certificates, as well as all pended due to COVID-19 those who contributed Sheree Emmerson concerns. by e-transfer from out of Assessor Members spent time town. 7,36 reviewing the year-end Members agreed to finances for 2020. Grants make two donations from were received from the the poppy fund: one to NOTICE OF PREPARATION RM of South Qu’Appelle No. 157 federal government and Paws for a Cause, the Le- Seasonal Equipment Operator OF ASSESSMENT ROLL and Seasonal Mower Operator ASSESSMENT ROLL NOTICE Resort Village of West End Rural Municipality of McLeod No. 185 The Rural Municipality of South Qu’Appelle No. 157 is Notice is hereby given that the Assessment Roll for the seeking applicants for Seasonal Equipment Operator and 1RWLFHLVKHUHE\JLYHQWKDWWKH$VVHVVPHQW5ROORIWKH5XUDO Resort Village of West End for the year 2021 has been prepared Seasonal Mower Operator. 0XQLFLSDOLW\ RI 0F/HRG 1R  IRU WKH \HDU  KDV EHHQ and is open to inspection in the office of the assessor from SUHSDUHG DQG LV QRZ RSHQ WR LQVSHFWLRQ DW WKH 2IILFH RI WKH 9 a.m. to 12 p.m. and 1 to 5 p.m. on the following days: For details, please visit the RM of South Qu’Appelle No. $VVHVVRUIURPDPWRQRRQDQGWRSP Monday’s and Tuesday’s, March 8, 2021 to May 12, 2021. 157 website at: www.rm157.ca 0RQGD\0DUFKWKURXJK7KXUVGD\0D\ A bylaw pursuant to section 214 of The Municipalities Act  $%\ODZSXUVXDQWWR6HFWLRQRIThe Municipalities Act Applicants are invited to submit a resume indicating of KDVEHHQSDVVHGDQGDVVHVVPHQWQRWLFHVKDYHEHHQVHQWDV has been passed and the assessment notices have been sent UHTXLUHG as required. QVIYLSH[LKZHML[`JV\YZLZHUKJLY[PÄJH[LZHJOPL]LKX\HS  $Q\SHUVRQZKRGHVLUHVWRDSSHDODJDLQVWKLVRUKHUDVVHVV Any person who wishes to appeal against his or her PÄJH[PVUZL_WLYPLUJLHUK^VYRYLMLYLUJLZ(+YP]LYZ(I PHQWLVUHTXLUHGWRILOHKLVRUKHUQRWLFHRIDSSHDODORQJZLWKD assessment is required to file his or her notice of appeal, stract and a current Criminal Record Check must accom- DSSHDOIHHZKLFKZLOOEHUHWXUQHGLIWKHDSSHDOLVVXF accompanied by a $50.00 appeal fee which will be returned pany resume. FHVVIXOZLWK if the appeal is successful, with the Assessor, Resort Village $LOHHQ6ZHQVRQ (WWSPJH[PVU+LHKSPUL!WT-YPKH`4HYJO[V! of West End, P.O. Box 1765, Esterhazy, SK. S0A 0X0, or to B. *RUG.ULVPHU $VVRFLDWHV RM of South Qu’Appelle No. 157, Junek, Secretary Board of Revision, P.O. Box 334, Stockholm, *RUGRQ5RDG P.O. Box 66, Qu’Appelle, SK S0G 4A0 5HJLQD6.660 SK. S0A 3Y0 by the 12th day of May, 2021.  $SSHDOVPXVWEHILOHGE\7KXUVGD\0D\ Fax: (306)-699-2671 - Email: [email protected]  'DWHGDW1HXGRUI6DVNWKLVWKGD\RI0DUFK Dated this 5th day of March, 2021 Only those applicants selected for an interview will be 7DUD+DUULV$VVHVVRU Lorrayne Smith, Assessor contacted.

PUBLIC NOTICE Automotive and Service Zoning Bylaw 50RI1257+48·$33(//(12 Directory  38%/,&127,&(LVKHUHE\JLYHQWKDWWKH&RXQFLORIWKH50RI1RUWK4X·$SSHOOH1R LQWHQGVWRDGRSWDE\ODZXQGHUThe Planning and Development Act 2007WRDPHQG %\ODZ1RNQRZQDVWKH=RQLQJ%\ODZ INTENTED OW TOWING SERVICES  7KHSURSRVHGE\ODZZLOO 24 Hour Service   7KH=RQLQJ'LVWULFW0DSUHIHUUHGWRLQ6HFWLRQ=RQLQJ'LVWULFWVLVDPHQGHGE\ Cell: 306-331-8833   UH]RQLQJIURP$$JULFXOWXUDOWR55HVLGHQWLDO'LVWULFW /RZ'HQVLW\ WKHSRUWLRQ  RIWKH1RUWK(DVW: :UHFNPDVWHU&HUWLÀHG AFFECTED LAND 6*,6WRUDJH&RPSRXQG Ervin Wolfe  7KHDIIHFWHGODQGLVOHJDOO\GHVFULEHGDVSDUWRIWKH1RUWK(DVW:DVVKRZQ )UHH8QZDQWHG&DU5HPRYDO /RFNRXWVERRVWLQJDQGZLQFKLQJ Product Advisor RQWKHIROORZLQJPDS [email protected] Cell 306-533-5945

306-331-8833 655 Broad Street, Regina, Sask 1-800-667-9976 – taylorautogroup.ca

Wholesale Transmission SHANNON & Differential Wholesale Prices ,PSRUWV 'RPHVWLFV2YHUKDXOV)UHH5RDG7HVWV TRANSPORT All Makes & Models Rebuilt in Our Own Shop + Differential +CVA Joints + Clutches + #1 in the bin, since 1982 + Universal Joints + Drive Shafts + 4X4 Transfer Cases + ´7KH3ULFH:H4XRWH··LVWKH3ULFH

NFE project to implement the to see. the new devices. to change his or her be- E L R L G ASSESSMENT signage was approved on “Along with this initia- After a meeting on haviour upon being given May 5, 2019. tive, the City of Melville March 1, council ap- immediate feedback as 1882 It was then that also implemented our proved that the informa- the result of their actions, S ROLL NOTICE A S A N Melville City Council transportation master tion from the report on as well as an opportunity K ATCHE W Town of Grenfell approved the RFP sub- plan, adding 65 new yield the signs is presented to change those actions. Notice is hereby given that the Assessment Roll of the mitted from Airmaster signs and 53 new stop to the RCMP as well as In the case of traffic calm- Town of Grenfell for the year 2021 has been prepared and is Signs to purchase nine signs, making every in- local schools as an infor- ing, the radar readout is open to inspection in the office of the Assessor from 9 a.m. to Driver Feedback Radar tersection within the City mational and educational the warning to avoid the 12 p.m. and 1 p.m. to 4:30 p.m. on the following days: Monday signs, eight School Zone of Melville a controlled resource. nasty shock of receiving a to Friday, March 3, 2021 to May 3, 2021. Blinker signs, five Park one,” added McCullough. “Radar signs provide speeding ticket. A bylaw pursuant to section 214 of The Municipalities Act Zone Blinker signs, and Prior to 2020, the city immediate feedback,” ex- “Studies show radar has been passed and the assessment notices have been sent two Dual Sided Button had a number of intersec- plains McCullough. speed signs reduce speed- as required. Activated Crosswalk tions that had no signage “Unlike typical street ing by five to 10 per cent,” Any person who wishes to appeal against his or her signs. on all four ways, leaving signs that only post the says McCullough. assessment is required to file his or her notice of appeal with: “City crews started it to motorists under- speed limit, radar signs “Even better, their im- The Assessor, Town of Grenfell, P.O. Box 1120, Grenfell, SK S0G installing steel posts in standing of right of way also display the current pact on drivers’ behav- 2B0, by the 3rd day of May, 2021. the designated areas in from their earlier days speed of an approaching ior has been shown to Dated this 3rd day of March, 2021. preparation for the ar- studying for their driv- motorist. By providing endure for several kilo- rival of the signs,” said meters after the sign has Brenna Ackerman, Assessor er’s test. such feedback, these signs city manager Ron Mc- Needless to say, the ignite what psychologists been passed. Given this, Cullough.” rarity of uncontrolled call a feedback loop.” it comes as no surprise During the weeks of intersections in North In simple terms, a that police agencies and PROPERTY FOR June 15 to June 26, city America leads to such feedback loop is a form safety experts rate these crews assembled, pro- knowledge being forgot- of behaviour modifica- signs as the number one SALE BY TENDER grammed, and installed ten and it was especially tion where a warning tool for producing an im- Village of Lebret all 17 traffic calming puzzling for those visiting increases the chances of mediate and long-lasting signs, and at that time from out of town who, avoiding negative rein- reduction in speeding.” 1. Under the provision of The Tax Enforcement Act, the started collecting data perhaps, until visiting forcement. -££!+'3('#8';3ø'89(389!£';,'(3££3>-2+6836'8ধ'9V from the nine Driver Melville, had never seen A basic example of this LOT 13-15 BLK/PAR 11 PLAN NO BI3055 11 St. Joseph Street ‰W;'2&'81<9;#'9<#1-ħ'&-2!9'!£'&'2='£36' marked “Property Tender” addressed to the Village of INVITATION TO BID ASSESSMENT ROLL Lebret, P.O. Box 40 LEBRET SK S0G 2Y0.  9LOODJHRI)HQZRRGLQYLWHV&RQWUDFWRUVWRSURYLGHDELGIRUWKH Town of Broadview 3. Tenders must be postmarked by 4 pm, on March 30, UHSODFHPHQWRIDFXOYHUWRQQG$YH  )RULQIRUPDWLRQUHJDUGLQJWKLVSURMHFW\RXPD\FRQWDFW 2021. Village of Fenwood 306-728-2185 1RWLFHLVKHUHE\JLYHQWKDWWKHDVVHVVPHQWUROOIRU ‹W$'8ধ)'&$,'7<';3;,'1<2-$-6!£-;@(38ˆ‡¦3(the [email protected] WKH7RZQRI%URDGYLHZIRUWKH\HDUKDVEHHQ amount of the tender must accompany the tender. 7KH2ZQHUUHVHUYHVWKHULJKWWRDFFHSWRUUHMHFWDQ\RUDOO%LGVDQG SUHSDUHGDQGLVRSHQWRLQVSHFWLRQLQWKHRIILFHRIWKH '2&'899<#1-ħ'&>-;,3<;$'8ধ)'&(<2&9>-££23;#' WRZDLYHLUUHJXODULWLHVDQGLQIRUPDOLWLHVDWLWVGLVFUHWLRQ7KH2ZQHUUH considered. VHUYHVWKHULJKWWRDFFHSWDELGRWKHUWKDQWKHORZHVW%LGZLWKRXWVWDWLQJ $VVHVVRU IURP  DP WR  QRRQ DQG  SP UHDVRQV%\WKHDFWRIVXEPLWWLQJLWVELGWKH%LGGHUZDLYHVDQ\ULJKWWR 5. Highest, or any tender, not necessarily accepted. WRSPRQWKHIROORZLQJGD\V0RQGD\WR)ULGD\ FRQWHVWLQDQ\OHJDOSURFHHGLQJRUDFWLRQWKHULJKWRIWKH2ZQHUWRDZDUG IURP0DUFKWR0D\ 6. Successful bidder will have 45 days to provide the WKHZRUNWRZKRPHYHULWFKRRVHVLQLWVVROHDQGXQIHWWHUHGGLVFUHWLRQ DQGIRUZKDWHYHUUHDVRQVWKH2ZQHUGHHPVDSSURSULDWH:LWKRXWOLPLWLQJ  $E\ODZSXUVXDQWWRVHFWLRQRIThe Municipali- balance of cash to complete the purchase. The deposit WKHJHQHUDOLW\RIWKHIRUHJRLQJWKH2ZQHUPD\FRQVLGHUDQ\RWKHUIDFWRU will be forfeited if the successful bidder does not EHVLGHVSULFHDQGFDSDELOLW\WRSHUIRUPWKHZRUNWKDWLWGHHPVLQLWVVROH ties ActKDVEHHQSDVVHGDQGWKHDVVHVVPHQWQRWLFHV )2!£-A';,'!+8''1'2;(389!£'>-;,-2;,'8'7<-8'&ধ1'W GLVFUHWLRQWREHUHOHYDQWWRLWVGHFLVLRQ&RQWUDFWRUVPXVWSURYLGHSURRIRI KDYHEHHQVHQWDVUHTXLUHG 0LQOLDELOLW\LQVXUDQFHDQG:&%&RYHUDJHXSRQDZDUG W£££'+!£$39;9Tধ;£';8!29('8(''9!2&!66£-$!#£';!?'9 RIFRQWUDFW  $Q\SHUVRQZKRZLVKHVWRDSSHDODJDLQVWKLVRUKHU are the responsibility of the purchaser and are in GENERAL CONDITIONS & INSTRUCTIONS: DVVHVVPHQWRUFODVVLILFDWLRQWRWKH%RDUGRI5HYLVLRQ addiধ32;3;,'#-&68-$'W Scope of Work  7KH&RQWUDFWRUVKDOOIXUQLVKDOOODERXUHTXLSPHQWDQGPDWHULDO LVUHTXLUHGWRILOHKLVRUKHUQRWLFHRIDSSHDODFFRP 8. Agreement signed upon sale. WRSHUIRUPWKHZRUNDVVSHFLILHGKHUHLQ SDQLHGE\DDSSHDOIHHZKLFKZLOOEHUHWXUQHG  7KHZRUNLQJHQHUDOVKDOOLQFOXGH LIWKHDSSHDOLVVXFFHVVIXOZLWK7KH$VVHVVRU7RZQ Dated the 1st day of March, 2021.  ‡5HPRYDO ,QVWDOODWLRQRI&XOYHUW Time of Completion RI%URDGYLHZ32%R[0DLQ6WUHHW%URDG Caroline MacMurchy, Administrator  7KHZRUNVKDOOEHIXOO\FRPSOHWHGRQRUSULRUWR6HSWHPEHU XQOHVVPXWXDOO\DJUHHGXSRQE\ERWKSDUWLHV YLHZ6DVN6*.E\WKHWKGD\RI0D\ Village of Lebret  ,QWHUHVWHG SDUWLHV PD\ FRQWDFW WKH YLOODJH RIILFH DW   'DWHGWKLVWKGD\RI0DUFK RUHPDLOYLOODJHRIIHQZRRG#VDVNWHOQHWWRDUUDQJHIRUDVLWH Mervin J. Schmidt WRXU  $OO%LGVPXVWEHUHFHLYHGE\7XHVGD\$SULO Assessor ASSESSMENT ROLL 2021 Town of Balcarres

Notice is hereby given that the assessment roll for the Town of Balcarres for the year of 2021 has been prepared and is now open to inspection in the office of the assessor from 8:00 a.m. to 12:00 noon and 1:00 p.m. to 4:00 p.m. Monday to Friday, March 5, 2021 to May Grasslands News WIN 4, 2021. A bylaw pursuant to Section 214 of $100$100 The Municipalities Act has been passed and contest CASH!CASH! the assessment notices have been sent as Photo required. Any person who wishes to appeal against We want your winter & summer his/her assessment to the Board of Revision FUN PHOTOS is required to file his/her complaint(s) in writ- Email your photos to [email protected] for your chance to win $100 cash! ing with: The Assessor, Town of Balcarres, Photos collected may be featured in an upcoming P.O. Box 130, Balcarres SK. S0G 0C0 by 8!99£!2&9'>9 83<66<#£-$!ধ32W May 4, 2021. Dated at Balcarres, Sask., March 5, 2021. WIN a $100 CASH! Mark Hartman 1!-£@3<8,-+,8'93£<ধ329<11'8!2&>-2;'8(<26,3;39;3!&9|+8!99£!2&92'>9W$! and you’ll be entered to win $100 dollars CASH! Assessor Draw will be made May 1, 2021. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV March 5, 2021 27

Camping in Saskatchewan 2021 Time to plan your summer get-away, as the Saskatchewan Provincial Parks will open for reservations for season camp sites on April 12 and nightly/group camping on April 14. Saskatchewan Provincial Park reservations opening in April

Reservations for the 2021 camping season at Sas- Laura Ross said. “Our provincial parks provide many • April 16 - Bronson Forest, Meadow Lake, Makwa katchewan’s Provincial Parks are set to begin April 12 options for safe and local summer vacations, with so Lake, Lac La Ronge for seasonal campsites and on April 14-23 for nightly much to see and do. Sask Parks staff are looking for- • April 19 - Saskatchewan Landing, Douglas, Danielson and group campsites. ward to welcoming visitors and their families back to • April 20 - Buffalo Pound, Rowan’s Ravine, Echo Val- “With the recent cold snap across the province, the parks for another memorable year.” ley, Crooked Lake many folks are anticipating summer and this year’s In early 2020, Sask Parks launched a competitive • April 21 - Cypress Hills camping season,” Parks, Culture and Sport Minister process for a vendor that could provide an enhanced • April 22 - Duck Mountain, Good Spirit Lake, Green- reservation and campground management system. As- water Lake pira was selected as the vendor and comes with more • April 23 - Candle Lake, Great Blue Heron, Moose than 30 years of experience providing reservation Mountain platforms for government park agencies across North Fee changes for 2021 include a $1 increase in nightly America. electric sites, now $33 a night, and a $1 increase in Prior to reservations opening, customers should full-service nightly sites, now $43 a night. The new plan to create a new account once the site is available full-service seasonal sites offered at Greenwater Lake in April. Online tutorials will be offered to help guide and Meadow Lake provincial parks are $3,400. All users through this process. other fees remain the same from 2020. Customers will also want to note that reservations will begin at 7 a.m. each day - there is no longer a need to log on at 6:40 a.m. in order to be placed in the queue. The complete reservation schedule is as follows: LOOK HERE! • April 12 - Seasonal campsites for all parks offering seasonal camping You just proved even small ads get noticed • April 14 - Pike Lake, The Battlefords, Narrow Hills, 1-844-GNG-NEWS – DGV#JUDVVODQGVQHZVFD GFL IS HIRING! Blackstrap We’re looking for an experienced Vacuum Truck Operator to join our team working in the Rocanville and Esterhazy Area, requirements are: • 1A or 3A Saskatchewan driver’s license with a clean driver’s abstract • Industrial vacuum truck and hydro-excavating experience Help keep your • Exceptional customer service skills community’s • Safety-focused attitude with experience working in an industrial setting history alive.

Join Team Green – SUBSCRIBE TO YOUR apply online today at LOCAL NEWSPAPER! gflenv.com/current-opportunities Questions? Call Toll Free: CAREER Call our HR team at 306-244-9500 1-844-GNG-NEWS Green Today. Green For Life. gflenv.com [email protected] OPPORTUNITY       is currently seeking a Journeyman Autobody Technician/ Painter to help meet the demand of our bustling state of the art business.   V • A great team atmosphere 8!-8-'3f36-93>$$'6ধ2+66£-$!ধ329(38;,' 3££3>-2+ • The highest wages in the industry 39-ধ329!;'£=-££' 33&'2;8'V j316'ধধ=''2');9!$0!+' • Grocery Department Manager • State of the art facility with the latest and the best '7<-61'2;!=!-£!#£' • Deli Department Manager • Produce Department Manager We are both SGI and MPI accredited and draw from a For further details please email [email protected], call large area both in Saskatchewan and Manitoba. 306-728-5437 or visit our website www.prairiecoop.com. If you are interested in working with a winning team £'!9'(38>!8&@3<88'9<1';3;@£'81|$'£'#8!ধ32(38&W <#1-;@3<8!66£-$!ধ32!2&8'9<1';3V,8|68!-8-'$336W$31f $3138/!1'9|$'£'#8!ধ32(38&W$31 ħ'2ধ32;3V <1!2'93<8$'9T38#@1!-£;38!-8-'3f36'8!ধ=' Or in person at in Limited, P.O. Box 1330, Melville, SK SOA 2P0. ˆ¥‰‡'£'#8!ধ328-=' 33931-2 !90W!££ˆfŠ‡¤f‹ŠŒfŠŠˆŠ ';,!20@3<(38@3<8!66£-$!ধ32T,3>'='832£@;,39'9'£'$;'& for interview will be contracted. 28 March 5, 2021 Melville Advance Grasslands News

Blue Chip Realty SERVING MELVILLE AND AREA www.remax-bluechip-yorkton-sk.ca 269A Hamilton Road, Yorkton, SK Phone: 306-783-6666 Each Offi ce is Independently Owned & Operated $54,900, $47,000 Includes Empty Lots on Lisa Kirkwood Both Sides of House Shawn Pryhitka Residential Specialist Agriculture Specialist 306-728-6789 306-621-9798 [email protected] [email protected] 358 - 5th Ave. W. 327/333 - 6th Ave. E. MLS®SK836017 MLS®SK804573

$60,000 $79,900 $87,000 $96,900 $119119,900,900 PRICE REDUCED PRICE REDUCED

368 Manitoba St. 256 - 6th Ave. E. 301 - 5th Ave. E 572 - 4th Ave. W. 829 Main St. MLS®SK826083 MLS®SK7840724 MLS®SK810235 MLS®SK 839687 MLS®SK824177

$135,000 $134134,000,000 $159,000 $175175,000,000 $199,500 PRICE REDUCED PRICE REDUCED

Duplex 202 - 5thhA Ave. W. 329 - 3rd Ave. W. 374 - 8th Ave. W. 528 Main St. 423 - 9th Ave. W. MLS®SK839162 MLS®SK823956 MLS®SK834381 MLS®SK 839454 MLS®SK817235

$245,000 $289,900 $329,000 $19,500 $125,000

7 Carlton Bay 8 Carlton Bay 799 - 1st Ave. E. Lot 60A, Grenfell Beach 108 Indian Point, Crooked MLS®SK809915 MLS®SK813274 MLS®SK 839913 MLS®SK 840906 Lake MLS®SK814800

$100,000 $39,900 $69,900 $77,000 $359,000

537 - 5th St. NE - Ituna 223 Main St., Neudorf 310 Main St. - Neudorf 205 Taylor St. - Neudorf 208-210 Criddle Ave - MLS®SK823881 MLS®SK827582 MLS®SK837324 MLS®SK815620 Crooked Lake MLS®SK817614

$272,500 $3,439,800 $649,000 $575,000 $300300,000,000 JUST LISTED

RM of Foam Lake RM of Insinger RM of Good Lake RM of Stanley #215 - RM of Orkney, York Lake MLS®SK839581 MLS®SK839586 MLS®SK817569 Land MLS®SK833880 Land MLS®SK42430

$1,8901,890,000,000 $490,000 $499,000 $285,000 $LIST TODAY JUST LISTED Looking to Buy or Sell?

Call Us Before Your Next Move! RM of Orkney, York Lake RM of Preeceville RM of Wallace #243 - RM of Willowdale #153 Your Address Land MLS®SK42430 MLS®SK839593 Acreage MLS®SK817645 MLS®SK838401 MLS®SK