DOCSLIB.ORG

(12) United States Patent (10) Patent No.: US 8,999,335 B2 Cojocaru Et Al

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(12) United States Patent (10) Patent No.: US 8,999,335 B2 Cojocaru Et Al US00899.9335B2 (12) United States Patent (10) Patent No.: US 8,999,335 B2 Cojocaru et al. (45) Date of Patent: Apr. 7, 2015 (54) COMPOSITIONS AND METHODS FOR (56) References Cited TREATMENT OF DRUG RESISTANT MULTIPLE MYELOMA U.S. PATENT DOCUMENTS (75) Inventors: Gad S. Cojocaru, Ramat HaSharon (IL); 6,979,557 B2 12/2005 Isogai et al. Haiming Chen, West Hills, CA (US); 7,411,051 B2 8, 2008 Rosen et al. 2003/0219741 A1 11/2003 Isogai et al. James Berenson, Beverly Hills, CA 2004/0241803 A1 12/2004 Rosen et al. (US) 2006, OO68405 A1 3/2006 Diber et al. (73) Assignee: Compugen Ltd., Tel Aviv (IL) 2007, OO15163 A1 1/2007 Isogai et al. 2007/0O37741 A1 2/2007 Baldwin et al. (*) Notice: Subject to any disclaimer, the term of this 2007/0224663 A1 9, 2007 Rosen et al. patent is extended or adjusted under 35 2008/0057519 A1* 3/2008 McWhirter .................. 435/723 2010, O144538 A1 6, 2010 Belouchi et al. U.S.C. 154(b) by 0 days. 2010/0286.048 A1 11/2010 Rosen et al. (21) Appl. No.: 13/821, 176 2011/00594.71 A1 3/2011 Yamashiro et al. (22) PCT Filed: Sep. 16, 2011 FOREIGN PATENT DOCUMENTS (86). PCT No.: PCT/B2O11AO54060 EP 1293569 A2 3, 2003 EP 2264071 A1 12/2010 S371 (c)(1), WO 02070539 A2 9, 2002 (2), (4) Date: Jun. 21, 2013 WO 03090694 A2 11/2003 WO 2004081199 A2 9, 2004 (87) PCT Pub. No.: WO2012/035518 WO 2004/110369 A2 12/2004 WO 2006O20266 A2 2, 2006 PCT Pub. Date: Mar. 22, 2012 WO 2008112177 A2 9, 2008 WO WO 2009113649 A1 * 9, 2009 (65) Prior Publication Data WO 201OO673O8 A2 6, 2010 US 2013/026651O A1 Oct. 10, 2013 OTHER PUBLICATIONS Related U.S. Application Data ISR for PCT/IB2011/O54060 mailed Feb. 1, 2012. PCT search report for parent PCT Application No. PCT/IB2009/ (60) Provisional application No. 61/383,784, filed on Sep. 055585, mailed Jun. 22, 2010. 17, 2010. Office action for corresponding EP Application No. 097994.024. mailed Jan. 25, 2013. (51) Int. Cl. OA for IL 213300 mailed Aug. 22, 2013. A6 IK39/00 (2006.01) ER for AU 2009325878 mailed Jul. 3, 2013. A 6LX39/395 (2006.01) Genbank accession No. AAH6O775. 1; from 2002. A6 IK3I/713 (2006.01) Genbank accession No. AAH 19600.1; from 2002. C07K 6/30 (2006.01) NCBI accession No. NP 689893.1; from 2007. CI2N IS/II3 (2010.01) Genbank Accession No. EAXO4974. 1; from 2001. GOIN33/574 (2006.01) Genbank Accession No. EAXO4975. 1; from 2001. Office action for corresponding Chinese Application No. A6 IK 45/06 (2006.01) 200980 155730.6. mailed on Mar. 15 2013. CI2O I/68 (2006.01) Office action for corresponding Chinese Application No. GOIN33/68 (2006.01) 200980 155730.6. mailed on Oct. 31 2013. (52) U.S. Cl. Office Action for IL 213300 mailed Mar. 23, 2014. CPC ........... A61K.39/3955 (2013.01); A61 K3I/713 (2013.01); A61 K39/39558 (2013.01); A61 K * cited by examiner 2039/505 (2013.01); C07K 16/3061 (2013.01); C07K 2317/73 (2013.01); C07K 2317/732 Primary Examiner — Daniel C Gamett (2013.01); C07K 2317/77 (2013.01); C07K (74) Attorney, Agent, or Firm — Graeser Associates 2319/30 (2013.01); C12N 15/1138 (2013.01); International Inc.; Dvorah Graeser CI2N 2310/11 (2013.01); C12N 2310/12 (2013.01); C12N 23 10/14 (2013.01); G0IN (57) ABSTRACT 33/57426 (2013.01); A61K 45/06 (2013.01): This invention relates to a novel target for production of CI2O I/6886 (2013.01); G0IN33/6893 immune and non-immune based therapeutics and for disease (2013.01) diagnosis. More particularly, the invention provides thera (58) Field of Classification Search peutic antibodies against TMEM154 antigens, which are dif CPC ........... A61 K31/713; A61K 2039/505; A61 K ferentially expressed in cancer, and diagnostic and therapeu 39/00; G01N 33/6893; C07K 16/3061; C07K tic usages, wherein the cancer is relates to multiple myeloma, 2317/73; C07K 2317/732; C07K 2317/77; including multiple myeloma precursor diseases. This inven C07K 2319/30; C07K 16/28: C07K 16/30; tion further relates to extracellular domains of TMEM154 C07K 2317/55; C12N 15/1138; C12N 2310/11; proteins and variants, and therapeutic usages thereof. C12N 2310/12: C12N 2310/14 See application file for complete search history. 11 Claims, 20 Drawing Sheets U.S. Patent Apr. 7, 2015 Sheet 5 of 20 US 8,999,335 B2 ATGCAGGCTCCCCGCGCAGCCCAGCTCGCCCTGGGACGCGCCGTCCCGCGGCCGG GGAAT AGAGGAATTAGAAAACCAGGAGATACAAC GTGGAATCGAAAGACCAAATAAA GTGACACCAAGCACATT GCGCAGTGACCACAAAGAAACATTAAATGCAAAATAAAT CTACCAACTTTGCTCCGGAGAAAATCAGTTAGAGTTATACTGAGGTGAACCCATTG ATTATGGTCCTCTACTTACCGTGGATTCCTGCAACAACAAAAAGAAAAAGAA CAAACAAGAACCCAGCCAAGGATCTCAGAGGCTTACAGACAATGAACTGGGAAG GAAAACGTGAAAGTCCCTATTTTGAGGAAGATACACCCCTGTATGGAAATTGAAAGGA AGAGCTTGAAAAGGATGAACAGCAGAAAGAAAGCCGACTTGAATGTACCTACCTT GAAGGAAGAGAAGGAATCAAATCACAACCCAAGGACAGTGAACCGACACAAAGACGAT GACGACAAGAA FG. 3 MOAPRAALVFALVIALVPVGRGNYEELENSGDTTVESERPNKVTIPSTFA AVTIKETLNANINSTNFAPDENOLEFILMVLIPLLVLLLLSWFLATY YKRKRTKOEPSSOGSQSALOTYELGSENVKVPFEEDTPSVMEEMEELD KWMNSMNRNADFECLPLKEEKESNHNPSDSESDYKDDDDK FG. 4 U.S. Patent Apr. 7, 2015 Sheet 6 of 20 US 8,999,335 B2 FG 5A FG FIG. 6A FIG. 6B U.S. Patent Apr. 7, 2015 Sheet 7 of 20 US 8,999,335 B2 FIG 7A FIG. 7B FIG. 8A FIG. 8B FG. 8C U.S. Patent Apr. 7, 2015 Sheet 8 of 20 US 8,999,335 B2 FIG. 9A - 1 FG. 9A - 2 FIG. 9A-3 FIG 9A" 4 U.S. Patent Apr. 7, 2015 Sheet 9 of 20 US 8,999,335 B2 FG. 9B-1 FIG. 9B-2 FG 9 B-3 U.S. Patent Apr. 7, 2015 Sheet 10 of 20 US 8,999,335 B2 FIG. 9C - 1 FIG. 9C - 2 FG. 9C-3 U.S. Patent Apr. 7, 2015 Sheet 12 of 20 US 8,999,335 B2 U.S. Patent Apr. 7, 2015 Sheet 13 of 20 US 8,999,335 B2 75 1. 5 O 1.l 57O2 O5O5 2 5 as1. NE Y-E En YE NE nE NE Y.E nE NE H d O O O O O O Sa 5 to5 c.s is3 is 9is &is 3is TM21-ANTIBODY 103 100 FG. 12B ANNEXIN V U.S. Patent CNNNNNNNN í,y^^) IZUZ |u/370GIZWI |u/370OIIZWI FG, 13C U.S. Patent Apr. 7, 2015 Sheet 19 of 20 US 8,999,335 B2 U.S. Patent Apr. 7, 2015 Sheet 20 of 20 US 8,999,335 B2 s irer sS hs 5 O H. H. - races cr (r. O. O. He 48 a CN YO C 5 N. N. CN? electice a s CD ti - O C - s E. C-5 - 2 O CP s re C C C C C co c S. S2 CO d s CN C (TOLNOOO %) ALITIS WIN TO US 8,999,335 B2 1. 2 COMPOSITIONS AND METHODS FOR “magic bullets' that would deliver toxic agents. Such as drugs, TREATMENT OF DRUG RESISTANT toxins, enzymes and radioisotopes, specifically to the dis MULTIPLE MYELOMA eased site and leaving the non-target normal tissues unaf fected. Indeed, antibodies, and in particular antibody frag FIELD OF THE INVENTION ments, can function as carriers of cytotoxic Substances Such as radioisotopes, drugs and toxins. Immunotherapy with Such The present invention relates to compositions and methods immunoconjugates is more effective than with the naked for treatment of drug resistant cancer, and in particular, but antibody. not exclusively, to TMEM154 related polypeptides and poly With the advent of antibody engineering, small molecular nucleotides as Suitable targets and/or candidates for develop 10 weight antibody fragments exhibiting improved tumor pen ment of therapeutics and diagnostics, particularly for cancer etration have been generated. Such antibody fragments are therapy and treatment of immune related disorders. often conjugated to specific cytotoxic molecules and are designed to selectively deliver them to cancer cells. Still, solid BACKGROUND OF THE INVENTION tumors remain a formidable challenge for therapy, even with 15 immunoconjugated antibody fragments. Tumor antigens are ideally positioned as biomarkers and The new wave of optimization strategies involves the use of drug targets, and they play a critical role in the development of biological modifiers to modulate the impediments posed by novel strategies for active and passive immunotherapy agents, solid tumors. Thus, in combination to antibodies or their to be used as stand-alone therapies or in conjunction with conjugated antibody fragments, various agents are being used conventional therapies for cancer. Tumor antigens can be to improve the tumor blood flow, enhance vascular perme classified as either tumor-specific antigens (TSAs) where the ability, lower tumor interstitial fluid pressure by modulating antigens are expressed only in tumor cells and not in normal stromal cells and extracellular matrix components, upregu tissues, or tumor-associated antigens (TAAS) where the anti late expression of target antigens and improve penetration gens are overexpressed in tumor cells but nonetheless also and retention of the therapeutic agent. present at low levels in normal tissues. 25 Immunotherapy with antibodies represents an exciting TAAS and TSAS are validated as targets for passive (anti opportunity for combining with Standard modalities, such as body) therapy as well as active immunotherapy using strate chemotherapy, as well as combinations with diverse biologi gies to break immune tolerance and stimulate the immune cal agents to obtain a synergistic activity. Indeed, unconju system. The antigenic epitopes that are targeted by these gated mAbs are more effective when used in combination therapeutic approaches are present at the cell Surface, over 30 with other therapeutic agents, including other antibodies. expressed in tumor cells compared to non-tumor cells, and are Passive tumor immunotherapy uses the exquisite specific targeted by antibodies that block functional activity, inhibit ity and lytic capability of the immune system to target tumor cell proliferation, or induce cell death. specific antigens and treat malignant disease with a minimum There are a growing number of tumor-associated antigens of damage to normal tissue.
Load more

Recommended publications
  • Protein Identities in Evs Isolated from U87-MG GBM Cells As Determined by NG LC-MS/MS
    Protein identities in EVs isolated from U87-MG GBM cells as determined by NG LC-MS/MS. No. Accession Description Σ Coverage Σ# Proteins Σ# Unique Peptides Σ# Peptides Σ# PSMs # AAs MW [kDa] calc. pI 1 A8MS94 Putative golgin subfamily A member 2-like protein 5 OS=Homo sapiens PE=5 SV=2 - [GG2L5_HUMAN] 100 1 1 7 88 110 12,03704523 5,681152344 2 P60660 Myosin light polypeptide 6 OS=Homo sapiens GN=MYL6 PE=1 SV=2 - [MYL6_HUMAN] 100 3 5 17 173 151 16,91913397 4,652832031 3 Q6ZYL4 General transcription factor IIH subunit 5 OS=Homo sapiens GN=GTF2H5 PE=1 SV=1 - [TF2H5_HUMAN] 98,59 1 1 4 13 71 8,048185945 4,652832031 4 P60709 Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 - [ACTB_HUMAN] 97,6 5 5 35 917 375 41,70973209 5,478027344 5 P13489 Ribonuclease inhibitor OS=Homo sapiens GN=RNH1 PE=1 SV=2 - [RINI_HUMAN] 96,75 1 12 37 173 461 49,94108966 4,817871094 6 P09382 Galectin-1 OS=Homo sapiens GN=LGALS1 PE=1 SV=2 - [LEG1_HUMAN] 96,3 1 7 14 283 135 14,70620005 5,503417969 7 P60174 Triosephosphate isomerase OS=Homo sapiens GN=TPI1 PE=1 SV=3 - [TPIS_HUMAN] 95,1 3 16 25 375 286 30,77169764 5,922363281 8 P04406 Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens GN=GAPDH PE=1 SV=3 - [G3P_HUMAN] 94,63 2 13 31 509 335 36,03039959 8,455566406 9 Q15185 Prostaglandin E synthase 3 OS=Homo sapiens GN=PTGES3 PE=1 SV=1 - [TEBP_HUMAN] 93,13 1 5 12 74 160 18,68541938 4,538574219 10 P09417 Dihydropteridine reductase OS=Homo sapiens GN=QDPR PE=1 SV=2 - [DHPR_HUMAN] 93,03 1 1 17 69 244 25,77302971 7,371582031 11 P01911 HLA class II histocompatibility antigen,
    [Show full text]
  • The Proteomic Landscape of Resting and Activated CD4+ T Cells Reveal Insights Into Cell Differentiation and Function
    International Journal of Molecular Sciences Article The Proteomic Landscape of Resting and Activated CD4+ T Cells Reveal Insights into Cell Differentiation and Function Yashwanth Subbannayya 1 , Markus Haug 1, Sneha M. Pinto 1, Varshasnata Mohanty 2, Hany Zakaria Meås 1, Trude Helen Flo 1, T.S. Keshava Prasad 2 and Richard K. Kandasamy 1,* 1 Centre of Molecular Inflammation Research (CEMIR), Department of Clinical and Molecular Medicine (IKOM), Norwegian University of Science and Technology, 7491 Trondheim, Norway; [email protected] (Y.S.); [email protected] (M.H.); [email protected] (S.M.P.); [email protected] (H.Z.M.); trude.fl[email protected] (T.H.F.) 2 Center for Systems Biology and Molecular Medicine, Yenepoya (Deemed to be University), Mangalore 575018, India; [email protected] (V.M.); [email protected] (T.S.K.P.) * Correspondence: [email protected] Abstract: CD4+ T cells (T helper cells) are cytokine-producing adaptive immune cells that activate or regulate the responses of various immune cells. The activation and functional status of CD4+ T cells is important for adequate responses to pathogen infections but has also been associated with auto-immune disorders and survival in several cancers. In the current study, we carried out a label-free high-resolution FTMS-based proteomic profiling of resting and T cell receptor-activated (72 h) primary human CD4+ T cells from peripheral blood of healthy donors as well as SUP-T1 cells. We identified 5237 proteins, of which significant alterations in the levels of 1119 proteins were observed between resting and activated CD4+ T cells.
    [Show full text]
  • Downloaded from Ftp://Ftp.Uniprot.Org/ on July 3, 2019) Using Maxquant (V1.6.10.43) Search Algorithm
    bioRxiv preprint doi: https://doi.org/10.1101/2020.11.17.385096; this version posted November 17, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. The proteomic landscape of resting and activated CD4+ T cells reveal insights into cell differentiation and function Yashwanth Subbannayya1, Markus Haug1, Sneha M. Pinto1, Varshasnata Mohanty2, Hany Zakaria Meås1, Trude Helen Flo1, T.S. Keshava Prasad2 and Richard K. Kandasamy1,* 1Centre of Molecular Inflammation Research (CEMIR), and Department of Clinical and Molecular Medicine (IKOM), Norwegian University of Science and Technology, N-7491 Trondheim, Norway 2Center for Systems Biology and Molecular Medicine, Yenepoya (Deemed to be University), Mangalore, India *Correspondence to: Professor Richard Kumaran Kandasamy Norwegian University of Science and Technology (NTNU) Centre of Molecular Inflammation Research (CEMIR) PO Box 8905 MTFS Trondheim 7491 Norway E-mail: [email protected] (Kandasamy R K) Tel.: +47-7282-4511 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.11.17.385096; this version posted November 17, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Abstract CD4+ T cells (T helper cells) are cytokine-producing adaptive immune cells that activate or regulate the responses of various immune cells.
    [Show full text]
  • Study of Vesicular Glycolysis in Health and Huntington's Disease
    Study of vesicular glycolysis in health and Huntington’s Disease Maximilian Mc Cluskey To cite this version: Maximilian Mc Cluskey. Study of vesicular glycolysis in health and Huntington’s Disease. Neurons and Cognition [q-bio.NC]. Université Grenoble Alpes [2020-..], 2021. English. NNT : 2021GRALV006. tel-03251320 HAL Id: tel-03251320 https://tel.archives-ouvertes.fr/tel-03251320 Submitted on 7 Jun 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. THÈSE Pour obtenir le grade de DOCTEUR DE L’UNIVERSITE GRENOBLE ALPES Spécialité : Neurosciences, Neurobiologie Arrêté ministériel : 25 mai 2016 Présentée par Maximilian Mc CLUSKEY Thèse dirigée par Frédéric SAUDOU et co-encadrée par Anne-Sophie NICOT préparée au sein du Grenoble Institut des Neurosciences dans l'École Doctorale de Chimie et Sciences du Vivant Study of vesicular glycolysis in health and Huntington’s disease Thèse soutenue publiquement le 04/02/2021, devant le jury composé de : Mr, Frédéric, DARIOS Chargé de recherche INSERM, Institut du Cerveau, rapporteur Mme, Carine, POURIÉ Professeure
    [Show full text]
  • Carla Freire Celedonio Fernandes Molecular Characterization And
    www.doktorverlag.de [email protected] Tel: 0641-5599888 Fax: -5599890 Tel: D-35396 GIESSEN ST AU FEN BER G R I N G 1 5 VVB LAUFERSWEILERVERLAG VVB LAUFERSWEILER VERLAG VVB LAUFERSWEILER édition scientifique 9783835 952300 ISBN 3-8359-5230-7 ISBN VVB CARLA FREIRE CELEDONIO FERNANDE S SLC10A4 AND SLC10A5 Carla FreireCeledonioFernandes Expression ofTwoNewMembers of theSLC10TransporterFamily: Molecular Characterizationand VVB LAUFERSWEILER VERLAG VVB LAUFERSWEILER SLC10A4 andSLC10A5 Doktorgrades der Naturwissenchaften dem Fachbereich Pharmazie der Dissertation zur Erlangung des édition scientifique édition Philipps-Universität Marburg (Dr. rer. Nat.) Das Werk ist in allen seinen Teilen urheberrechtlich geschützt. Jede Verwertung ist ohne schriftliche Zustimmung des Autors oder des Verlages unzulässig. Das gilt insbesondere für Vervielfältigungen, Übersetzungen, Mikroverfilmungen und die Einspeicherung in und Verarbeitung durch elektronische Systeme. 1. Auflage 2007 All rights reserved. No part of this publication may be reproduced, stored in a retrieval system, or transmitted, in any form or by any means, electronic, mechanical, photocopying, recording, or otherwise, without the prior written permission of the Author or the Publishers. 1st Edition 2007 © 2007 by VVB LAUFERSWEILER VERLAG, Giessen Printed in Germany VVB LAUFERSWEILER VERLAG édition scientifique STAUFENBERGRING 15, D-35396 GIESSEN Tel: 0641-5599888 Fax: 0641-5599890 email: [email protected] www.doktorverlag.de Aus dem Institut für Pharmakologie und Toxikologie der Philipps-Universität Marburg Betreuer: Prof. Dr. Dr. Joseph Krieglstein und dem Institut für Pharmakologie und Toxikologie der Justus-Liebig-Universität Gießen Betreuer: Prof. Dr. Ernst Petzinger Molecular Characterization and Expression of Two New Members of the SLC10 Transporter Family: SLC10A4 and SLC10A5 Dissertation zur Erlangung des Doktorgrades der Naturwissenchaften (Dr.
    [Show full text]
  • Role of Genes Differentially Expressed in Thyroid Carcinogenesis
    Open Research Online The Open University’s repository of research publications and other research outputs Role of genes differentially expressed in thyroid carcinogenesis Thesis How to cite: Anania, Maria Chiara (2012). Role of genes differentially expressed in thyroid carcinogenesis. PhD thesis The Open University. For guidance on citations see FAQs. c 2012 The Author https://creativecommons.org/licenses/by-nc-nd/4.0/ Version: Version of Record Link(s) to article on publisher’s website: http://dx.doi.org/doi:10.21954/ou.ro.0000eeae Copyright and Moral Rights for the articles on this site are retained by the individual authors and/or other copyright owners. For more information on Open Research Online’s data policy on reuse of materials please consult the policies page. oro.open.ac.uk o FONDAZIONE IRees +-it.•. lsmuro NAZIONALE l±lT DEI TUMOI.I Maria Chiara Anania Degree in Biological Science OU personal identifier A298071X ROLE OF GENES DIFFERENTIALLY EXPRESSED IN THYROID CARCINOGENESIS This thesis is presented to The Open University for the Degree of Doctor of Philosophy Discipline: Life and Biomolecular Sciences Date of submission: 31st May 2012 Affiliated Research Centre: Fondazione IRCCS Istituto Nazionale dei Tumori, Milan (Italy) Director of studies: Dr. Angela Greco External supervisor: Dr. Karen Pulford 1 IMAGING SERVICES NORTH Boston Spa, Wetherby West Yorkshire, LS23 7BQ www.bl,uk BEST COpy AVAILABLE. VARIABLE PRINT QUALITY NOTIFICATION OF REDACTION THESIS TITLE: Role of genes differentially expressed in thyroid carcinogenesis. AUTHOR: Maria Chiara Anania YEAR: 2012 CLASSMARK: 616.99444 ANA The following pages/sections have been redacted from this thesis: Paqe No.
    [Show full text]
  • Divergent Evolution of Animal Excretory Systems
    DIVERGENT EVOLUTION OF ANIMAL EXCRETORY SYSTEMS: EVIDENCE FROM MOLECULAR AND FUNCTIONAL STUDIES IN PLANARIANS by Hanh Thi Kim Vu A dissertation submitted to the faculty of The University of Utah in partial fulfillment of the requirements for the degree of Doctor of Philosophy Department of Neurobiology and Anatomy The University of Utah May 2015 Copyright © Hanh Thi Kim Vu 2015 All Rights Reserved The University of Utah Graduate School STATEMENT OF DISSERTATION APPROVAL The dissertation of Hanh Thi Kim Vu has been approved by the following supervisory committee members: Alejandro Sánchez Alvarado , Chair 12-04-2014 Date Approved Charles L. Murtaugh , Member 12-04-2014 Date Approved Tatjana Piotrowski , Member 12-04-2014 Date Approved Yukio Saijoh , Member 12-04-2014 Date Approved Monica L. Vetter , Member 12-04-2014 Date Approved and by Monica L. Vetter , Chair/Dean of the Department/College/School of Neurobiology and Anatomy and by David B. Kieda, Dean of The Graduate School. ABSTRACT Animals have developed extraordinary capacities to maintain homeostasis in the face of severe osmoregulatory challenges from their environment. For instance, with respect to salt and water homeostasis, freshwater animals continuously eliminate excess water while conserving solutes, whereas land-dwelling organisms have to conserve water and solutes as much as possible. Comparative morphological studies suggest that animals have tackled the problems of excretion and osmoregulation by evolving a specialized structure: the excretory organ. Animal excretory organs are extremely diverse. Some are unicellular, such as the excretory cell in nematodes. Others are multicellular and highly specialized, such as the protonephridia/metanephridia in invertebrates or the kidneys in vertebrates.
    [Show full text]
  • ( 12 ) United States Patent
    US010314844B2 (12 ) United States Patent ( 10 ) Patent No. : US 10 ,314 ,844 B2 Lee et al. ( 45 ) Date of Patent: Jun . 11 , 2019 ( 54 ) INHIBITORS OF BRUTON ' S TYROSINE 5 ,059 , 714 A 10 / 1991 Palfreyman et al. 5 , 120 ,764 A 6 / 1992 McCarthy et al. KINASE 5 , 182 ,297 A 1 / 1993 Palfreyman et al. 5 ,252 , 608 A 10 / 1993 Palfreyman et al . (71 ) Applicants :GILEAD SCIENCES , INC . , Foster 7 ,514 , 444 B24 / 2009 Honigberg et al. City , CA (US ) ; ONO 8 ,450 ,321 B2 5 /2013 Mitchell et al. PHARMACEUTICAL CO ., LTD ., 8 , 501, 724 B1 8 / 2013 Chen et al. Osaka ( JP ) 8 ,557 , 803 B2 * 10 / 2013 Yamamoto . .. .. C07D 473 / 34 514 /210 . 18 (72 ) Inventors : Seung H . Lee , Sammamish , WA (US ) ; 8 , 940 , 725 B2 * 1 / 2015 Yamamoto .. .. .. .. C07D 473 / 34 Shingo Yamamoto , Osaka ( JP ) 514 / 210 . 18 8 , 940 ,893 B2 1 / 2015 Bosanac et al . ( 73 ) Assignees: GILEAD SCIENCES , INC ., Foster 9 , 199 , 997 B2 * 12 / 2015 Yamamoto A61K 31/ 522 City , CA (US ) ; ONO 9 , 371, 325 B2 6 / 2016 Yamamoto et al . 9 ,550 , 835 B2 1 / 2017 Ono et al. PHARMACEUTICAL CO ., LTD . , 9 ,896 , 453 B2 * 2 / 2018 Yamamoto .. .. .. .. A61K 31 /522 Osaka ( JP ) 9 ,926 , 322 B2 * 3 / 2018 Yamamoto C07D 473/ 34 2004 /0248871 A112 / 2004 Farjanel et al. ( * ) Notice : Subject to any disclaimer , the term of this 2009 /0142345 A1 6 / 2009 Satou et al. patent is extended or adjusted under 35 2010 /0120717 A1 * 5 /2010 Brown .. .. CO7D 241/ 18 U . S . C .
    [Show full text]
  • Callosobruchus Chinensis) Response to Hypoxia And
    Supplementary material Comparative transcriptome analyses of adzuki bean weevil (Callosobruchus chinensis) response to hypoxia and hypoxia/hypercapnia S.F.Cui1, L. Wang1, L. Ma2,J.P. Qiu1, Y.L.W1,Zh.Ch.Liu1*, and X.Q.Geng1* 1Department of Resources and Environment, School of Agriculture and Biology, Shanghai Jiao Tong University, Shanghai 200240, China 2Behavioral & Physiological Ecology (BPE) Group, Groningen Institute for Evolutionary Life Sciences, University of Groningen, Nijenborgh 7, 9747 AG Groningen, Netherlands Table S1. DEGs in (A) HHA vs. NOR, (B) HA vs. NOR, and (C) HHA vs. HA. Table S2. Summary of DEGs in the GO enrichment (HHA-HA-NOR). Table S3. Summary of DEGs in the KEGG enrichment (HHA-HA-NOR). Table S4. List of DEGs in biological processes based on the KEGG database. Table S5. List of DEGs related to the function of immune, signal transduction, and stress responses based on the GO database. Table S6. Primers used for q-PCR certification. Table S1 DEGs in (A)HHA vs. NOR,(B)HA vs.NOR and (C) HHA vs. HA. (A)DEGs in HHA vs. NOR. HHA vs.NOR ID Name Putative function aFold change p-value c594_g1_i1 XP002581749.1 XP002581749.1 14.18 2.59E-02 c7162_g1_i1 ART2 Putative uncharacterized protein ART2 16.04 7.03E-03 c10028_g1_i1 CCCP Circadian clock-controlled protein 7.92 3.24E-03 c10085_g1_i1 ENN78907.1 ENN78907.1 4.56 3.72E-03 c17791_g1_i1 COX6C Cytochrome c oxidase subunit 6C 3.95 4.36E-02 c24002_g1_i1 MYRO1 Myrosinase 1 440.98 5.94E-09 c24102_g1_i1 TAR1 Protein TAR1 10.97 2.15E-02 c28303_g1_i1 PAPSS Bifunctional 3'-phosphoadenosine
    [Show full text]
  • Proteome-Scale Amino-Acid Resolution Footprinting of Protein-Binding Sites
    bioRxiv preprint doi: https://doi.org/10.1101/2021.04.13.439572; this version posted April 13, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Proteome-scale amino-acid resolution footprinting of protein-binding sites in the intrinsically disordered regions of the human proteome Caroline Benz1,*, Muhammad Ali1,*, Izabella Krystkowiak2,* , Leandro Simonetti1, Ahmed Sayadi1, Filip Mihalic3, Johanna Kliche1, Eva Andersson3, Per Jemth3, Norman E. Davey2,#, Ylva Ivarsson1, # Affiliations: 1. Department of Chemistry - BMC, Uppsala University, Box 576, Husargatan 3, 751 23 Uppsala, Sweden 2. Division of Cancer Biology, The Institute of Cancer Research, 237 Fulham Road, London SW3 6JB, UK. 3. Department of Medical Biochemistry and Microbiology, Uppsala University, Box 582, Husargatan 3, 751 23 Uppsala Sweden * Equal contribution # Corresponding authors: [email protected] [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.04.13.439572; this version posted April 13, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Abstract Specific protein-protein interactions are central to all processes that underlie cell physiology. Numerous studies using a wide range of experimental approaches have identified tens of thousands of human protein-protein interactions. However, many interactions remain to be discovered, and low affinity, conditional and cell type-specific interactions are likely to be disproportionately under-represented.
    [Show full text]
  • ODF 1.0 Headerlines= 9 Model= Gene List COLUMN NAMES:Feature Description COLUMN TYPES:String String Float COLUMN DESCS:Name of the Description of the Gene
    ODF 1.0 HeaderLines= 9 Model= Gene List COLUMN_NAMES:Feature Description COLUMN_TYPES:String String float COLUMN_DESCS:Name of the Description of the gene. Distance from reference gene. MarkerSelectionMethod= Continuous GeneName= Z48481_at_NA_illumina DistanceFunction= Euclidean NumNeighbors= 15191 DataLines= 15191 N Target ID Description Score 1 Z48481_at_NA_illumina MT-MMP protein 0 2 U66059_cds7_at_NA_illumina TCRBV1S1A1N1 gene extracted from 2012.3337 3 HG3319-HT3496_s_at_NA_illumina Split Gene 1 Enhancer, Tup1-Like 2044.1316 4 M34667_at_GI_33598945-A PLCG1 Phospholipase C, gamma 1 2044.6802 5 M87284_at_GI_8051624-A 69/71 KD 2080.5542 6 HG243-HT243_s_at_NA_illumina Lowe Oculocerebrorenal Syndrome 2083.9236 7 U77827_at_GI_4504090-S Orphan G protein-coupled receptor 2084.0466 8 L13434_at_NA_illumina Chromosome 3p21.1 gene sequence 2114.1865 9 X66894_s_at_GI_4557588-S FACC Fanconi anemia complementation 2145.438 10 D88613_at_GI_45269132-S HGCMa 2148.3267 11 X97160_rna1_at_GI_21359903-S TFE3 transcription factor gene extracted 2158.8982 12 X99687_at_NA_illumina Methyl-CpG-binding protein 2, intron 2 2165.1611 13 Y08302_at_GI_4503420-S MAP kinase phosphatase 4 2166.3406 14 M29581_at_GI_33438574-S ZNF8 Zinc finger protein 8 (clone HF.18) 2172.3496 15 U24056_s_at_NA_illumina Inward rectifier K+ channel protein (hirk2) 2179.5518 16 U52830_at_NA_illumina Cri-du-chat region mRNA, clone CSC8 2182.0735 17 X80763_s_at_NA_illumina HTR2C 5-hydroxytryptamine (serotonin) 2184.6533 18 HG960-HT960_at_NA_illumina Guanine Nucleotide Exchange Factor 1
    [Show full text]
  • Glucose Transport and Its' Regulation in Rodent Mammary Gland
    2807714121 1 GLUCOSE TRANSPORT AND ITS' REGULATION IN RODENT MAMMARY GLAND by Sally Martin B.Sc. (Manchester) Dept. Biochemistry Royal Free Hospital School of Medicine Rowland Hill Street LONDON, NW3 2PF MEDICAL LIBRARY. ROYAL FREE HOSPITAL HAMPSTEAD. A dissertation submitted in fulfilment of the requirements for the degree of Doctor of Philosophy in the University of London December, 1992 ProQuest Number: U063566 All rights reserved INFORMATION TO ALL USERS The quality of this reproduction is dependent upon the quality of the copy submitted. In the unlikely event that the author did not send a complete manuscript and there are missing pages, these will be noted. Also, if material had to be removed, a note will indicate the deletion. uest. ProQuest U063566 Published by ProQuest LLC(2016). Copyright of the Dissertation is held by the Author. All rights reserved. This work is protected against unauthorized copying under Title 17, United States Code. Microform Edition © ProQuest LLC. ProQuest LLC 789 East Eisenhower Parkway P.O. Box 1346 Ann Arbor, Ml 48106-1346 2 ABSTRACT GLUCOSE TRANSPORT AND ITS* REGULATION IN RODENT MAMMARY GLAND by Sally Martin Specific, anti-peptide antibodies against the five known mammalian facilitative D-glucose transporter iso forms (GLUT 1-5) were used to investigate the transporter content of lactating rat mammary gland. Western blots of gland homogenate showed the apparent presence of GLUTl and GLUT4. However, in isolated epithelial cells only GLUTl was present, a result which indicated the mammary GLUT4 is present within adipocytes. The putative GLUTl glucose transporter was recognised by antibodies against several hydrophilic regions of human erythrocyte GLUTl and endoglycosidase F digestion decreased its apparent from 50,000 to 42,000, a value essentially identical to that of the deglycosylated human protein.
    [Show full text]