MUC1 Antibody - C-terminal region (ARP41457_P050) Data Sheet
Product Number ARP41457_P050 Product Name MUC1 Antibody - C-terminal region (ARP41457_P050) Size 50ug Gene Symbol MUC1 Alias Symbols CD227; EMA; H23AG; KL-6; MAM6; PEM; PEMT; PUM; MUC-1; MUC-1/X; MUC1/ZD; MUC-1/SEC Nucleotide Accession# NM_001044393 Protein Size (# AA) 158 amino acids Molecular Weight 14kDa Product Format Lyophilized powder NCBI Gene Id 4582 Host Rabbit Clonality Polyclonal Gene Family CD This is a rabbit polyclonal antibody against MUC1. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: GCAGHCLSHCLGCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCA This gene encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is Description of Target proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is known to contain a highly polymorphic variable number tandem repeats (VNTR) domain. Alternate splicing results in multiple transcript variants. BAX,CDKN1A,TP53,CTNNB1,EGFR,SRC,ABL1,APC,CTNNB1,CTNNB1,CTNND1,CTNND1,EGFR,EGFR,E RBB2,ERBB2,ERBB3,ERBB3,ERBB4,ERBB4,GALNT1,GALNT1,GALNT10,GALNT10,GALNT12,GALNT2,G Partner Proteins ALNT2,GALNTL2,GALNTL2,GRB2,GRB2,GSK3B,GSK3B,JUP,JUP,LCK,LYN,OSGEP,OSGEP,PRKCD,PRK CD,SIGLEC1,SOS1,SOS1,SRC,SRC,ZAP70,APC,CTNNB1,CTNND1,Ctnnb1,EGFR,ERBB2,ERBB3,ERBB4, ESR1,GALNT12,GALNT4,GRB2,GSK3B,JUP,LYN,PRKCD,SOS1,SRC Reconstitution and Add 50 ul of distilled water. Final anti-MUC1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide Catalog # AAP41457 Immunogen The immunogen for Anti-MUC1 antibody is: synthetic peptide directed towards the C-terminal region of Human MUC1 Swissprot Id Q7Z538 Protein Name Mucin short variant PC2 EMBL AAP97027.1 Protein Accession # NP_001037858 Purification Affinity Purified Species Reactivity Human, Pig Application IHC Predicted Homology Based on Immunogen Human: 100%; Pig: 86% Sequence
NmuFG NmuFG Image 1
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.