DOCSLIB.ORG

To Link Back to USGS Publications

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
To Link Back to USGS Publications � Table 14 .--Chemical and physical data for major sampling sites (continued) HEPTA- DI- ENDO- HEPTA- CHLOR PER- TOX- ELDRIN SULFAN, ENDRIN, CHLOR, EPOXIDE LINDANE MIREX, THANE APHENE, TOTAL TOTAL TOTAL TOTAL TOTAL TOTAL TOTAL TOTAL TOTAL DATE (UG/L) (UG/L) (UG/L) (UG/L) (UG/L) (UG/L) (UG/L) (UG/L)' (UG/L) Site 12 01098722 - GRIST MILLPOND OUTLET NEAR MARLBOROUGH, MA (LAT 42 21 26 LONG 071 28 AUG , 1978 23 . .00 .00 .00 .00 .00 .00 .00 -- . 0 NOV 21 . .00 .00 .00 .00 .00 .00 -- .00 . 0 Site 15 01098730 - CARDING MILLPOND NEAR MARLBOROUGH, MA (LAT 42 21 42 LONG 071 27 57) NOV , 1976 03 . .00 -- .00 .00 .00 .00 -- -- .00 OCT , 1977 13 . .00 .00 .00 .00 .00 .00 -- -- .00 JUN , 1978 22 . .00 .00 .00 .00 .00 .00 .00 -- .00 AUG 22 . .00 .00 .00 .00 .00 .00 .00 -- .00 NOV 21 . .00 .00 .00 .00 .00 .00 -- .00 .00 Site 16 01098733 - HOP BROOK NEAR MARLBOROUGH, MA (LAT 42 22 02 LONG 071 28 01) AUG , 1978 23 . .00 .00 .00 .00 .00 .00 .00 -- .00 NOV 21 . .00 .00 .00 .00 .00 .00 -- .00 .00 Table 15 .--Chemical and physical data for other sampling sites NITROGEN, STREAMFLOW, SPECIFIC TEM- OXYGEN, OXYGEN, ORGANIC INSTAN- CON- PH PERA- DIS- DISSOLVED TOTAL TIME TANEOUS DUCTANCE TURE SOLVED (PERCENT (MG/L DATE (CFS) (UMHOS) (UNITS) (DEG C) (MG/L) SATURATION) AS N) Site 1 01098704 - HAGER POND TRIBUTARY AT MARLBOROUGH, MA (LAT 42 21 07 LONG 071 29 43) NOV 1976 Ol . 0830 .13 290 6 .6 6 .5 10 .6 86 .18 Site 3 01098706 - HAGER POND TRIBUTARY AT MARLBOROUGH, MA (LAT 42 20 57 LONG 071 29 30) NOV, 1976 01 . 1300 .28 73 5 .8 7 .0 8 .9 73 .40 Site 4 01098707 - HAGER POND TRIBUTARY AT MARLBOROUGH, MA (LAT 42 20 30 LONG 071 29 20) NOV , 1976 01 . 1430 .09 68 6 .1 6 .5 10 .3 84 .32 Site 6 01098708 - HAGER POND TRIBUTARY AT MARLBOROUGH, MA (LAT 42 20 48 LONG 071 29 03) NOV , 1976 02 . 1300 .12 90 5 .9 7 .0 12 .3 101 .16 Site 10 01098714 - GRIST MILLPOND TRIBUTARY NEAR MARLBOROUGH, MA MAT 42 21 16 LONG 071 28 44) NOV , 1976 03 . 0930 .18 146 6 .4 4 .0 12 .4 94 .19 Site 11 01098718 - GRIST MILLPOND TRIBUTARY NEAR MARLBOROUGH, MA (LAT 42 21 27 LONG 071 28 42) NOV , 1976 03 . 1215 .03 200 5 .9 7 .5 5 .8 48 1 .3 Site 13 01098725 - CARDING MILLPOND TRIBUTARY NEAR MARLBOROUGH, MA (LAT 42 21 24 LONG 071 28 00) NOV , 1976 03 . 1430 .05 210 6 .0 6 .5 7 .8 63 .24 Site 14 01098728 - CARDING MILLPOND TRIBUTARY NEAR MARLBOROUGH, MA (LAT 42 21 26 LONG 071 27 48) NOV 4, 1976 04 . 0830 .09 154 6 .1 6 .0 8 .5 68 .19 � Table 15 .--Chemical and physical data for other sampling sites (continued) NITROGEN, NITROGEN, NITROGEN, PHOSPHORUS, PHOS- ALGAL AMMONIA NITRITE NITRATE NITROGEN, ORTHO, PHORUS, GROWTH TOTAL TOTAL TOTAL TOTAL TOTAL TOTAL POTENTIAL, (MG/L (MG/L (MG/L (MG/L (MG/L (MG/L BOTTLE TEST DATE AS N) AS N) AS N) AS N) AS P) AS P) (MG/L) Site 1 01098704 - HAGER POND TRIBUTARY AT MARLBOROUGH, MA (LAT 42 21 07 LONG 071 29 43) NOV , 1976 01 . .070 .010 .39 .65 .010 .020 Site 3 01098706 - HAGER POND TRIBUTARY AT MARLBOROUGH, MA (LAT 42 20 57 LONG 071 29 30) NOV , 1976 01 . .030 .010 .02 .46 .010 .030 2 .9 Site 4 01098707 - HAGER POND TRIBUTARY AT MARLBOROUGH, MA (LAT 42 20 30 LONG 071 29 20) NOV , 1976 01 . .010 .010 .02 .36 .020 .030 1 .1 Site 6 01098708 - HAGER POND TRIBUTARY AT MARLBOROUGH, MA (LAT 42 20 48 LONG 071 29 03) NOV , 1976 02 . .020 .010 .01 .20 .020 .020 .4 Site 10 01098714 - GRIST MILLPOND TRIBUTARY NEAR MARLBOROUGH, MA (LAT 42 21 16 LONG 071 - 28 44) NOV , 1976 03 . .010 .010 .00 .21 .010 .020 .5 Site 11 01098718 - GRIST MILLPOND TRIBUTARY NEAR MARLBOROUGH, MA (LAT 42 21 27 LONG 071 28 42) NOV , 1976 03 . .260 .010 .04 1 .7 .010 .200 .8 Site 13 01098725 - CARDING MILLPOND TRIBUTARY NEAR MARLBOROUGH, MA (LAT 42 21 24 LONG 071 28 00) NOV , 1976 03 . .010 .010 .02 .28 .010 .030 2 .3 Site 14 01098728 - CARDING MILLPOND TRIBUTARY NEAR MARLBOROUGH, MA (LAT 42 21 26 LONG 071 27 48) NOV , 1976 04 . .010 .010 .00 .21 .010 .030 .5 � Table 16 .--Phytoplankton data for all sampling sites Site 2 01098705 HAGER POND TRIBUTARY AT MARLBOROUGH, MA PHYTOPLANKTON ANALYSES, AUGUST 1978 TO NOVEMBER 1978 DATE AUG 23,78 NOV 21,78 TIME 1015 0730 TOTAL CELLS/ML 480 980 CELLS PER- CELLS PER­ ORGANISM /ML CENT /ML CENT CHRYSOPHYTA .BACILLARIOPHYCEAE . .CENTRALES . .COSCINODISCACEAE . COSCINODISCUS -- - 14 1 . .PENNALES . .ACHNANTHACEAE . .ACHNANTHES 16 3 -- - . .GOMPHONEMATACEAE . .GOMPHONEMA 11 2 -- - . .NAVICULACEAE . .NAVICULA 16 3 14 1 . .NITZSCHIACEAE . .NITZSCHIA 110# 22 -- - CYANOPHYTA (BLUE-GREEN ALGAE) .CYANOPHYCEAE . .HORMOGONALES . .OSCILLATORIACEAE . .OSCILLATORIA 320# 67 920# 94 EUGLENOPHYTA (EUGLENOIDS) .EUGLENOPHYCEAE . .EUGLENALES . .EUGLENACEAE . .EUGLENA 5 1 29 3 NOTE : # - DOMINANT ORGANISM ; EQUAL TO OR GREATER THAN 15 PERCENT * - OBSERVED ORGANISM, MAY NOT HAVE BEEN COUNTED ; LESS THAN 112 PERCENT Table 16 .--Phytoplankton data for all sampling sites (continued) Site 5 01098709 HAGER POND AT MARLBOROUGH, MA PHYTOPLANKTON ANALYSES, NOVEMBER 1976 TO NOVEMBER 1978 DATE NOV 2,76 JUN 14,77 AUG 71 77 OCT 13,77 TIME 1030 0930 0900 0830 TOTAL CELLS/ML 150000 16000 46000 41000 CELLS PER- CELLS PER- CELLS PER- CELLS PER- ORGANISM /ML CENT /ML CENT /ML CENT /ML CENT CHLOROPHYTA (GREEN ALGAE) .CHLOROPHYCEAE -- - 2300 14 -- - -- - . .CHLOR000CCALES . .HYDRODICTYACEAE . .PEDIASTRUM -- - 2100 13 23000# 51 25000# 59 . .MICRACTINIACEAE . .GOLENKINIA * 0 -- - 7800# 17 2600 6 . .MICRACTINIUM -- - 530 3 -- - -- - . .000YSTACEAE . .ANKISTRODESMUS -- - * 0 -- - -- - . .CHLORELLA 88000# 60 -- - -- - -- - . .KIRCHNERIELLA -- - 600 4 -- - -- - . .000YSTIS -- - 270 2 380 1 -- - . .TETRAEDRON -- - -- _ __ _ * 0 . .SCENEDESMACEAE . SCENEDESMUS 57000# 39 8200# 50 14000# 31 12000# 29 . .TETRASPORALES . .PALMELLACEAE . GLOEOCYSTIS -- - -- - -- - -- - . .VOLVOCALES . .CHLAMYDOMONAOACEAE . CHLAMYDOMONAS 960 1 * 0 -- - 340 1 . .ZYGNEMATALES . .DESMIDIACEAE . .STAURASTRUM CHRYSOPHYTA .BACILLARIOPHYCEAE . .CENTRALES . .COSCINODISCACEAE . CYCLOTELLA -- - * 0 -- - -- - . .PENNALES . .ACHNANTHACEAE . .ACHNANTHES -- - * 0 -- - -- - . .FRAGILARIACEAE . .FRAGILARIA -- - -- - -- - 340 1 . .NAVICULACEAE . .GYROSIGMA -- - -- - -- - * 0 . .NAVICULA -- - -- - -- - -- - . .NITZSCHIACEAE . .NITZSCHIA * 0 870 5 -- - 250 1 . .SURIRELLACEAE . .SURIRELLA * 0 -- - -- - -- - CRYPTOPHYTA (CRYPTOMONADS) .CRYPTOPHYCEAE . .CRYPTOMONADALES . .CRYPTOCHRYSIDACEAE . .CHROOMONAS -- - -- - * 0 . .CRYPTOMONADACEAE . .CRYPTOMONAS -- - * 0 -- - * 0 CYANOPHYTA (BLUE-GREEN ALGAE) .CYANOPHYCEAE . .CHR000OCCALES . .CHR000OCCACEAE . ANACYSTIS -- - 1200 7 -- - 850 2 . .HORM000NALES . .RIVULARIACEAE . .RAPHIDIOPSIS -- - -- - -- - -- - NOTE : # - DOMINANT ORGANISM ; EQUAL TO OR GREATER THAN 15 PERCENT * - OBSERVED ORGANISM, MAY NOT HAVE BEEN COUNTED ; LESS THAN 1/2 PERCENT � Table 16 .--Phytoplankton data for all sampling sites (continued) Site 5 01098709 HAGER POND AT MARLBOROUGH, MA PHYTOPLANKTON ANALYSES, NOVEMBER 1976 TO NOVEMBER 1978 DATE JUN 22,78 AUG 22,78 NOV 21,78 TIME 0815 1045 0900 TOTAL CELLS/ML 95000 17000 93000 CELLS PER- CELLS PER- CELLS PER­ ORGANISM /ML CENT /ML CENT /ML CENT CHLOROPHYTA (GREEN ALGAE) .CHLOROPHYCEAE -- - -- - -- - . .CHLOR000CCALES . .HYDRODICTYACEAE . .PEDIASTRUM 62000# 65 3100# 18 -- - . .MICRACTINIACEAE . .GOLENKINIA -- - -- - -- - . .MICRACTINIUM -- - -- - -- - . .000YSTACEAE . .ANKISTRODESMUS -- - -- - -- - . .CHLORELLA -- - -- - -- - . .KIRCHNERIELLA -- - -- - -- - . .000YSTIS 4500 5 -- - -- - . .TETRAEDRON . .SCENEDESMACEAE . SCENEDESMUS 25000# 26 8500# 50 90000# 97 . .TETRASPORALES . .PALMELLACEAE . GLOEOCYSTIS 2800 3 -- - -- - . .VOLVOCALES . .CHLAMYDOMONADACEAE . CHLAMYOOMONAS -- - 230 1 -- - . .ZYGNEMATALES . .DESMIDIACEAE . .STAURASTRUM -- - -- - 2700 3 CHRYSOPHYTA .BACILLARIOPHYCEAE . .CENTRALES . .COSCINODISCACEAE . CYCLOTELLA 780 1 -- - -- - . .PENNALES . .ACHNANTHACEAE . .ACHNANTHES -- - -- - -- - . .FRAGILARIACEAE . .FRAGILARIA . .NAVICULACEAE . .GYROSIGMA -- - -- - -- - . .NAVICULA * 0 -- - -- - . .NITZSCHIACEAE . .NITZSCHIA 560 1 -- - -- - . .SURIRELLACEAE . .SURIRELLA -- - -- - -- - CRYPTOPHYTA (CRYPTOMONADS) .CRYPTOPHYCEAE . .CRYPTOMONADALES . .CRYPTOCHRYSIDACEAE . .CHROOMONAS - 5000# 29 . .CRYPTOMONADACEAE . .CRYPTOMONAS CYANOPHYTA (BLUE-GREEN ALGAE) .CYANOPHYCEAE . .CHR000OCCALES . .CHR000OCCACEAE . ANACYSTIS -- - -- - . .HORM000NALES . .RIVULARIACEAE . .RAPHIDIOPSIS -- - 230 1 NOTE : # - DOMINANT ORGANISM ; EQUAL TO OR GREATER THAN 15 PERCENT * - OBSERVED ORGANISM, MAY NOT HAVE BEEN COUNTED ; LESS THAN 112 PERCENT � Table 16 .--Phytoplankton data for all sampling sites (continued) Site 8 01098710 HAGER POND OUTLET AT MARLBOROUGH, MA PHYTOPLANKTON ANALYSES, AUGUST 1978 TO NOVEMBER 1978 DATE AUG 23,78 NOV 22,78 TIME 1200 0930 TOTAL CELLS/ML 12000 88000 CELLS PER- CELLS PER­ ORGANISM /ML CENT /ML CENT CHLOROPHYTA (GREEN ALGAE) .CHLOROPHYCEAE . .CHLOR000CCALES . .CHARACIACEAE . .SCHROEDERIA 87 1 -- - . .HYDRODICTYACEAE . .PEDIASTRUM 1500 12 6900 8 . .SCENEOESMACEAE . SCENEDESMUS 89009 72 770009 88 . .ZYGNEMATALES . .DESMIDIACEAE . .STAURASTRUM -- - 3900 4 CHRYSOPHYTA .BACILLARIOPHYCEAE . .PENNALES . .NAVICULACEAE . .HAVICULA * 0 CRYPTOPHYTA (CRYPTOMONADS) .CRYPTOPHYCEAE . .CRYPTOMONADALES . .CRYPTOCHRYSIDACEAE . .CHROOMONAS 1100 9 CYANOPHYTA (BLUE-GREEN ALGAE) .CYANOPHYCEAE . .CHROD000CALES . .CHR000OCCACEAE . .ANACYSTIS 650 5 NOTE : 9 - DOMINANT ORGANISM ; EQUAL TO OR GREATER THAN 15 PERCENT * - OBSERVED ORGANISM, MAY NOT HAVE BEEN COUNTED ; LESS THAN 112 PERCENT Table 16 .--Phytoplankton data for all sampling sites (continued) Site 9 01098712 GRIST MILLPOND NEAR MARLBOROUGH, MA PHYTOPLANKTON ANALYSES, NOVEMBER 1976 TO NOVEMBER 1978 DATE NOV 2,76 JUN 14,77 AUG 11,77 OCT 13,77
Load more

Recommended publications
  • Pediastrum Species (Hydrodictyaceae, Sphaeropleales) in Phytoplankton of Sumin Lake (£Êczna-W£Odawa Lakeland)
    Vol. 73, No. 1: 39-46, 2004 ACTA SOCIETATIS BOTANICORUM POLONIAE 39 PEDIASTRUM SPECIES (HYDRODICTYACEAE, SPHAEROPLEALES) IN PHYTOPLANKTON OF SUMIN LAKE (£ÊCZNA-W£ODAWA LAKELAND) AGNIESZKA PASZTALENIEC, MA£GORZATA PONIEWOZIK Department of Botany and Hydrobiology, Catholic University of Lublin C.K. Norwida 4, 20-061 Lublin, Poland e-mail: [email protected] (Received: April 7, 2003. Accepted: July 18, 2003) ABSTRACT During studies of phytoplankton in Sumin Lake (£êczna-W³odawa Lakeland), conducted from May till Sep- tember 2001 and 2002, 15 taxa of the genus Pediastrum (Hydrodictyaceae, Sphaeropleales) were found. Among them there were common species as Pediastrum boryanum, P. duplex, P. tetras and P. simplex, but also rare spe- cies as P. integrum or P. kawraiskyi. An especially interesting species was P. orientale, the taxon that until now has not been noted in phytoplankton of Polish water bodies. The paper gives descriptions of the genus Pediastrum coenobia and physico-chemical conditions of the habitat. The original documentation of Pediastrum taxa is added. KEY WORDS: Pediastrum taxa, Chlorophyta, phytoplankton, £êczna-W³odawa Lakeland. INRTODUCTION rved in palynological preparations (Jankovská and Komá- rek 2000, Komárek and Jankovská 2001; Nielsen and Lakes of £êczna-W³odawa Lakeland are the only group Sørensen 1992). in Poland located beyond the limits of a continental glacier The taxonomical research of the genus Pediastrum was of the last glaciation. The genesis of lakes is still disputa- not conducted in phytoplankton of £êczna-W³odawa Lake- ble, but the most of them have a termo-karst origin (Hara- land lakes. Only some information on occurrence of this simiuk and Wojtanowicz 1998).
    [Show full text]
  • Impact of Procedural Steps and Cryopreservation Agents in the Cryopreservation of Chlorophyte Microalgae
    Impact of Procedural Steps and Cryopreservation Agents in the Cryopreservation of Chlorophyte Microalgae Tony V. L. Bui, Ian L. Ross, Gisela Jakob, Ben Hankamer* Institute for Molecular Biosciences, The University of Queensland, Brisbane, Queensland, Australia Abstract The maintenance of traditional microalgae collections based on liquid and solid media is labour intensive, costly and subject to contamination and genetic drift. Cryopreservation is therefore the method of choice for the maintenance of microalgae culture collections, but success is limited for many species. Although the mechanisms underlying cryopreservation are understood in general, many technical variations are present in the literature and the impact of these are not always elaborated. This study describes two-step cryopreservation processes in which 3 microalgae strains representing different cell sizes were subjected to various experimental approaches to cryopreservation, the aim being to investigate mechanistic factors affecting cell viability. Sucrose and dimethyl sulfoxide (DMSO) were used as cryoprotectants. They were found to have a synergistic effect in the recovery of cryopreserved samples of many algal strains, with 6.5% being the optimum DMSO concentration. The effect of sucrose was shown to be due to improved cell survival and recovery after thawing by comparing the effect of sucrose on cell viability before or after cryopreservation. Additional factors with a beneficial effect on recovery were the elimination of centrifugation steps (minimizing cell damage), the reduction of cell concentration (which is proposed to reduce the generation of toxic cell wall components) and the use of low light levels during the recovery phase (proposed to reduce photooxidative damage). The use of the best conditions for each of these variables yielded an improved protocol which allowed the recovery and subsequent improved culture viability of a further 16 randomly chosen microalgae strains.
    [Show full text]
  • High Abundance of Plagioselmis Cf. Prolonga in the Krka River Estuary (Eastern Adriatic Sea)
    SCIENTIA MARINA 78(3) September 2014, 329-338, Barcelona (Spain) ISSN-L: 0214-8358 doi: http://dx.doi.org/10.3989/scimar.03998.28C Cryptophyte bloom in a Mediterranean estuary: High abundance of Plagioselmis cf. prolonga in the Krka River estuary (eastern Adriatic Sea) Luka Šupraha 1, 2, Sunčica Bosak 1, Zrinka Ljubešić 1, Hrvoje Mihanović 3, Goran Olujić 3, Iva Mikac 4, Damir Viličić 1 1 Department of Biology, Faculty of Science, University of Zagreb, Rooseveltov trg 6, 10000 Zagreb, Croatia. 2 Present address: Department of Earth Sciences, Paleobiology Programme, Uppsala University, Villavägen 16, SE-752 36 Uppsala, Sweden. E-mail: [email protected] 3 Hydrographic Institute of the Republic of Croatia, Zrinsko-Frankopanska 161, 21000 Split, Croatia. 4 Ruđer Bošković Institute, Bijenička cesta 54, 10000 Zagreb, Croatia. Summary: During the June 2010 survey of phytoplankton and physicochemical parameters in the Krka River estuary (east- ern Adriatic Sea), a cryptophyte bloom was observed. High abundance of cryptophytes (maximum 7.9×106 cells l–1) and high concentrations of the class-specific biomarker pigment alloxanthine (maximum 2312 ng l–1) were detected in the surface layer and at the halocline in the lower reach of the estuary. Taxonomical analysis revealed that the blooming species was Plagioselmis cf. prolonga. Analysis of the environmental parameters in the estuary suggested that the bloom was supported by the slower river flow as well as the increased orthophosphate and ammonium concentrations. The first record of a crypto- phyte bloom in the Krka River estuary may indicate that large-scale changes are taking place in the phytoplankton commu- nity.
    [Show full text]
  • University of Oklahoma
    UNIVERSITY OF OKLAHOMA GRADUATE COLLEGE MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION SUBMITTED TO THE GRADUATE FACULTY in partial fulfillment of the requirements for the Degree of DOCTOR OF PHILOSOPHY By JOSHUA THOMAS COOPER Norman, Oklahoma 2017 MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION APPROVED FOR THE DEPARTMENT OF MICROBIOLOGY AND PLANT BIOLOGY BY ______________________________ Dr. Boris Wawrik, Chair ______________________________ Dr. J. Phil Gibson ______________________________ Dr. Anne K. Dunn ______________________________ Dr. John Paul Masly ______________________________ Dr. K. David Hambright ii © Copyright by JOSHUA THOMAS COOPER 2017 All Rights Reserved. iii Acknowledgments I would like to thank my two advisors Dr. Boris Wawrik and Dr. J. Phil Gibson for helping me become a better scientist and better educator. I would also like to thank my committee members Dr. Anne K. Dunn, Dr. K. David Hambright, and Dr. J.P. Masly for providing valuable inputs that lead me to carefully consider my research questions. I would also like to thank Dr. J.P. Masly for the opportunity to coauthor a book chapter on the speciation of diatoms. It is still such a privilege that you believed in me and my crazy diatom ideas to form a concise chapter in addition to learn your style of writing has been a benefit to my professional development. I’m also thankful for my first undergraduate research mentor, Dr. Miriam Steinitz-Kannan, now retired from Northern Kentucky University, who was the first to show the amazing wonders of pond scum. Who knew that studying diatoms and algae as an undergraduate would lead me all the way to a Ph.D.
    [Show full text]
  • JJB 079 255 261.Pdf
    植物研究雑誌 J. J. Jpn. Bo t. 79:255-261 79:255-261 (2004) Phylogenetic Phylogenetic Analysis of the Tetrasporalean Genus Asterococcus Asterococcus (Chlorophyceae) sased on 18S 18S Ribosomal RNA Gene Sequences Atsushi Atsushi NAKAZA WA and Hisayoshi NOZAKI Department Department of Biological Sciences ，Graduate School of Science ，University of Tokyo ， Hongo Hongo 7-3-1 ，Bunkyo-ku ，Tokyo ，113 ・0033 JAPAN (Received (Received on October 30 ，2003) Nucleotide Nucleotide sequences (1642 bp) from 18S ribosomal RNA genes were analyzed for 100 100 strains of the clockwise (CW) group of Chlorophyceae to deduce the phylogenetic position position of the immotile colonial genus Asterococcus Scherffel ， which is classified in the Palmellopsidaceae Palmellopsidaceae of Tetrasporales. We found that the genus Asterococcus and two uni- cellular ， volvocalean genera ， Lobochlamys Proschold & al. and Oogamochlamys Proschold Proschold & al.， formed a robust monophyletic group ， which was separated from two te 位asporalean clades ， one composed of Tetraspora Link and Paulschulzia Sk 吋a and the other other containing the other palme l1 0psidacean genus Chlamydocaps αFot t. Therefore ， the Tetrasporales Tetrasporales in the CW group is clearly polyphyletic and taxonomic revision of the order order and the Palmellopsidaceae is needed. Key words: 18S rRNA gene ，Asterococcus ，Palmellopsidaceae ，phylogeny ，Tetraspor- ales. ales. Asterococcus Asterococcus Scherffel (1908) is a colo- Recently ， Ettl and Gartner (1 988) included nial nial green algal genus that is characterized Asterococcus in the family Palmello- by an asteroid chloroplast in the cell and psidaceae ， because cells of this genus have swollen swollen gelatinous layers surrounding the contractile vacuoles and lack pseudoflagella immotile immotile colony (e. g.
    [Show full text]
  • Lobo MTMPS (2019) First Record of Tetraspora Gelatinosa (Vaucher) Desvaux (Tetrasporales, Chlorophyceae) in the State of Goiás, Central-Western Brazil
    15 1 NOTES ON GEOGRAPHIC DISTRIBUTION Check List 15 (1): 143–147 https://doi.org/10.15560/15.1.143 First record of Tetraspora gelatinosa Link ex Desvaux (Tetrasporales, Chlorophyceae) in the state of Goiás, Central-Western Brazil Weliton José da Silva1, Ina de Souza Nogueira2, Maria Tereza Morais Pereira Souza Lobo3 1 Universidade Estadual de Londrina, Centro de Ciências Biológicas, Departamento de Biologia Animal e Vegetal, Laboratório de Microalgas Continentais, Rodovia Celso Garcia Cid, Pr 445 Km 380, CEP 86057-970, Londrina, PR, Brazil. 2 Universidade Federal de Goiás, Instituto de Ciências Biológicas, Departamento de Botânica, Laboratório de Análise de Gerenciamento Ambiental de Recursos Hídricos, Alameda Palmeiras Quadra I - Lote i2, CEP 74690-900, Goiânia, GO, Brazil. 3 Universidade Federal de Goiás, Programa de Pós-graduação em Ciências Ambientais, Laboratório de Análise de Gerenciamento Ambiental de Recursos Hídricos, Alameda Palmeiras Quadra I - Lote i2, CEP 74690-900, Goiânia, GO, Brazil. Corresponding author: Weliton José da Silva, [email protected] Abstract Tetraspora gelatinosa is rare and has been recorded only in 3 Brazilian states since the 2000s. The flora of the state of Goiás is incipiently known, but there is no record of Tetraspora thus far. We record the occurrence of T. gelatinosa in Goiás and characterize this species’ morphology and ecological preferences. Specimens were found in the Samambaia Reservoir, Goiânia, Goiás. Physical and chemical characteristics of the water were measured. Where T. gelatinosa was found, the water was shallow and characterized as ultraoligotrophic. These conditions agree with those reported for other environments in Brazil. Key words Algae, Meia Ponte river basin, new record, rare species, ultraoligotrophic.
    [Show full text]
  • Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016
    Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016 April 1981 Revised, May 1982 2nd revision, April 1983 3rd revision, December 1999 4th revision, May 2011 Prepared for U.S. Department of Commerce Ohio Department of Natural Resources National Oceanic and Atmospheric Administration Division of Wildlife Office of Ocean and Coastal Resource Management 2045 Morse Road, Bldg. G Estuarine Reserves Division Columbus, Ohio 1305 East West Highway 43229-6693 Silver Spring, MD 20910 This management plan has been developed in accordance with NOAA regulations, including all provisions for public involvement. It is consistent with the congressional intent of Section 315 of the Coastal Zone Management Act of 1972, as amended, and the provisions of the Ohio Coastal Management Program. OWC NERR Management Plan, 2011 - 2016 Acknowledgements This management plan was prepared by the staff and Advisory Council of the Old Woman Creek National Estuarine Research Reserve (OWC NERR), in collaboration with the Ohio Department of Natural Resources-Division of Wildlife. Participants in the planning process included: Manager, Frank Lopez; Research Coordinator, Dr. David Klarer; Coastal Training Program Coordinator, Heather Elmer; Education Coordinator, Ann Keefe; Education Specialist Phoebe Van Zoest; and Office Assistant, Gloria Pasterak. Other Reserve staff including Dick Boyer and Marje Bernhardt contributed their expertise to numerous planning meetings. The Reserve is grateful for the input and recommendations provided by members of the Old Woman Creek NERR Advisory Council. The Reserve is appreciative of the review, guidance, and council of Division of Wildlife Executive Administrator Dave Scott and the mapping expertise of Keith Lott and the late Steve Barry.
    [Show full text]
  • The Plankton Lifeform Extraction Tool: a Digital Tool to Increase The
    Discussions https://doi.org/10.5194/essd-2021-171 Earth System Preprint. Discussion started: 21 July 2021 Science c Author(s) 2021. CC BY 4.0 License. Open Access Open Data The Plankton Lifeform Extraction Tool: A digital tool to increase the discoverability and usability of plankton time-series data Clare Ostle1*, Kevin Paxman1, Carolyn A. Graves2, Mathew Arnold1, Felipe Artigas3, Angus Atkinson4, Anaïs Aubert5, Malcolm Baptie6, Beth Bear7, Jacob Bedford8, Michael Best9, Eileen 5 Bresnan10, Rachel Brittain1, Derek Broughton1, Alexandre Budria5,11, Kathryn Cook12, Michelle Devlin7, George Graham1, Nick Halliday1, Pierre Hélaouët1, Marie Johansen13, David G. Johns1, Dan Lear1, Margarita Machairopoulou10, April McKinney14, Adam Mellor14, Alex Milligan7, Sophie Pitois7, Isabelle Rombouts5, Cordula Scherer15, Paul Tett16, Claire Widdicombe4, and Abigail McQuatters-Gollop8 1 10 The Marine Biological Association (MBA), The Laboratory, Citadel Hill, Plymouth, PL1 2PB, UK. 2 Centre for Environment Fisheries and Aquacu∑lture Science (Cefas), Weymouth, UK. 3 Université du Littoral Côte d’Opale, Université de Lille, CNRS UMR 8187 LOG, Laboratoire d’Océanologie et de Géosciences, Wimereux, France. 4 Plymouth Marine Laboratory, Prospect Place, Plymouth, PL1 3DH, UK. 5 15 Muséum National d’Histoire Naturelle (MNHN), CRESCO, 38 UMS Patrinat, Dinard, France. 6 Scottish Environment Protection Agency, Angus Smith Building, Maxim 6, Parklands Avenue, Eurocentral, Holytown, North Lanarkshire ML1 4WQ, UK. 7 Centre for Environment Fisheries and Aquaculture Science (Cefas), Lowestoft, UK. 8 Marine Conservation Research Group, University of Plymouth, Drake Circus, Plymouth, PL4 8AA, UK. 9 20 The Environment Agency, Kingfisher House, Goldhay Way, Peterborough, PE4 6HL, UK. 10 Marine Scotland Science, Marine Laboratory, 375 Victoria Road, Aberdeen, AB11 9DB, UK.
    [Show full text]
  • Plant Life Magill’S Encyclopedia of Science
    MAGILLS ENCYCLOPEDIA OF SCIENCE PLANT LIFE MAGILLS ENCYCLOPEDIA OF SCIENCE PLANT LIFE Volume 4 Sustainable Forestry–Zygomycetes Indexes Editor Bryan D. Ness, Ph.D. Pacific Union College, Department of Biology Project Editor Christina J. Moose Salem Press, Inc. Pasadena, California Hackensack, New Jersey Editor in Chief: Dawn P. Dawson Managing Editor: Christina J. Moose Photograph Editor: Philip Bader Manuscript Editor: Elizabeth Ferry Slocum Production Editor: Joyce I. Buchea Assistant Editor: Andrea E. Miller Page Design and Graphics: James Hutson Research Supervisor: Jeffry Jensen Layout: William Zimmerman Acquisitions Editor: Mark Rehn Illustrator: Kimberly L. Dawson Kurnizki Copyright © 2003, by Salem Press, Inc. All rights in this book are reserved. No part of this work may be used or reproduced in any manner what- soever or transmitted in any form or by any means, electronic or mechanical, including photocopy,recording, or any information storage and retrieval system, without written permission from the copyright owner except in the case of brief quotations embodied in critical articles and reviews. For information address the publisher, Salem Press, Inc., P.O. Box 50062, Pasadena, California 91115. Some of the updated and revised essays in this work originally appeared in Magill’s Survey of Science: Life Science (1991), Magill’s Survey of Science: Life Science, Supplement (1998), Natural Resources (1998), Encyclopedia of Genetics (1999), Encyclopedia of Environmental Issues (2000), World Geography (2001), and Earth Science (2001). ∞ The paper used in these volumes conforms to the American National Standard for Permanence of Paper for Printed Library Materials, Z39.48-1992 (R1997). Library of Congress Cataloging-in-Publication Data Magill’s encyclopedia of science : plant life / edited by Bryan D.
    [Show full text]
  • Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes
    LysR transcriptional regulator Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 13/164 (8%) 70530- SNQAIKTYLMPK*LRLLRQK*SPVEFQLQVHLIKKIRLNIVIRDINLTIIEN-TPVKLKI -70354 ++Q TYLMP+ + L RQK V QLQVH ++I ++ INL II P++LK 86251- ASQTTGTYLMPRLIGLFRQKYPQVAVQLQVHSTRRIAWSVANGHINLAIIGGEVPIELKN -86072 70353- FYTLLRMKERI*H*YCLGFL------FQFLIAYKKKNLYGLRLIKVDIPFPIRGIMNNP* -70192 + E L + F L + +K++LY LR I +D IR +++ 86071- MLQVTSYAED-----ELALILPKSHPFSMLRSIQKEDLYRLRFIALDRQSTIRKVIDKVL -85907 70191- IKTELIPRNLN-EMELSLFKPIKNAV*PGLNVTLIFVSAIAKEL -70063 + + EMEL+ + IKNAV GL + VSAIAKEL 85906- NQNGIDSTRFKIEMELNSVEAIKNAVQSGLGAAFVSVSAIAKEL -85775 ycf3 Photosystem I assembly protein Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 3/59 (5%) 19162- NRSYML-SIQCM-PNNSDYVNTLKHCR*ALDLSSKL-LAIRNVTISYYCQDIIFSEKKD -19329 +RSY+L +I + +N +YV L++ ALDL+S+L AI N+ + Y+ Q + SEKKD 19583- DRSYILYNIGLIYASNGEYVKALEYYHQALDLNSRLPPAINNIAVIYHYQGVKASEKKD -19759 Fig.S1. The pairwise aligments of high scoring pairs of recognizable pseudogenes. The upper amino acid sequences indicates Cryptomonas sp. SAG977-2f. The lower sequences are corresponding amino acid sequences of homologs in C. curvata CCAP979/52. Table S1. Presence/absence of protein genes in the plastid genomes of Cryptomonas and representative species of Cryptomonadales. Note; y indicates pseudogenes. Photosynthetic Non-Photosynthetic Guillardia Rhodomonas Cryptomonas C. C. curvata C. curvata parameciu Guillardia Rhodomonas FBCC300 CCAP979/ SAG977 CCAC1634 m theta salina -2f B 012D 52 CCAP977/2 a rps2 + + + +
    [Show full text]
  • Altitudinal Zonation of Green Algae Biodiversity in the French Alps
    Altitudinal Zonation of Green Algae Biodiversity in the French Alps Adeline Stewart, Delphine Rioux, Fréderic Boyer, Ludovic Gielly, François Pompanon, Amélie Saillard, Wilfried Thuiller, Jean-Gabriel Valay, Eric Marechal, Eric Coissac To cite this version: Adeline Stewart, Delphine Rioux, Fréderic Boyer, Ludovic Gielly, François Pompanon, et al.. Altitu- dinal Zonation of Green Algae Biodiversity in the French Alps. Frontiers in Plant Science, Frontiers, 2021, 12, pp.679428. 10.3389/fpls.2021.679428. hal-03258608 HAL Id: hal-03258608 https://hal.archives-ouvertes.fr/hal-03258608 Submitted on 11 Jun 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. fpls-12-679428 June 4, 2021 Time: 14:28 # 1 ORIGINAL RESEARCH published: 07 June 2021 doi: 10.3389/fpls.2021.679428 Altitudinal Zonation of Green Algae Biodiversity in the French Alps Adeline Stewart1,2,3, Delphine Rioux3, Fréderic Boyer3, Ludovic Gielly3, François Pompanon3, Amélie Saillard3, Wilfried Thuiller3, Jean-Gabriel Valay2, Eric Maréchal1* and Eric Coissac3* on behalf of The ORCHAMP Consortium 1 Laboratoire de Physiologie Cellulaire et Végétale, CEA, CNRS, INRAE, IRIG, Université Grenoble Alpes, Grenoble, France, 2 Jardin du Lautaret, CNRS, Université Grenoble Alpes, Grenoble, France, 3 Université Grenoble Alpes, Université Savoie Mont Blanc, CNRS, LECA, Grenoble, France Mountain environments are marked by an altitudinal zonation of habitat types.
    [Show full text]
  • Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea
    Baltic Sea Environment Proceedings No.106 Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Baltic Sea Environment Proceedings No. 106 Biovolumes and size-classes of phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Authors: Irina Olenina, Centre of Marine Research, Taikos str 26, LT-91149, Klaipeda, Lithuania Susanna Hajdu, Dept. of Systems Ecology, Stockholm University, SE-106 91 Stockholm, Sweden Lars Edler, SMHI, Ocean. Services, Nya Varvet 31, SE-426 71 V. Frölunda, Sweden Agneta Andersson, Dept of Ecology and Environmental Science, Umeå University, SE-901 87 Umeå, Sweden, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Norbert Wasmund, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Susanne Busch, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Jeanette Göbel, Environmental Protection Agency (LANU), Hamburger Chaussee 25, D-24220 Flintbek, Germany Slawomira Gromisz, Sea Fisheries Institute, Kollataja 1, 81-332, Gdynia, Poland Siv Huseby, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Maija Huttunen, Finnish Institute of Marine Research, Lyypekinkuja 3A, P.O. Box 33, FIN-00931 Helsinki, Finland Andres Jaanus, Estonian Marine Institute, Mäealuse 10 a, 12618 Tallinn, Estonia Pirkko Kokkonen, Finnish Environment Institute, P.O. Box 140, FIN-00251 Helsinki, Finland Iveta Ledaine, Inst. of Aquatic Ecology, Marine Monitoring Center, University of Latvia, Daugavgrivas str. 8, Latvia Elzbieta Niemkiewicz, Maritime Institute in Gdansk, Laboratory of Ecology, Dlugi Targ 41/42, 80-830, Gdansk, Poland All photographs by Finnish Institute of Marine Research (FIMR) Cover photo: Aphanizomenon flos-aquae For bibliographic purposes this document should be cited to as: Olenina, I., Hajdu, S., Edler, L., Andersson, A., Wasmund, N., Busch, S., Göbel, J., Gromisz, S., Huseby, S., Huttunen, M., Jaanus, A., Kokkonen, P., Ledaine, I.
    [Show full text]