CATBMP_2015_US_Cover_2014 10/23/14 11:26 AM Page 1
Premium Science, Technology, and Medical eBook Collections
Ask about Free Trials
✦ More than 12,000 references in over 350 subject areas ✦ Comprehensive, customizable, and cost-effective ✦ Up-to-date information with new titles added monthly
Take a Video Tour at www.CRCnetBASE.com
Catalog no. CATBMP
[email protected] 1-888-318-2367 US VERSION The following subject catalogs are also available from CRC Press. Visit www.crcpress.com/catalogs or contact your local sales representative for copies.
www.crcpress.com/catalogs Science, Technology, and Medical
4 Agriculture & Life Sciences 4 Environmental Science & Engineering Knowledge for the Next Generation
4 Biomedical Sciences 4 Ergonomics & Human Factors, Industrial Engineering & Manufacturing 4 Business, Management, & Public Administration 4 Food Science & Nutrition
4 Chemistry & Chemical Engineering 4 Forensic Science, Law Enforcement, & Homeland Security 4 Civil & Mechanical Engineering 4 Mathematics & Statistics 4 Computer Science, Information Technology, & Game Development 4 Medicine & Veterinary Medicine
4 Electrical Engineering 4 Physics & Materials Science
Discover More at www.crcpress.com
• Related titles, tables of contents, and new and With more than a century of publishing excellence, forthcoming publications as science evolves, so do we.
• Book reviews by industry influencers and thought leaders • Authoritative STM references that cover the latest developments • Our Featured Authors community with detailed author bios, and emerging trends news about their work, and the latest research • Textbooks with ancillary materials that make teaching easier
• Digital content delivery that provides anywhere, anytime access in multiple formats
CRC Press Go to www.crcpress.com to find out more. CRC Press Go to www.crcpress.com for detailed information on every book. Taylor & Francis Group Taylor & Francis Group Business &Finance Lean &SixSigma Hospitality &Tourism Management. Healthcare ProcessImprovement...... Healthcare FinancialManagement&Leadership...... Healthcare Administration&Policy...... Finance &Investing...... Business Management...... Business InformationSystems...... Human Resources &Training. Mistake-Proofing -Poka-Yoke Lean Basics...... Finance &Investing...... Security Management...... Sales, Marketing,&Service Project Management...... Metrics &Finances...... Mathematics &StatisticsforFinance...... Leadership &Strategy...... Value StreamManagement...... Tools &Methods ...... Productivity Improvement...... Product Development...... Organizational Culture...... Office &AdministrativeProcesses...... Table ofContents ...... 16 15 13 11 24 25 56 56 50 49 40 39 31 26 59 69 66 66 65 62 60 5 3
Business, Management, & Public Administration Table of Contents continued...
Manufacturing & Industrial Processes
Facility Management & Plant Engineering...... 70
Implementation - Case Studies...... 73
Manufacturing & Industrial Engineering...... 75
Manufacturing & Processing...... 76
Operations Research...... 78
Product Development...... 79
Production Systems...... 81
Quality Control & Reliability...... 82
Supply Chain Management/Logistics...... 91
Public Administration
Disaster Planning & Recovery...... 97
Fundamentals...... 101
Government & Education...... 106
Leadership & Performance...... 106
Planning & Development...... 108
Policy...... 111
Public Health...... 117
General Reference...... 117
Title Index...... 119
Author Index...... 123
Sales Agents...... 127 Suggested Price: 2014,6x 9, 360pp. February eBook ISBN:978-1-4822-4057-3 Print ISBN:978-1-77188-007-7 professional practice. IT alignment.Thechaptersprovideasolidfoundationforcross-disciplinary organize thefunctionsofsystemsacrossanenterpriseforeffectivebusiness- on whatenterprisearchitecture (EA)isandhowitcanbeusedtobetter This bookgatherstogetheracriticalbodyofknowledge Alexandru IoanCuzaUniversity, Iasi,Romania Liviu GabrielCretu Edited by with ITInfrastructure Integrating BusinessProcesses Architecture Frameworks Designing Enterprise Suggested Price: July 2014,7x10,808pp. eBook ISBN:978-1-4665-0240-6 Print ISBN:978-1-4665-0239-0 other helpfultechniquesarealsoprovided. approaches such as use of soft systems skillsare illustrated in applications,and A numberofthecasestudiesfocusonaddressingrealhumanneeds.Diverse range of domains that demonstrate the underlyingprinciplesandbestpractices. practitionerspresentandanalyzecasestudiesfroma engineering (CSE).Industry engineering (SoSE),enterprisesystems(ESE),andcomplex a textbookforclassroomuse,thisbookprovidesanunderstandingofsystems practitionersandas Suitable asareferenceforindustry Series: ComplexandEnterpriseSystemsEngineering S. JimmyGandhi,andBrianSauser Alex Gorod,BrianE.White,Vernon Ireland, Edited by Complex SystemsEngineering Systems, Enterprise Systems, and Case StudiesinSystemof Suggested Price: December 2013,6-1/8x9-1/4,564pp. eBook ISBN:978-1-4665-7838-8 Print ISBN:978-1-4665-7837-1 tools andtechnologiesinrealpracticalapplications. information management.ItemphasizestheadoptionanddiffusionofBigData that discussthetechnicalandpracticalissuesrelatedtoBigDatainintelligent cases andindustry This bookpresentsamixoftheory rate due to marketforces andtechnological evolution. for BigDatacomputingisdevelopingatasatisfactory challenges of Big Data.Moreover, the technologyrequired Novel approachesandtoolshaveemergedtotacklethe Western Research Norway Institute,Sogndal Rajendra Akerkar Edited by Big DataComputing
$104.95 /£65.99 $119.95 /£76.99 $149.95 /£89.00
For more informationand acompletelistof titles,visitusat www.crcpress.com
Implementation Directing theERP Suggested Price: September 2014,7x10,602pp. eBook ISBN:978-1-4398-6065-6 Print ISBN:978-1-4398-6059-5 and softwaretoolsfordevelopingWindows andweb-basedinformationsystems. in engineering,businessandsciencefieldstolearnup-to-dateconcepts,methods modeling anddesignmethods.Itisdesignedtoenablestudentsprofessionals both Windows-based andWeb-based informationsystems,specificallydata languages andsoftwaretoolsofdesigningdeveloping This textbookcoversconcepts,methods,programming Arizona StateUniversity, Phoenix,USA Nong Ye andTeresa Wu Systems and Web-Enabled Information Developing Windows-Based Textbook Suggested Price: May 2012,6-1/8x9-1/4,406pp. eBook ISBN:978-1-4398-5289-7 Print ISBN:978-1-4398-5288-0 withpractice. frameworks proposedinthebooktieGeneral SystemsTheory andintegration the integrationofsystems?Thesystems integrationtheory product withitsenvironment,andare theremethodsthatcombinetoimprove express the interplayof human actionsand the result of system interactionsofa systems integrationmetrics.Thebookaddressestwoquestions:Isthereaway to systems managers and systems engineers to consider their decisions in light of practical andproductivemanner, thisbook prepares systems integrationandhowtoexpositthemintoa The firstbooktoaddresstheunderlyingpremisesof Institute, Adelaide and TheUniversityofSouthAustralia,DefenceSystems The NavalPostgraduateSchool,Monterey, California USA O.Langford Gary Theory, Metrics,andMethods Engineering SystemsIntegration Suggested Price: March 2015,7x10,312 pp. Print ISBN:978-1-4822-4841-8 quality, andmaximumreturnoninvestment. Together thesetoolsinsuresmoothplanningandsystemsdeployment,product and ProjectMonitoringDeployment,coveringprojectriskmanagement. Framework, whichaddressespreparingtheoperatingproductionenvironment; teams toobjectivesseamlessly;Education,Training and Implementation (IWS), whichdefinesquality;ConferenceRoomPiloting,assistsinmatching unique results-provenmethodssuchas:InformationWorkmanship Standard and integrationthroughtoreturnoninvestment.Bestpracticetoolsetsinclude fromsoftwareselection implementations success,thisbookcoverseverything A roadmaptoEnterpriseResource Management Series: Resource Management Michael W. Pelphrey System Performance Program FailureTraps WhileTuning A BestPracticeGuidetoAvoiding $129.95 /£49.99 $139.95 /£89.00 $89.95 /£57.99
3 Business Information Systems Enterprise Dynamics Sourcebook The SAP Materials Management Edited by Handbook Kenneth C. Hoffman, Christopher G. Glazner, Ashfaque Ahmed William J. Bunting, Leonard A. Wojcik, SCM Consulting, Bhilai, Chattisgarh, India and Anne Cady This handbook provides a complete understanding of The Enterprise Dynamics Sourcebook presents how to configure and implement the SAP materials frameworks and analytical models of the enterprise as a management module across various types of projects. It complex system to improve reader’s understanding of its uses system screenshots of SAP environments to illustrate dynamic elements and their interactions. This sourcebook the complete flow of business transactions involved with is the product of MITRE-sponsored research on enterprise dynamics and the SAP MM. Supplying detailed explanations of the steps involved, it presents Business Information Systems range of applications pertaining to enterprise transformation programs. Filled case studies from actual projects that demonstrate how to convert theory into with examples, it provides the understanding of the qualitative and quantitative powerful SAP MM solutions. The book explains how to use the SAP MM module data-analytic methods required to reduce risk and failure rates and enable an to take care of the complete range of business functions related to purchasing organization to operate effectively in today’s complex and ever-changing and inventory management. environment. Print ISBN: 978-1-4665-8162-3 Print ISBN: 978-1-4200-8256-2 eBook ISBN: 978-1-4665-8163-0 eBook ISBN: 978-1-4200-8257-9 March 2014, 7 x 10, 443 pp. February 2013, 6-1/8 x 9-1/4, 379 pp. Suggested Price: $79.95 / £49.99 Suggested Price: $94.95 / £59.99
Information Security Policy Social Computing Development for Compliance Edited by ISO/IEC 27001, NIST SP 800-53, HIPAA San Murugesan Multimedia University, Selangor, Malaysia Standard, PCI DSS V2.0, and AUP V5.0 Many individuals and enterprises will soon be computing Barry L. Williams in the clouds. Cloud computing offers on-demand, Williams Technology Audit Services, Alton, Illinois, USA utility-like availability of computing resources at a low Compliance standards, of which there are many, can and cost. A critical understanding of cloud computing is should be used as a guide to write comprehensive and essential to leverage the opportunities and benefits effective security policies. Many standards cover much of the same topics, but that this new computing paradigm offers. This book provides a comprehensive they each state the requirements in slightly different ways. This book provides overview of cloud computing concepts, technologies, businesses models, security managers with a simplified way to address the regulatory requirements strategies, and applications. It also examines potential risks and challenges of of an organization by writing policy statements that specifically address these cloud computing. Written by international experts, the text addresses different requirements. The book enables them to more efficiently write policies that meet aspects of cloud computing, including resource issues, security, and cost-effective the major regulatory requirements. scalable applications. Print ISBN: 978-1-4665-8058-9 Print ISBN: 978-1-4398-1998-2 eBook ISBN: 978-1-4665-8059-6 June 2015, 6-1/8 x 9-1/4, 400 pp. 4 March 2013, 6-1/8 x 9-1/4, 152 pp. Suggested Price: $79.95 / £49.99 Suggested Price: $59.95 / £39.99
Model-Driven Engineering of What Every Engineer Should Information Systems Know About Cyber Security Principles, Techniques, and Practice and Digital Forensics Edited by Joanna F. DeFranco Liviu Gabriel Cretu and Florin Dumitriu The Pennsylvania State University, Malvern, USA Alexandru Ioan Cuza University, Iasi, Romania Series: What Every Engineer Should Know
Model-driven engineering (MDE) is the automatic Designed for the non-security professional, this volume is production of software from simplified models of an overview of cyber security and digital forensics. Topics structure and functionality. It mainly involves the automation of the routine and include network and personal data security, the information security common technologically complex programming tasks, thus allowing developers to focus body of knowledge, cloud and mobile computing, preparing for and responding on the true value-adding functionality that the system needs to deliver. This book to an incident, evidence handling, security compliance, and law. It also examines serves an overview of some of the core topics in MDE. The volume is broken security certifications and reference manuals in the area of information security into two sections offering a selection of papers that helps the reader not only and digital forensics. By mastering the principles in this volume, engineering understand the MDE principles and techniques, but also learn from practical professionals will not only better understand how to mitigate the risk of security examples. incidents and keep their data secure, but also understand how to break into this expanding field. Print ISBN: 978-1-77188-083-1 eBook ISBN: 978-1-4987-0634-6 Print ISBN: 978-1-4665-6452-7 October 2014, 6 x 9, 350 pp. eBook ISBN: 978-1-4665-6454-1 Suggested Price: $149.95 / £95.00 October 2013, 6-1/8 x 9-1/4, 168 pp., Soft Cover Suggested Price: $62.95 / £39.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: September 2014,6-1/8x9-1/4,240 pp. eBook ISBN:978-1-4665-9238-4 Print ISBN:978-1-4665-9237-7 way anorganizationcanuseBigData. different areaoflawineachchapterandexplainhowtheselawscanaffect the book brings together a collection of subject matter experts that examine a solutions to collecting, licensing, handling, and using Big Data. The powerful readers toquicklygraspthekeyissuesandimmediatelybeginimplementing accessible primer on Big Data and its business implications, this book will enable and lawyers(in-houseinprivatepractice)withan that impactitsuse.Providingbusinessprofessionals Data andthelaws,regulations,contractingpractices understanding oftheinterrelationshipsbetweenBig Big Data:ABusinessandLegalGuidesuppliesaclear Foley &LardnerLLP, LosAngeles,California,USA James R.KalyvasandMichaelOverly A BusinessandLegalGuide Big Data Suggested Price: June 2015,6x9,350pp. Print ISBN:978-1-4822-4531-8 effectivemanner.problem solvinginasimple,focused,andpowerfully asamajorconceptualadvancein This bookisthefirsttopresentdramatheory and offersaframeworktofacilitatetheresolutionofmostarrestingproblems. and rationalthoughtcansometimesmakemattersworseindifficultsituations and conflictual problems.It describeshowemotion canbeappliedtoaddressthemostcomplex theory international level,thisbookdemonstrateshowdrama solving onapersonal,local,business,national,or Presenting ahighlyuniqueapproachtoproblem Sheffield HallamUniversity, UK James William Bryant Drama Theory Acting StrategicallyUsing Suggested Price: July 2014,6-1/8x9-1/4,549pp. eBook ISBN:978-1-4987-0529-5 Print ISBN:978-1-4665-6435-0 development. and examplesofthemostimportanttoolsinLeanmanagementsystems to successfulapplicationinthefield.Eachchapterfeaturesbriefsummaries reference guidetohelpmanagersandleadersmakethetransitionfromtheory culture. Packedwithdetailedexamplesandstep-by-stepinstructions,it’s anideal philosophy, beliefs,andbehaviorsrequiredtodevelopathrivingLeancompany daily managementactivities.ItalsodefinestheLean levels of theorganization can integrate Lean into their Lean management.Itexplainshowmanagersatall that describescriticalcomponentsforsustainable This handbookpresentsafirst-of-its-kindapproach and HalWiggin Rich Charron,H.JamesHarrington,FrankVoehl, Handbook The LeanManagementSystems $59.95 /£38.99 $99.95 /£63.99 $59.95 /£38.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Bringing JobsBacktotheUSA Suggested Price: April 2013,6-1/8x9-1/4,304pp. eBook ISBN:978-1-4665-6579-1 Print ISBN:978-1-4665-6578-4 interested inthisemergingfield. managers, aswellforbusiness,management,andtechnologystudents healthcare, andtransportation.ItoffersaconciseguideforCEOssenior domains suchascybersecurity, marketing,finance,emergencymanagement, come intoplay. leadersinbigdata Thisbookexplorescasestudiesfromindustry competitive advantage.That’s wherebusinessanalytics and effective way to improvetheirdecisionmaking and for organizationstomakesenseofthisdatainatimely With theincreasingbarrageof“bigdata,”itbecomesvital Pennsylvania, USA Harrisburg UniversityofScienceandTechnology, DiSanto Visiting ChairinAppliedBusinessandFinance, Jay Liebowitz Edited by Big DataandBusinessAnalytics Suggested Price: December 2014,6-1/8x9-1/4,280 pp. Print ISBN:978-1-4665-1575-8 competence. framework oftechnologicalcompetence, customercompetence,andlinkage examples. Theinformationispresented withinafullyformulatedtheoretical fascinating case studies featuring Japanese,Korean, and indigenous business provides athoroughreviewoftheliterature andanunparalleledabundanceof and competitiveadvantagewithinthecontextoftheseemergingmarkets. It challenges andoptimizingtheopportunitiesforbuildingnetworkcapabilities economies intheworld.Thisbookpresentsstrategiesforrecognizing the Brazil, Russia,India,andChina(BRIC)areamongthelargestfastestgrowing Series: Resource Management,49 University ofTokyo, Japan YoungWon Park University ofToledo, Ohio, USA Paul Hong Business SuccessStoriesfromtheBRICs Environments in Turbulent Competitive Building NetworkCapabilities Suggested Price: June 2014,6-1/8x9-1/4,245pp. eBook ISBN:978-1-4822-8252-8 Print ISBN:978-1-4665-5756-7 not understandingthetruecostofoffshoring. companies hadtooff-shoretheirjobsandtheerrorsofomissiontheymadeby supply chainproviders,andconsumers.Thebookrevealsthemotivationthese employees, negative effectsthishadonthequalityoftheirproductsandservices, the storiesofcompaniesthathavesenttheirjobsoutsideUSAand Your BusinessintheUSA:ProfitGloballyWhileOperatingLocally, thisbooktells A follow-uptoTim Hutzel’s previousbook,Keeping President, HamiltonCaster&Mfg.Co.,Hamilton,Ohio,USA Dave Lippert Oxford, Ohio,USA President, Tim BoardServices, HutzelAdvisory Tim Hutzel through Reshoring Rebuilding America’s Manufacturing $69.95 /£44.99 $79.95 /£44.99 $39.95 /£25.99
5 Business Management Bursting the Big Data Bubble Computational The Case for Intuition-Based Business Analytics Decision Making Subrata Das Machine Analytics, Inc., Belmont, Massachusetts, USA Edited by Chapman & Hall/CRC Data Mining and Knowledge Discovery Series Jay Liebowitz DiSanto Visiting Chair in Applied Business and Finance, This book presents tools and techniques for descriptive, Harrisburg University of Science and Technology, predictive, and prescriptive analytics applicable across Pennsylvania, USA multiple domains. The author first covers core descriptive As we get caught up in the quagmire of big data and and inferential statistics for analytics and then enhances analytics, it is important to be able to reflect and apply insights, experience, numerical statistical techniques with symbolic artificial intelligence and machine and intuition as part of the decision-making process. This book focuses on this learning techniques for richer predictive and prescriptive analytics. Through intuition-based decision making. The first part of the book presents contributions many examples and challenging case studies from a variety of fields, practitioners Business Management from leading researchers worldwide on the topic of intuition-based decision easily see the connections to their own problems and can then formulate their making as applied to management. In the second part, executives and senior own solution strategies. managers in industry, government, universities, and not-for-profits present Print ISBN: 978-1-4398-9070-7 vignettes that illustrate how they have used intuition in making key decisions. eBook ISBN: 978-1-4398-9073-8 Print ISBN: 978-1-4822-2885-4 December 2013, 6-1/8 x 9-1/4, 516 pp. eBook ISBN: 978-1-4822-2887-8 Suggested Price: $83.95 / £53.99 July 2014, 6-1/8 x 9-1/4, 351 pp. Suggested Price: $79.95 / £49.99
Textbook Consider a Spherical Patent Business Analytics IP and Patenting in An Introduction Technology Business Edited by Joseph E. Gortych Jay Liebowitz Opticus IP Law PLLC, Sarasota, Florida, USA DiSanto Visiting Chair in Applied Business and Finance, Using examples of actual patents and patent portfolios of Harrisburg University of Science and Technology, Pennsylvania, USA real technology businesses, this practical and engaging book provides key insights and perspectives on the reality This book explains how to use business analytics to sort of how patents are used and abused in the technology through an ever-increasing amount of data and improve the decision-making business. It explains often misunderstood patent phenomena, such as how and capabilities of an organization. Covering the key areas of business analytics, why invalid patents are issued by the patent office, and covers important topics the book explores the concepts, techniques, applications, and emerging trends frequently ignored or glossed over, including provisional patent applications, that professionals across a wide range of industries need to be aware of. It also independent inventors, obviousness, and the dynamic interplay between examines legal and privacy issues and explores social media in analytics. With infringeability and patent validity. this book, readers can develop the understanding required to use Big Data and high-performance computing in complex environments to improve strategic Print ISBN: 978-1-4398-8805-6 decision making. eBook ISBN: 978-1-4822-5320-7 February 2014, 6-1/8 x 9-1/4, 267 pp., Soft Cover 6 Print ISBN: 978-1-4665-9609-2 Suggested Price: $59.95 / £38.99 eBook ISBN: 978-1-4665-9611-5 December 2013, 6-1/8 x 9-1/4, 288 pp. Suggested Price: $89.95 / £57.99
Chance or Choice Textbook Unlocking Innovation Success Customer and Business Analytics Greg McLaughlin and Vinny Caraballo Applied Data Mining for Business Global Targeting, Inc., Fort Lauderdale, Florida, USA Decision Making Using R A practical guide for implementing innovation throughout Daniel S. Putler the organization, this book provides a process framework Alteryx, California, USA which the authors call ENOVALE. With this process Robert E. Krider innovation becomes a strategic component as it applies Simon Fraser University, Burnaby, British Columbia, Canada to all functions within the organization. Rather than Chapman & Hall/CRC The R Series relegating innovation to the R&D and engineering function, all departments can conduct innovation projects and claim success. The authors emphasize the Showing how data mining can improve the performance of organizations, this individual’s contribution and extend this strategy into other functions outside of book and its R-based software provide the skills and tools needed to successfully research, design, and engineering. Simply, it answers the question “how to” for develop advanced analytics capabilities. It explains and demonstrates, via the continued success. accompanying open-source software, how advanced analytical tools can address various business problems. The authors also give insight into some of the Print ISBN: 978-1-4665-8186-9 challenges faced when deploying these tools. Readers can access a powerful, eBook ISBN: 978-1-4665-8187-6 GUI-enhanced customized R package online as well as example data sets on the March 2013, 6-1/8 x 9-1/4, 219 pp., Soft Cover book’s website. Suggested Price: $62.95 / £39.99 Print ISBN: 978-1-4665-0396-0 eBook ISBN: 978-1-4665-0399-1 May 2012, 7 x 10, 315 pp., Soft Cover Suggested Price: $76.95 / £48.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: July 2014,6-1/8x9-1/4,446pp. eBook ISBN:978-1-4398-5025-1 Print ISBN:978-1-4398-5024-4 emerging trendsinenterpriseintegration anditsinformationarchitecture. illustrates the critical issues that arise in professional practice and also explores extended enterpriseintegrationinactual supplychainenvironments,thebook and enterpriseinformationintegration.Completewithnumerousexamples of information architecture forenterprises,businessprocess/workflowmodeling, systems scienceisimpactingcurrentresearch, itcoversenterprisearchitecture, integration through the application of a systems approach. Describing how This bookexplainshowtoimproveindustrialinformation Series: AdvancesinSystemsScienceandEngineering Old DominionUniversity, Virginia, Norfolk, USA Li DaXu Industrial InformationIntegration A SystemsPerspectiveon Information Architecture Enterprise Integrationand Suggested Price: October 2013,6-1/8x9-1/4,203pp.,SoftCover eBook ISBN:978-1-4665-9209-4 Print ISBN:978-1-4665-9208-7 each ofthe“means”innovation. project. The book also provideastep-by-stepprocessforinitiatingandconductinganinnovation demonstrate The authors explainwhatthestrategymeansin terms ofinnovation and the need,nominate,objectify, validate,alignandadapt,link,execute. projects followingtheENOVALE methodologies:envision This book provides a strategy for implementing innovation Global Targeting, HawthornWoods, Illinois,USA Vinny Caraballo Global Targeting Inc.,FortLauderdale,Florida,USA Greg McLaughlin Project Success How toUnlockSustainedInnovation ENOVALE Suggested Price: May 2015,6-1/8x9-1/4,225pp. Print ISBN:978-1-4822-4577-6 The bookincludes forms,templates,andchecklists. organizations recentlyinthenewsforexposureofconfidentialpatientrecords. including Firestone,Mattel,Fisher-Price,MorganStanley, andhealthcare The bookincludescasestudiesandexamplesfromavarietyofbusinesses, and opportunitiesthatcan help theirorganizationendureandrebound. book willhelpdecisionmakerstoidentifyorganizational-behaviorthreats the underlyingcausesofsuccessfulandunsuccessfulcrisismanagement.The This bookprovidesguidelinesforunderstanding K.Prescott Beryl DeVry University, DownersGrove,Illinois,USA Ken J.Brumfield Needs toKnow Organization What Every Management DecisionMaking Effect ofCultureonCrisis its transformative power for products, processes, and services. They They its transformative power for products, processes, and services. includes business examples, templates, tools, and strategies for $79.95 /£49.99 $71.95 /£45.99 $59.95 /£38.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Four-Cornered Leadership Suggested Price: October 2014,6-1/8x9-1/4,363pp. eBook ISBN:978-1-4665-5672-0 Print ISBN:978-1-4665-5671-3 material. included withmocktrialtranscriptsandotherancillary literature ofthebestmanagementtheoriesandpractice.AsupplementalDVDis and a reviewofcurrent includes case studies simulating a working laboratory efficiency andeffectivenessoftheirmanagementdecision-making.Thebook that applythebestsciencetoevidenceinamannerincreases of leadershipskills.Thistext are oftenpromotedfromcaseworkdutiesandmustnowlearnawholenewset isfrequentlyachallengeforforensicmanagers,who timely forensicservices Obtaining properresources toprovidequalityand Shippensburg University, Pennsylvania,USA Wendy S.Becker Becker–Dale Consulting,BallstonLake,NewYork, USA W. MarkDale Applying BusinessPrinciples Management Forensic Laboratory Suggested Price: May 2013,6-1/8x9-1/4,298pp. eBook ISBN:978-1-4665-8503-4 Print ISBN:978-1-4665-8502-7 departments caneasilyunderstand. the Leanmindsetinamannerthat peopleinyourbusinessandtechnology with actionable advice you can use immediately, the book introduces Agile and that businessexecutivesandtechnologyleadersfaceonaday-to-daybasis.Filled illustrations, and case studies to show you how to solve the real-world problems technology roadmapsinyourorganization.Itusesnumerousexamples, identifying businessstrategiesandcreatingvalue-driven This booklaysoutapractical,how-toapproachto Tiffany Pham,DavidK.andAndrewPham and BoardMembers A PracticalGuideforExecutives Roadmap Information Technology From BusinessStrategyto Suggested Price: August 2013,6-1/8x9-1/4,277pp. eBook ISBN:978-1-4665-9290-2 Print ISBN:978-1-4665-9289-6 toachievesustainablechange. anyone trying examples andtablesto in relationtoprevailingmanagementandorganizationaltheory. Filled with the bookanalyzeseachoffourelementssystemprofoundknowledge its application. Illustrating the power relationship between leaders and followers, This bookexaminesthissystemanddescribescompetenciesthatsetthestagefor understood andappliedtheSystemofProfoundKnowledge. also concludedthatcapableleaderswerethosewho butleadership.He management isnotsupervision W. Edwards Demingoncestatedthatthejobof and RetiredCollegeProfessor Independent ManagementConsultant John RolandSchultz A FrameworkforMakingDecisions $89.95 /£57.99 $49.95 /£31.99 $62.95 /£39.99 reinforce guide for keyconcepts,this book is the perfect provides laboratory managers with business tools managerswithbusinesstools provides laboratory
7 Business Management Getting Started with Impact Analytics Business Analytics Making Every Decision Count Insightful Decision-Making Ryan Burge The Boulevard Consulting Group, Arlington, Virginia, USA David Roi Hardoon Galit Shmueli Business impact analysis is an essential component of Indian School of Business, Hyderabad an organization’s business continuance plan. This book presents proven methodologies to help business leaders Helping you make sound decisions based on hard data, understand the impact of their decisions now and this self-contained guide provides an integrated framework into the future. The authors share valuable methods, of data mining in business analytics. It explores the contents, capabilities, and coupled with real cases, interviews, and other strategic insights that all business applications of business analytics without assuming any prior knowledge or leaders can use to improve their decision-making ability. This book implements technical skills. The authors describe business analytics from a non-commercial the fundamentals of operations research, cost budgeting, risk management Business Management standpoint, demystify the main concepts and terminologies, and give many planning, Six Sigma, and data visualization. Each chapter highlights best examples of real-world applications. They take you on a journey through this practices, as well as case studies from government and the private sector. data-rich world, showing you how to deploy business analytics solutions in your organization. Print ISBN: 978-1-4822-4620-9 May 2015, 7 x 10, 225 pp. Print ISBN: 978-1-4398-9653-2 Suggested Price: $69.95 / £44.99 eBook ISBN: 978-1-4822-0587-9 March 2013, 7 x 10, 190 pp. Suggested Price: $59.95 / £38.99
The Guide to Entrepreneurship Implementing SAP® CRM How to Create Wealth for Your The Guide for Business Company and Stakeholders and Technology Managers Michael Szycher, Ph.D Vivek Kale Sterling Biomedical, Inc., Lynnfield, Massachusetts Independent Strategy and Management Consultant, Thane (West), India This how-to guide to intrapreneurship and entrepreneurship explores what constitutes entrepreneurial timber and the This book will help technologists and managers come to leadership skills required to raise all the needed capital. grips with the vision, concept, and technology of CRM. It Demystifying the process of founding a firm from scratch, begins by laying out the groundwork for understanding the book provides aspiring entrepreneurs with concrete action plans and detailed CRM. It explains the concept and context of CRM and the tangible business guidance written in plain English. Identifying the unique set of characteristics benefits of CRM adoption. Demonstrating a professional approach to the that are shared by successful entrepreneurs, this guide will be especially helpful evaluation and selection of SAP, it details the Critical Success Factors (CSF), to those seeking to start new ventures that require a high degree of scientific patterns, and anti-patterns of a successful SAP CRM implementation. knowledge. Print ISBN: 978-1-4822-3142-7 Print ISBN: 978-1-4822-0907-5 December 2014, 7 x 10, 493 pp. eBook ISBN: 978-1-4822-0908-2 Suggested Price: $89.95 / £57.99 8 August 2014, 7 x 10, 427 pp., Soft Cover Suggested Price: $49.95 / £31.99
A Guide to IT Contracting The Independent Professional Checklists, Tools, and Techniques A Roadmap for Self-Employment Michael R. Overly Success Foley & Lardner LLP, Los Angeles, California, USA Katy Tynan Matthew A. Karlyn Safety Partners, Inc., Bedford, Massachusetts, USA Technology Transactions Practice, Cooley LLP, Boston, MA The full-time employee, the staple of the US workplace, Distilling critical business and legal lessons learned from is becoming an endangered species. We are on the decades of drafting and negotiating technology-related brink of a seismic shift in the employer/employee agreements, this highly accessible handbook allows relationship that will redefine the nature of jobs and readers to quickly access information on almost every type of agreement and careers. This book describes what’s driving this change and includes a pragmatic immediately understand the intended and actual purpose. It includes key business action plan for professionals who wish to survive the challenge of how to be and legal issues, tips and techniques for negotiating terms, and common pitfalls. successful in this “new skills marketplace”. Suitable for non-legal professionals, it offers checklists to organize concepts and Print ISBN: 978-1-4822-5881-3 a complete glossary to define key legal, business, and technical terms as well as April 2015, 6-1/8 x 9-1/4, 160 pp., Soft Cover Internet resources and online aids to assist in drafting contracts. Suggested Price: $29.95 / £19.99 Print ISBN: 978-1-4398-7657-2 eBook ISBN: 978-1-4398-7659-6 December 2012, 6-1/8 x 9-1/4, 448 pp. Suggested Price: $79.95 / £49.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: April 2015,6-1/8x9-1/4,256pp. Print ISBN:978-1-4987-0458-8 management models(mostlyAmerican byorigin)inotherculturesaswell. to-day activities.Thebookgivespractical strategiesforhowtoapplypopular dimensions ofcultureyetstruggletotranslatetheseinsightspractical, day- other countries.Managersquiteoftenareawareconceptuallyofthedifferent and dealwithpartners,suppliers,customersfrom concretely tomanagetheir(virtual)intercultural teams This bookgivesmanagersinsightintowhattheycando Frank GartenBV with Worldwide Colleagues Cooperating, andNegotiating A GuideforCommunicating, The InternationalManager Suggested Price: October 2014,6-1/8x9-1/4,254pp. Print ISBN:978-1-4822-1012-5 creating brandingforpublicinvestorsandmore. the fundablemilestonesforangelandventurecapital.Italsoprovidestools satisfied, alongthe way. It presentsdataand analyticalprocesses articulating skills tobeacquiredandtheconstituenciesthatmust data,partnership,and an appreciationforthenecessary sciences start-upfrominitiationtoexit.Thereadersgain to create a successful life methodologies necessary This book specifically provides the reader with the Carnegie MellonUniversity, Pittsburgh,Pennsylvania,USA James F. Jordan and Start-UpsinLifeSciences Innovation, Commercialization, Suggested Price: April 2015,7x10,400pp.,SoftCover Print ISBN:978-1-4822-2370-5 presented throughoutthebook. future, willbenefitpersonallyfromknowingit.Cutting-edgetechnologyisalso content directly to students’ needs by showing how they, on the job in the students at mostbusinessschoolsarenotISmajors.Thebookconnectsthe that isofvalueonlytoinformationsystemsspecialists,sincethe majority material allbusinessprofessionalsneedtoknow. Thebookeliminatesmaterial that’s accessible tostudents.Itpresents carefully selectedcontentthat coversthe This textbookpresentsinformationsystemsinamanner Series: Chapman&Hall/CRCTextbooks inComputing Rhode IslandCollege,Providence,USA Efrem G.Mallach to Know BusinessStudentNeeds What Every Information Systems Textbook $49.95 /£31.99 $89.95 /£57.99 $89.95 /£49.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
of Excellence Inverting theParadox Suggested Price: June 2015,7x10,650pp. Print ISBN:978-1-4822-2176-3 syllabus foranemergingfirstcourseatMBAlevelinBusinessAnalytics. and referstheinterestedto further sources. This book establishes anational to greatcomplexityinpractice,itassociatesconceptsthroughgeneralizations examples inthoroughdetailanddesignedtoilluminatetopicsthatoftenramify concrete, specific,simpleexamplespertainingtobusinessanalytics.Offering and specialize without sacrificing its core. This book highlights this spirit using If youwanttosolveaproblem,striptheproblemofnonessentials,simplify, University, Singapore School ofInformationSystems,SingaporeManagement Lau HoongChuin Philadelphia, USA The WhartonSchool,UniversityofPennsylvania, Steven OrlaKimbrough Business Analytics Introduction to Textbook Suggested Price: December 2012,6-1/8 x9-1/4,219pp. eBook ISBN:978-1-4665-1526-0 Print ISBN:978-1-4665-1525-3 actionabletakeawaysandsolutions. offers simple,straight-forward, can beanopportunityratherthanaliability toaninnovativecompany. Thisbook and creativityrefinementtactics; anditexplainswhyeconomicfluctuation and adoptionofinnovations;itdiscussed therelationshipbetweeninnovation relates totheprocessesofinnovationinahealthyway, andthestrategictiming to customers.Theauthordiscusseshowachieveacompanyculture that higher productivity and a smoother companypresentation innovation. Itexplainshowtoeliminatewaste,allowing guides businessleadersthroughtheprocessoflean Packed withcases,statistics,andanecdotes,thisbook Queen’s University, Kingston,Ontario,Canada L.Cross Barry Economy Understanding What’s NextinToday’s Lean Innovation Suggested Price: July 2014,7x10,442pp. eBook ISBN:978-1-4665-9217-9 Print ISBN:978-1-4665-9216-2 NUMMI; aswelldetailedcasehistoriesofGE,IBM,andUPS. Samsung, Volvo, CharlesSchwab,McDonald’s, Starbucks, Google,Disney, and segmentsfromToyota,book includescasehistory Acer, eBay, Cisco,Blackberry, including structurevariations,sharedvaluesandstaffvariations.The excellence andincludesdetailedcasestudiesbasedondifferentvariations, and reframecontinuously. Itintroducesthepatternsandanti-patternsof market environmentandcompetitorstoascertainexcellencereconfigure model, thisbookexplainswhyanorganizationmustactivelymonitorthe Drawing lessonsfromoneofthebestmodelssuccess,evolutionary Thane (West), India Independent StrategyandManagementConsultant, Vivek Kale Variations AreEnabledbySAP Business ExcellenceandHowEnterprise How CompaniesUseVariations for $99.95 /£63.99 $54.95 /£34.99 $59.95 /£38.99
9 Business Management The Lean Six Sigma Black Belt Out of the Box Thinking Handbook for Successful Managers Tools and Methods William F. Roth for Process Acceleration Kutztown University, Pennsylvania, USA Frank Voehl, H. James Harrington, Chuck Mignosa, Through decades of teaching management theory, the and Rich Charron author has frequently questioned many modern-day management practices. This book explains, in a user- While at first glance Lean and Six Sigma may look very friendly and humorous manner, why these practices are different, they can work hand-in-hand to improve based on worn out logic that needs to be rethought. The processes, increase quality, and increase profitability. This book explains how book reviews a range of management theories, including Six Sigma, downsizing, these seemingly dissimilar approaches can complement one another. It teaches and management by objective. After showing where the holes lie, it offers several problem solving tools that can be used immediately to discover the root alternative approaches that have proven effective in a growing number of private
Business Management cause of defects and other problems. Based on a survey of the most beneficial Six and public sector organizations, including some that enable a more positive Sigma tools, the text includes tools that are frequently used and most beneficial. workplace culture. Print ISBN: 978-1-4665-5468-9 Print ISBN: 978-1-4822-4706-0 eBook ISBN: 978-1-4665-5469-6 eBook ISBN: 978-1-4822-4708-4 July 2013, 6-1/8 x 9-1/4, 621 pp. August 2014, 6-1/8 x 9-1/4, 229 pp. Suggested Price: $62.95 / £39.99 Suggested Price: $49.95 / £31.99
Nanotechnology Project Leadership Commercialization Creating Value with an Takuya Tsuzuki Adaptive Project Organization Australian National University, Australia Barry L. Cross and M. Kathryn Brohman In terms of commercialization, nanomaterials occupy Queen’s University, Kingston, Ontario, Canada a unique place in nanotechnology. Engineered Today’s organizations need to introduce new products nanomaterials, especially nanoparticulate materials, are and enhance existing services faster in order to remain the leading sector in nanotechnology commercialization. competitive. The common cause of project failure is that In addition, the nanomaterial sector has attracted much leadership fails to appreciate the extent of uncertainty more heated debate than any other nanotechnology sector with regard to safety, and complexity in a project and therefore doesn’t adapt their management regulation, standardization, and ethics. This is the first book on nanotechnology structure accordingly. This book highlights how successful projects rely not just commercialization that deals exclusively with nanomaterials. It provides overviews on the project team, but on the culture of executive leadership. Concepts are of the current trends in, and the issues associated with, the commercialization of presented in an anecdotal manner that will suit today’s leaders. The book offers nanomaterials by some of the foremost nanotechnology experts in their fields. straight-forward takeaways and solutions to provide executives with the tools to Print ISBN: 978-981-4303-28-6 implement an effective project environment. eBook ISBN: 978-981-4303-29-3 Print ISBN: 978-1-4822-1630-1 September 2013, 6 x 9, 480 pp. eBook ISBN: 978-1-4822-1631-8 10 Suggested Price: $99.95 / £63.99 July 2014, 6-1/8 x 9-1/4, 223 pp. Suggested Price: $49.95 / £31.99
Navigating Strategic Decisions Ready Technology The Power of Sound Analysis Fast-Tracking New Business and Forecasting Technologies John E. Triantis Stephen J. Andriole Long Range Planning Associates, Vero Beach, Florida, USA Villanova University, Pennsylvania, USA
Based on forty years of experience and research, this book Ready technology is a new category of information provides guidance on forecasting for strategic decision technology (IT) that allows companies to rapidly pilot and making. It includes methodology, tools, and models. It deploy new technologies at a very low cost. This book also explains how to apply sanity checks to existing explains the ready technology adoption process in detail, forecasts to rank project valuations, identify project risks, and select the higher enabling companies to exploit new technology immediately and effectively. It value creation projects. The author discusses how to assess the feasibility of covers the latest trends and processes in ready technology. It also describes the large projects, analyze forecasting models to determine controllable levers, and characteristics of ready companies and recommends ready technology pilots that create the conditions needed for forecasts to materialize. should be launched by the following industries: higher education, retail, and healthcare. Print ISBN: 978-1-4665-8598-0 eBook ISBN: 978-1-4665-8599-7 Print ISBN: 978-1-4822-5576-8 June 2013, 7 x 10, 435 pp. eBook ISBN: 978-1-4822-5577-5 Suggested Price: $104.95 / £65.99 September 2014, 6-1/8 x 9-1/4, 171 pp., Soft Cover Suggested Price: $49.95 / £40.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2014,6-1/8x9-1/4,568pp. Print ISBN:978-1-4665-6172-4 leverage informationandtechnologyfor acompetitiveadvantage. effectively collaboratewiththebusiness tobecomeastrategicpartnerand McKesson, andotherleadingcompaniestransformedtheirorganizations and shareholder wealth.LearnhowstrategicCIOsfromFedEx,Procter&Gamble, a strategicassetthatdrivescustomervalue,increasesrevenues,andenhances step methodologytotransformyourITorganizationinto book providesinsight,successstories,andastep-by- business executives,andacademicthoughtleaders,this withmorethan150CIOs,IT/ Based oninterviews President, StrategereConsulting,Allentown,Pennsylvania,USA Philip Weinzimer oftheBusinessEnterprise Changing theDynamics The StrategicCIO Suggested Price: August 2011,6-1/8x9-1/4,499pp. eBook ISBN:978-1-4398-4472-4 Print ISBN:978-1-4398-4471-7 facility designs,andtheirfitintourbancenters. an assessmentofownershipstructuresanddiscussesrealestatedevelopment, such asborrowingmoney, ticketpricing,andplayercompensation.Itincludes focuses onthehowandwhyofchange,ratherthantraditionalfinancetopics a realestatedevelopment,media,andentertainmentcorporation,thisbook sportsteamhasturnedto evolved. Addressing thefactthat21stCentury finance focusesonhowthemodernsportsteamhas This definitivetextonsportsmanagementand and BrianMMills Jason A.Winfree, MarkS.Rosentraub, and theRemakingofBusiness Real Estate,Entertainment, Sports FinanceandManagement Textbook Suggested Price: 2010,6x9,448pp.,SoftCover February eBook ISBN:978-1-4398-4220-1 Print ISBN:978-1-890367-55-8 Management Institute’s PMBOK ofriskpractice.UpdatedtoreflecttheProject history current information,whileremaininggroundedinthe This comprehensivefourtheditionviewsriskinlightof Carl L.Pritchard,PMP Fourth Edition Concepts andGuidance, Risk Management management, all within the project and program environments. management, allwithintheprojectandprogramenvironments. specific techniquesto enhanceorganizational riskidentification, assessment,and focusing onasystematicapproachtoriskmanagement.Theauthorhighlights and protocols.Thebook’s 35tool-packedchapterscoverthelatestperspectives, pragmatic perspective.Itisanencyclopediaofriskmanagementtools,practices, edition emphasizesgreaterclarityonriskpracticefroma $69.95 /£44.99 $79.95 /£49.99 $59.95 /£57.99 ® , this Guide,FourthEdition,this
For more informationand acompletelistof titles,visitusat www.crcpress.com
Crystal Ball Crystal Upgrading Leadership’s Suggested Price: August 2013,6-1/8x9-1/4,178pp. eBook ISBN:978-1-4665-0587-2 Print ISBN:978-1-4665-0586-5 and sustainability. and updatedthroughout,thiseditionincludesanewchapteronglobalization internal growth, the “dos and don’ts” of acquisitions, and much more. Revised avoid. Theauthoralsoexaminescompanyculture,staffing,howtomanage the thinkingbehindsuccessfulmanagerialchoicesandillustrateserrorsto affect managementdecisions.Usingcasestudiesandexamples,itdemonstrates unique,andshowshowthesefactors processing thatmaketheplasticsindustry manufacturing, compounding,distribution,and This bookexplainsthefundamentalelementsinpolymer Franklin International,LLC,Broomall,Pennsylvania,USA Roger F. Jones Sustainability, SecondEdition Dealing withGlobalizationand for thePlasticsIndustry Strategic Management Suggested Price: October 2012,6-1/8x9-1/4,295pp. eBook ISBN:978-1-4665-6267-7 Print ISBN:978-1-4665-6262-2 identify, pursue,andsuccessfullyprosecute white-collarcrime. thebooksetsoutamethodologyenablingreadersto Internal RevenueService, simple andconvincingmanner. Written by aformerSpecialAgentwiththeU.S. demonstrating howtopresentcircumstantial ina evidencetoajudge orjury readers throughthedifferentapproachesusedingatheringevidence and instruction onthe“howto”aspectsofcriminalfinancialinvestigations,taking of theseindividuals.Nowinitssecondedition,thisvolumeprovidesdirect collar crimeisoftenthekeytoapprehensionandsuccessfulprosecution Understanding thefinancialmotivationsbehindwhite- Colorado Technical University, SiouxFalls,SouthDakota,USA A.Pasco Gregory of Proof,SecondEdition Techniques andIndirectMethods The UseofForensicAccounting Criminal FinancialInvestigations Textbook Suggested Price: October 2013,6x9,168pp.,SoftCover eBook ISBN:978-1-4665-5404-7 Print ISBN:978-1-4665-5403-0 look intothefuture. the chapters can help business executives avoid problems from the past as they concisely andclearly, includingpracticalexamples.Theconceptsdiscussedin evaluate and influence their own futures. The text describes key concepts than tellingreadershowtoprepareforthefuture,itofferstools have failedtopreparedecision-makersfortoday’s economic problems.Rather predictivemodelsthat This bookoffersapracticalalternativetotheeveryday Chicago, Illinois,USA Independent HealthFuturistandMedicalEconomist, Jeffrey C.Bauer and PublicPolicy the StrategicChangeinBusiness Replace PredictingandHowtoMake Five ReasonsWhyForecastingMust $125.95 /£82.00 $109.95 /£69.99 $29.95 /£19.99
11 Business Management / Finance & Investing Dictionary of 21st Century Grid Parity Energy Technologies, Financing The Art of Financing Renewable and Sustainability Energy Projects in the U.S. Gene Beck, CEM, CLP Gene Beck, CEM, CLP Enviro-Tech Financial, Inc., Orange, California, USA Enviro-Tech Financial, Inc., Orange, California, USA
This comprehensive desktop reference addresses the Grid Parity provides an in-depth examination of the diverse terms and acronyms that form the backbone knowledge, insights, and techniques that are essential of 21st century energy technologies, applications of to success in financing renewable energy projects. those technologies, and the sustainability sector of the An energy project finance expert with 35 years of U.S. economy. The convergence of these disciplines has resulted in an explosion experience in capital asset financing, the author provides a comprehensive of specialized terms, acronyms, and jargon. The references encompass a wide overview of how to finance renewable energy projects in America today. range of legacy as well as emerging renewable energy technologies including He explores all components of “the deal” including tax, accounting, legal, regulatory, documentation, asset management and legislative drivers to this Finance & Investing the finance and sustainable segments of business that form an integral part of those technologies. dynamic growth sector. Filled with case studies, the book provides a thorough examination of what it takes to compete in the green-energy marketplace. Print ISBN: 978-1-4822-5304-7 June 2014, 8-1/2 x 11, 426 pp. Print ISBN: 978-1-4822-4170-9 Suggested Price: $149.95 / £95.00 May 2014, 8-1/2 x 11, 1000 pp. Suggested Price: $249.95 / £159.00
Finance Policy for Renewable Investment and Employment Energy and a Sustainable Opportunities in China Environment Jeffrey Yi-Lin Forrest Slippery Rock University, Pennsylvania, USA Michael Curley Johns Hopkins University, Baltimore, USA Tao Lixin Series: Systems Evaluation, Prediction, and Decision-Making This book explains how environmental projects and improvements are achieved through the imposition of This book is ideal for anyone investing in or seeking regulations, on the one hand, and financial incentives employment in mainland China. Based on recent on the other. It discusses how those incentives can be statistics from relevant Chinese bureaus, it introduces organized to achieve the greatest environmental benefits at the lowest possible new concepts and models, while providing recommendations for investment cost to the public. It presents the best environmental finance policies for the and employment. Examining recent statistics, the book reports on the current financing of alternative energy projects so that the ultimate cost of delivered state of regional economic, industrial, investment, and employment structures in power will decline. It also examines the challenges of the next generation of China. Although it provides suggestions on how to optimize economic structures environmental programs. in China, the theories presented are general and can be employed to investigate the investment and employment climate of other countries and regions. Print ISBN: 978-1-4398-9419-4 eBook ISBN: 978-1-4398-9421-7 Print ISBN: 978-1-4822-5207-1 March 2014, 6-1/8 x 9-1/4, 258 pp. November 2014, 7 x 10, 513 pp. 12 Suggested Price: $129.95 / £82.00 Suggested Price: $89.95 / £57.99
Textbook Money Laundering Financial Investigation A Guide for Criminal Investigators, and Forensic Accounting Third Edition Third Edition John Madinger Honolulu, Hawaii, USA George A. Manning, Ph.D, CFE, EA IRS Agent (Retired), Campbellton, Florida, USA This volume covers the basics of finding ill-gotten gains, linking them to an individual, and seizing them. Topics Presenting a complete examination of the current discussed include important changes in law since the methods and legal considerations involved in the second edition, new trends in crime and terrorism detection and prosecution of economic crimes, this book examines different financing, the rise of money laundering in connection with major frauds— types of offenses with a financial element. It explores offshore activities and including the Bernie Madoff case—and policy shifts related to terrorism and the means criminals use to hide their ill-gotten gains and provides a thorough financing since the Obama administration. The book also discusses new methods review of evidentiary rules as well as the protocol involved in search warrants. It for financial intelligence and the filing of Suspicious Activity Reports and explains examines two modalities used to prove financial crime and presents an example how changes in technology have enabled launderers to move funds more easily scenario based on real-life incidents. Additional topics include organized crime and anonymously. and money laundering, consumer and business fraud, computer crimes, and issues surrounding banking and finance. Print ISBN: 978-1-4398-6912-3 eBook ISBN: 978-1-4398-9824-6 Print ISBN: 978-1-4398-2566-2 December 2011, 8-1/2 x 11, 430 pp. eBook ISBN: 978-1-4398-8120-0 Suggested Price: $115.95 / £73.99 December 2010, 7 x 10, 792 pp. Suggested Price: $154.95 / £99.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,6-1/8x9-1/4,340 pp. Print ISBN:978-1-4822-2923-3 ways thatthiscanbeaccomplished. medical andadministrativerecordsto usefulinformationandtheinnovative and acrosstheirmedicalpractices.Theyalsoshowtherealityofmovingfrom on scalesthatareonlynowpossibleandusinginformationfromsystemswithin analytics showhowhealthcarepractitionersandorganizationsarelinking data analytics possible.Inthisbooksomeofthepioneersbigdataandhealth visualization arerequiredtomakebigdataandhealth including dataarchitecture, software,analytics,anddata A seriesofbusinessprocesseswithinhealthcare School ofMedicine,TheJohnsHopkinsUniversity Harold Lehmann UniversityCollege The GraduateSchool,UniversityofMaryland Katherine Marconi Edited by Big DataandHealthAnalytics Suggested Price: June 2013,7x10,377pp. eBook ISBN:978-1-4665-8184-5 Print ISBN:978-1-4665-8183-8 objectives asimprovedqualityoutcomesandaccesstocare. value onareviewofaspectspopulationhealthwithinthecontextsuch addressing the valuemetricsof ACOs. Itfocusesits discussion ofnon-monetary regulatory,healthcare industry: reimbursement,competition,andtechnologyin for change.Itexaminesthefourpillarsofvaluein foundational toassessingthecurrentefficacyandcapacity the valuemetricsandcapitalformationanalysesthatare of theACOmodelasbasisfordevelopment This bookexploresthehistoricalbackgroundandevolution Health CapitalConsultants,St.Louis,Missouri,USA Robert JamesCimasi Value MetricsandCapitalFormation Accountable CareOrganizations Suggested Price: November 2012,7x10,624pp. eBook ISBN:978-1-4398-9819-2 Print ISBN:978-1-4398-9818-5 alternativetoDowTheory.portfolio, and asimplermorepowerful charts, includingmodifiableonlineexpandedmaterialonpragmatic capital, andriskmanagement.Thiseditionoffersmoreillustrativepatterns recognition tools,balancinganddiversifyingastockportfolio,applicationof advances ininvestmenttechnology. It coversstockselection,charting,trend formations, trendsandchannels,technicalanalysisofcommoditycharts, decisions. Itpresentsreversalpatterns, consolidation analysis enablinginvestorstomakesmarttrading This bookprovideslong-andshort-termstocktrend and W.H.C. Bassetti Robert D.Edwards,JohnMagee, Tenth Edition of StockTrends Technical Analysis $79.95 /£49.99 $94.95 /£59.99 $109.95 /£69.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
in Healthcare Emerging Technologies Suggested Price: November 2014,6x9,348pp. Print ISBN:978-1-77188-091-6 of theproblemlist. problem lists,strategiestoimprovethelist,andapplicationsinpractice and importanceoftheelectronichealthrecord,attitudestowarduse the traditionaldata-orientedapproach.Itis comprehensive,coveringhistory problems, presenting a more effectiveproblem-orientedapproach rather than organization ofpatientmedicalrecordsaround timely bookpresentsavarietyofperspectivesonthe has extensiveexperienceinthisfield,importantand MedicalSchoolwho Edited byaprofessoratHarvard MedicalSchool,Boston,Massachusetts,USA Harvard Adam Wright Edited by Electronic HealthRecord Clinical ProblemListsinthe Suggested Price: May 2013,6-1/8x9-1/4,464pp. eBook ISBN:978-1-4665-8259-0 Print ISBN:978-1-4665-8258-3 required toresolvedayissuesencountered inthepharmacy. of thepharmacyenvironmentand authorusescasestudiestoillustrateskills issues attheworkplace.Topics havebeenchosentoincludeskillsinallsectors The bookpresentsawealthofinformationandmanagementskillsforresolving improved managementrolesinhospital-basedpharmaciesandretailoperations. accomplish the goals of patient-focused healthcare and competitive pharmacyenvironment,enablingthemto managers successfullymanagethechallengesof This bookhelpspharmacistsandnon-pharmacist UK Harwell, Titus DeSilva Managers for PharmacyandBusiness Essential ManagementSkills Suggested Price: April 2015,7x10,104pp. Print ISBN:978-1-4822-6262-9 telemedicine, telehealth,andtelecare. mhealth forself-careandremotecare,describesthedifferencesbetween delivered throughsmartphonesandsocialmedia.Thisbookoutlinestheroleof through theuseofemergingmobilehealth(mhealth)technologiesthatcanbe improving theirownhealth.Onewayofdoingthisis patients totakeaccountabilityformaintainingand healthcare providersarefocusingonwaystoengage by thePatientProtectionandAffordableCareAct, With mandated thechangesinhealthcaredelivery Global Targeting Inc.,Ogden,Utah,USA Suzanne MossRichins $149.95 /£95.00 $62.95 /£39.99 $49.95 /£31.99
13 Finance & Investing / Health Administration & Policy EU Annex 11 Guide to Impact of Healthcare Informatics Computer Validation on Quality of Patient Care and Compliance for the Worldwide Health Services Health Agency GMP Divya Srinivasan Sridhar HIMSS, Public Policy and Research Intern, Doctorate Orlando Lopez Candidate, George Mason University, Arlington, USA WW IT Manager, Risk & Compliance, Smith & Nephew Taking an integrated approach, this book provides a This book provides practical information to enable comparative perspective of how different organizations compliance with computer system validation adapt and use healthcare informatics. The first part of the requirements, while highlighting and integrating the Annex 11 guidelines into Health Administration & Policy book covers the basics of HIT. The second part focuses on the broader community: the computer validation program. The ideas presented in the book are based the the patient, the physician, government, and how HIT will impact each. The book author’s experience in the US Department of Defense and regulated industries in includes a discussion about mobile health and how a rapidly growing mobile various computer systems development, maintenance, and quality functions. A health generation is changing the face of healthcare as we know it. practical approach is presented to increase efficiency and to ensure that software development and maintenance is achieved correctly. Print ISBN: 978-1-4665-0487-5 eBook ISBN: 978-1-4665-0488-2 Print ISBN: 978-1-4822-4362-8 February 2013, 7 x 10, 162 pp., Soft Cover March 2015, 7 x 10, 280 pp. Suggested Price: $62.95 / £39.99 Suggested Price: $199.95 / £127.00
Handbook of Concierge Leadership and Management Medical Practice Design in Pharmacy Practice Maria K. Todd Second Edition Mercury Healthcare International, Inc., Denver, Colorado, USA Edited by This book discusses the many considerations a physician Andrew M. Peterson must make prior to transitioning their practice into Mayes College of Healthcare Business & Policy, concierge service. This book includes chapters on business Philadelphia, Pennsylvania, USA process re-engineering and workflow management, William N. Kelly financial considerations, competitive analysis, how to William N. Kelly Consulting Inc., Oldsmar, Florida, USA develop a business plan and strategy, how to market the new practice. The Pharmacy Education Series author includes patient acquisition and retention strategies as well as adding additional doctors and physician extenders such as nurse practitioners and This book introduces students to leadership and management principles and physician assistants. Appendices include sample employment contracts and how practices commonly used in pharmacy practice. It examines the foundations of to select and work with consultants. leadership, the management challenges leaders and practitioners face, and provides practical examples on how to solve some of the problems. This second edition takes Print ISBN: 978-1-4665-6818-1 a stronger approach to leadership, making it part and parcel to each and every topic December 2014, 7 x 10, 168 pp. discussed throughout the text. Further, the organization and design of the text will Suggested Price: $59.95 / £38.99 follow a learner-centered approach using more examples, and focusing on problem 14 solving and critical thinking versus just conveying of information. Print ISBN: 978-1-4665-8962-9 December 2014, 6-1/8 x 9-1/4, 352 pp. Suggested Price: $99.95 / £63.99 Healthcare Informatics Textbook Improving Efficiency and Productivity Medical Informatics Edited by An Introduction to Information Stephan P. Kudyba Systems and Software in New Jersey Institute of Technology, Newark, USA Medicine and Health Incorporating information technologies and information David J. Lubliner management, this work describes evolving areas of New Jersey Institute of Technology, Newark, USA efficiency in the healthcare industry due to healthcare informatics enhancements. The book begins with an This complete medical informatics textbook begins by overview of the shift into new healthcare system structures through the utilization reviewing the IT aspects of informatics, including systems architecture, electronic of information technology/systems and the creation of software platforms. It health records, interoperability, security and privacy, the cloud, mobile health then discusses innovative information systems and their functionality, business care, imaging, capturing data, design issues. Next, it provides case studies that intelligence in healthcare, and the use of advanced analytics and information illustrate the roll out of EHRs in hospitals. The third section incorporates four management. The book also examines evolving trends in healthcare, including anatomy and physiology lectures that focus on the physiological basis behind potential gains through data and information management. data captured in EHR medical records. Examples include detailed descriptions of the heart and electrical systems, lungs and alveoli, and oxygen exchange. Print ISBN: 978-1-4398-0978-5 eBook ISBN: 978-1-4398-0979-2 Print ISBN: 978-1-4665-9620-7 April 2010, 6-1/8 x 9-1/4, 279 pp. June 2015, 7 x 10, 608 pp. Suggested Price: $83.95 / £53.99 Suggested Price: $99.95 / £63.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2013,7x10,255pp. eBook ISBN:978-1-4822-0399-8 Print ISBN:978-1-4822-0397-4 that willoptimizethecareprovided. practice opportunities,andidentifyviable strategiesforadaptingtothechanges authors addressthemacro-problems, and micro-problemswhichwillhelpassess terminology, thefacts,andtypesofchangesthatarecurrentlyunderway. The key trendsthatarereformingoursystem.Thebookhelpsreadersunderstand the healthcare system’s access, cost,andqualityproblemsaswellidentifyingsix of thesefacts,andsummarizestheresultsempiricalstudiesregarding our economic conceptsneededtoexaminetheimplications This bookprovideskeyeconomicfacts,explainsthe and Teresa D.Serratt,PHD,RN Jeanne Wendel, PHD,William O’Donohue,PHD, an EvolvingHealthcareSystem Managing Your Careerin Economics Understanding Healthcare Suggested Price: August 2015,6-1/8x9-1/4,200pp. Print ISBN:978-1-4987-0462-5 reduce cost,increasequality, andimprovepatientsatisfaction. an avenuetocoordinatedeffortsbyhospitaladministrationandphysicians Clinical co-management programs from an insider’s perspective, and will provide implementation andoversight.Thisbookalsoexploresworkingmodelsfor experts haveareferencetoutilizepriorandduringCCMAnegotiations, that physicians, hospital executives, healthcare attorneys, and other industry This bookdissectsthisframeworkwhileprovidingadetailed,insiderviewso Murer Consultants,Inc.,Joliet,Illinois,USA Cherilyn G.Murer Structure Centralized, Co-Management Implementing aCompliant, A GuidetoDesigningand Workbook The ClinicalCo-Management Suggested Price: October 2014,6-1/8x9-1/4,246pp. Print ISBN:978-1-4665-9296-4 transitions thatwillresult. various typesofrelationshipsthatareformingaswellthenutsandbolts perspective. It supplies readers with an understanding of the basics behind the the changesoccurringinanonjudgmentalfashionandfrombusinesscase consultant inthehealthcareindustry, thebookaddresses systems purchase physicianpractices.Written byaleading issues thatmustbeaddressedwhenhospitalsandhealth Transformation examinestheculturalandfunctional Medical Staff Integration: Transactions and The LaPennaGroup,GrandRapids,Michigan,USA A. MichaelLaPenna Transactions andTransformation Medical StaffIntegration $79.95 /£49.99 $49.95 /£31.99 $69.95 /£44.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
and Advisors Planning StrategiesforDoctors Comprehensive Financial Suggested Price: May 2015,6-1/8x9-1/4,320pp. Print ISBN:978-1-4822-2397-2 benefits ofupgradingtheirHR. to retoolinordermodernizetheirsystem.Readerswillalsolearnaboutthe modelandtheywilldiscoverwhichHRprocessesneed 21st century Readers willbeabletocomparetheircurrentHRsystemtheauthors’proposed information regardingHRprotocols,ITrelatedissuesandworkplaceculture. issues relatedtohiringandcompensationprovidesreaderswithdetailed empirical methods.Thebookfocusesonsystemic their HRsystemsthroughtheuseofAI,ITandother key stakeholdershowtouseITprocessesmodernize This book is designed to teach managers and other Healthcare Consultant,Roanoke,Virginia, USA Anthony MatthewHopper Healthcare Techniques toModernize Using DataManagement Suggested Price: September 2013,7x10,358pp. eBook ISBN:978-1-4665-5874-8 Print ISBN:978-1-4665-5873-1 programs inadditiondiscussinghospital revenueenhancements. information systems.Italsodiscusses thefinancialfutureofmentalhealth features ofelectronicmedicalrecords, financial,andclinicalfeaturesofhospital well ascharts,tables,anddiagrams. The bookcoverstopicssuchasfinancial perspectives withreal-worldcasestudies,models,checklists,andreports as policiesand integrates prose,managerialapplications,andregulatory Drawing oncasestudiesfromhealthcarefinancialmanagement,this book Institute ofMedicalBusinessAdvisors,Norcross, Georgia,USA David EdwardMarcinko and HopeRachelHetico Edited by and CaseStudies Tools, Techniques, Checklists Healthcare Organizations Strategies forHospitalsand Financial Management Suggested Price: December 2014,7x10,741pp. Print ISBN:978-1-4822-4028-3 an accessiblestylegearedtowardphysiciansandhealthcareprofessionals. principles. Providing a step-by-stepprocess for financial success,the book uses real-world casemodelsresultinginaplethoraofintegratedfinancialplanning economic topicsfordoctorsandotherhealthcareproviders,thebookincludes their financial advisors.A“how-to”book onpersonalfinance andrelatedmicro- book shapesthefinancialplanninglandscapefordoctors,healthprofessionalsand revenues, increasingcosts,stringentSECscrutiny, andhigherexpectations.This Today, many physicians and healthcare providers struggle with decreasing Institute ofMedicalBusinessAdvisors,Norcross, Georgia,USA David EdwardMarcinko andHopeRachelHetico Edited by and CertifiedMedicalPlanners™ Best PracticesfromLeadingConsultants $89.95 /£57.99 $71.95 /£45.99 $99.95 /£63.99
15 Health Administration & Policy / Healthcare Financial Management The Practical Guide to HIPAA A Leadership Journey Healthcare Financial Mgmt. / Process Improvement Privacy and Security Compliance in Health Care Second Edition Virginia Mason’s Story Rebecca Herold Charles Kenney Rebecca Herold, LLC, Van Meter, Iowa, USA Virginia Mason Medical Center, Seattle Washington, USA
Kevin Beaver Many people visit Seattle to learn the methods of the Principle Logic, Acworth, Georgia, USA Virginia Mason Production System. When health care Following in the footsteps of its bestselling predecessor, professionals travel to Seattle in search of knowledge, this book is a one-stop, up-to-date resource on Health Insurance Portability and they invariably ask Virginia Mason teams: How did you do this? How have you Accountability Act (HIPAA) privacy and security, along with the HITECH Act and progressed so far on quality, safety, access, efficiency, finances, and affordability? the 2013 Omnibus Rule requirements. Updated and revised with several new This book is an effort to answer those questions. Focusing on the immense sections, this edition defines what HIPAA is, what it requires, and what you need importance of governance in the Virginia Mason story as well as a new initiative to do to achieve compliance. It provides an easy-to-understand overview of concerning respect for people, this book presents key lessons in improvement HIPAA privacy and security rules and compliance tasks. Supplying authoritative from the world leader in applying Lean methods and tools in health care. insights into real-world HIPAA privacy and security issues, it summarizes the Print ISBN: 978-1-4822-9968-7 analysis, training, and technology needed to properly plan and implement February 2015, 6-1/8 x 9-1/4, 144 pp. privacy and security policies. Suggested Price: $39.95 / £25.99 Print ISBN: 978-1-4398-5558-4 October 2014, 6-1/8 x 9-1/4, 544 pp. Suggested Price: $79.95 / £57.99
Revenue Cycle Management A3 Problem Solving in Healthcare for Healthcare Claudia Birkenshaw Garabelli A Practical Method Modern Management Muse, Inc., Flint, Michigan, USA for Eliminating Waste Written to assist healthcare leaders and managers Cindy Jimmerson become more effective decision makers, problem Lean Healthcare West, Missoula, Montana, USA solvers, and communicators within the revenue cycle and financial management areas of their organization, Written by an expert in Lean principles, this book this book introduces the core components and offers an easy-to-use problem-solving method that can concepts of the revenue cycle. It discusses the functions and responsibilities be applied to every aspect of healthcare to identify, understand, and improve in the patient financial services (PFS) area; revenue stream techniques from a processes. Illustrated with numerous A3s in various stages of development, this clinical perspective, contract management and finance, information systems and practical, easy-to-use workbook explains how to extend the VSM philosophy to the revenue cycle, plus the nuts and bolts of the chargemaster and compliance. a more focused perspective. Exploring the value of the A3 problem-solving tool Chapters include tables, charts, figures, and example scenarios that illustrate key in healthcare, it demonstrates the simplicity and completeness of the A3 tool concepts. and its applications to regulatory documentation and the activities of daily work. Print ISBN: 978-1-4398-5366-5 Print ISBN: 978-1-56327-358-2 May 2015, 7 x 10, 275 pp., Soft Cover June 2007, 8-1/2 x 11, 176 pp., Soft Cover 16 Suggested Price: $69.95 / £44.99 Suggested Price: $71.95 / £45.99
5S for Healthcare Accelerating Health Care Thomas L. Jackson Transformation with Rona Consulting Group, Mercer Island, Washington, USA Lean Tools for Healthcare Series Lean and Innovation The Virginia Mason Experience Based on Hiroyuki Hirano’s classic 5 Pillars of the Visual Workplace and modeled after the Shingo Prize-winning Paul E. Plsek Shopfloor Series for Lean Manufacturers, this work adopts a This insider’s account of describes how Virginia Mason proven reader-friendly format to impart all the information Medical Center has systematically integrated innovative needed to understand and efficiently implement lean structures, methods, and cultural practices into its methodology in a healthcare setting. Written by the principals involved with implementation of Lean. Describing how an organization can create a strategy the Rona Consulting Group, who were responsible for the groundbreaking and build a culture of innovation and learning, it supplies concrete examples implementation of the Toyota Production System at the Virginia Mason Medical that show how Lean and innovation can work hand-in-hand to improve Center, it provides a wealth of transferable examples along with a step-by- and transform value streams. The book also explains how to use the voices and step hands-on guide that will demonstrate how to get an entire organization experiences of patients and their families to drive improvement and innovation. positively involved in the process. Print ISBN: 978-1-4822-0383-7 Print ISBN: 978-1-4398-0350-9 eBook ISBN: 978-1-4822-0384-4 eBook ISBN: 978-1-4398-0351-6 October 2013, 6-1/8 x 9-1/4, 216 pp. December 2009, 7 x 10, 120 pp., Soft Cover Suggested Price: $39.95 / £25.99 Suggested Price: $35.95 / £17.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: May 2011,6x9,183pp.,SoftCover eBook ISBN:978-1-4398-6318-3 Print ISBN:978-1-56327-376-6 levels. distinct maps for the same work at the organization, process, and job/performer improvement effort.Itexplainshowtoemploythethreelevelsframeworkdraw processes, this neweditionexplainshowtouseprocessmappinginitiateany new chaptersandtoolsto identifyisolate and theUnitedNations’headquarters.Updatedwith universities, in-housecorporateimprovementapproaches, thinking incorporated intothecurriculumatforward The firsteditionofthisbestselling resource hasbeen President, TheBottomLineGroup,Dallas,Texas, USA Robert Damelio 2nd Edition The BasicsofProcessMapping Suggested Price: September 2013,6x9,310pp. eBook ISBN:978-1-4665-6538-8 Print ISBN:978-1-4665-6537-1 leadership, andqualityimprovement. of seniorleadersfromdiversefieldsincludingphysicianleadership,nursing improvement atBHCS,thisShingoPrizewinningbookpresents thecontributions efficient, equitableandpatient-centered(STEEEP). ofquality Telling thestory that supports theInstituteofMedicine’s callfor carethatissafe,timely, effective, formalized itscommitmenttoqualitywiththeadoptionofSTEEEPframework is anexcellentcasestudyonqualityimprovement.Inrecentyears,BHCShas populations, the Baylor Health CareSystem (BHCS) urban,rural,andsuburban As asystemthathasserved and President,STEEEPGlobalInstitute Chief QualityOfficer, BaylorScott&WhiteHealth David J.Ballard,MD,PhD,MSPH,FACP Edited by Improvement Journey Baylor HealthCareSystem’s Quality Achieving STEEEPHealthCare Suggested Price: June 2013,6-1/8x9-1/4,137pp. eBook ISBN:978-1-4665-8313-9 Print ISBN:978-1-4665-8308-5 applied acrossawiderangeofindustries. cultural transformation,the book presentsvaluable lessons learnedthat can be satisfaction. Demonstrating how Community General was able to achieve its andcustomer struggling tobeingnationallyrecognizedforitsperformance the journeyofCommunityGeneral,ahealthcareorganizationthatwentfrom experience transformation.Usinganengagingstory, itallowsreaderstofollow clearly outlinestheprinciplesanddevelopmentphasesofagreatcustomer customer andpatientexperiencemovement,thisbook Written byinternationallyacknowledgedexpertsinthe D.Erickson Kalina Janevska,andGregory Rhonda Dishongh,QaalfaDibeehi, Transformation inaHospital Lessons FromaSuccessfulCultural Customer) ExperienceExcellence Achieving Patient(aka $22.95 /£14.99 $39.95 /£25.99 $41.95 /£26.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Operational Improvement Emergency Department The DefinitiveGuideto Suggested Price: June 2015,7x10,120pp.,SoftCover Print ISBN:978-1-4665-5194-7 examples, andhow-to-steps. the use of margin assists, thebook highlights friendly bookwillhelptoimprovereaders’understandingofthistool.Through tocustomers. PartoftheLeanToolsfor delivery series,thisuser- inHealthcare process createsasmoothflowthatshortens leadtimes and equipmentintoanefficient,process-basedcell,this eliminating wastefromaprocess.Byarrangingpeople aspect ofLeanproduction thatcanboostefficienciesby Continuous flow(orcellularmanufacturing)isan Rona ConsultingGroup,Mercer Island,Washington, USA Thomas L.Jackson for Healthcare Continuous Flow Suggested Price: 2015,6-1/8 x9-1/4,288pp.,SoftCover February Print ISBN:978-1-4987-0132-7 improving thepracticeofmedicinethrough greaterefficiencyandeffectiveness. trends forthefuture.Thebookexamines thepossibilitiesofdirectpayfor became importantinachallenginghealthreformenvironmentandsuggests studies, aperspectiveonwhyandhowthesubjectoriginated, why withphysiciansandcase The authorincludesinterviews hybrid models. andfeeforservice non-covered services, orfeefor including: feeforcare;extraservice create businessmodelsusingdifferentfeestructures what itis,howpracticesviewandhavebeenableto This booksreviewsdirectpaybusinessmodels,clarifies Divya SrinivasanSridhar A SimplerWay toPracticeMedicine Direct Pay Suggested Price: April 2011,7x10,353pp.,SoftCover eBook ISBN:978-1-4398-0841-2 Print ISBN:978-1-4398-0840-5 illustrates the applicationofLeantoolsandconceptsinEDsacrosscountry. to moreefficient,cost-effective,andpatientfriendlydepartments.Thebook this step-by-stepguideshowshowtheapplication of Leanprinciplescanlead Offeringasolutiontothisfiscalandmedicalmadness, or hospitalareserved. have becomecauldronsofresentmentwhereneitherthebestneedspatient With somanyhavingnowhereelsetoturnfor care,emergencydepartments(ED) Knoxville, USA Professor ofManagementScience,CollegeBusiness,UniversityTennessee, Chuck Noon,PHD Fredericksburg, Virginia, USA WashingtonEmergency Physician,Mary Hospital, Jody Crane,MD,MBA the “NoWait” Department Current EDBestPracticestoCreate Employing LeanPrincipleswith $29.95 /£19.99 $49.95 /£31.99 $99.95 /£63.99
key terms and points, healthcare
17 Healthcare Process Improvement Engineering Patient Safety Expanding the Capacity in Radiation Oncology to Care University of North Carolina’s Pursuit Pierce Story, MPHM Concept Development Capacity Strategies, Inc., for High Reliability and Value Creation Atlanta, Georgia, USA Lawrence Marks, Lukasz Mazur, Bhishamjit Chera, Our nation’s capacity to care is destined to become and Robert Adams increasingly constrained as an aging and increasingly The grand challenge for radiation oncology centers is unhealthy population must contend with a reduction to develop highly reliable systems and deliver value to in medical professionals and increasingly tight Healthcare Process Improvement every patient. This book is about the pathway of getting there. In a world of financial resources. We need a significant overhaul and rethinking of our entire limited time and resources, any waste within the system serves as a distraction healthcare system such that we simultaneously impact capacity, cost, quality, and as a hindrance to reliability and quality. The book describes proven concepts and accessibility. This book is a comprehensive guide to a new way to properly and examples that are borrowed from high reliability and value creation manage total community-wide care capacity. Though clear examples and actual organizations to guide radiation oncology centers towards achieving their project results, the book demonstrates the outcomes of driving otherwise siloed patient safety and quality goals. performance improvement efforts towards a systems-level way of thinking. Print ISBN: 978-1-4822-3364-3 Print ISBN: 978-1-4665-9396-1 March 2015, 6-1/8 x 9-1/4, 328 pp. June 2015, 6-1/8 x 9-1/4, 224 pp. Suggested Price: $49.95 / £31.99 Suggested Price: $59.95 / £38.99
Getting to Standard Work in Health Care Engineering Solutions to America’s Healthcare Challenges Using TWI to Create a Foundation for Quality Care Ryan Burge The Boulevard Consulting Group LLC., Alexandria, Virginia, USA Patrick Graupp TWI Institute, Liverpool, New York, USA Engineering Solutions to America’s Healthcare Martha Purrier Challenges covers the technologies, systems, and Virginia Mason Medical Center, Seattle, Washington, USA processes that are emerging in hospitals, clinics, community centers, universities, and the White House to Addressing the challenges involved with achieving standard work in health care, repair healthcare in the United States. Focusing on the this book describes the Training Within Industry (TWI) Job Instruction method. importance of individuals being proactive about their own state of health, it This tool has been used by Toyota and other Japanese companies in creating presents a systems approach to changing the way healthcare professionals do a strong foundation for standardization in their production practice. The text business and take care of their patients. It presents proven Lean and Six Sigma places this methodology squarely within the health care paradigm. Using tools that can help any healthcare organization begin making operational examples, case studies, and terminology that all health care practitioners can improvements that result in a better quality of care for patients. understand, the authors show how this method can make all the difference in the delivery of quality health care while serving as a foundation for successful Lean Print ISBN: 978-1-4665-8355-9 practice in health care. eBook ISBN: 978-1-4665-8356-6 December 2013, 6-1/8 x 9-1/4, 181 pp. Print ISBN: 978-1-4398-7850-7 18 Suggested Price: $62.95 / £39.99 eBook ISBN: 978-1-4398-7851-4 August 2012, 7 x 10, 223 pp., Soft Cover Suggested Price: $65.95 / £41.99
The Executive Guide to The Guide to Achieving Healthcare Kaizen STEEEP™ Health Care Leadership for a Continuously Learning Baylor Scott & White Health’s Quality and Improving Organization Improvement Journey Mark Graban David J. Ballard, MD, PhD. Chief Improvement Officer, KaiNexus, San Antonio, Texas, USA Baylor Health Care System (BHCS) has formalized its Joseph E. Swartz commitment to quality with the adoption of the STEEEP Director of Business Transformation, Franciscan St. Francis Health, Indianapolis, Indiana, USA framework supporting the Institute of Medicine’s call for health care that is safe, timely, effective, efficient, equitable, and patient centered. Delivering an accessible introduction to Kaizen principles, this volume is for This workbook is a companion to BHCS’s recent book Achieving STEEEP Health hospital and medical organization leaders who want to engage every employee Care. It presents practical approaches and tools, including sample workflows, and physician in ongoing daily continuous improvement benefitting patients, forms, charters, and checklists, that health care delivery organizations can use staff, and the long-term good of the organization. Specifically written for senior to organize, lead, execute, and measure the impact of their own improvement leaders and managers who need to understand the power of this core Lean efforts. methodology, the book explains the practical actions that are required to create a lasting Kaizen culture in a healthcare system. Print ISBN: 978-1-4822-3681-1 December 2014, 7 x 10, 160 pp., Soft Cover Print ISBN: 978-1-4665-8641-3 Suggested Price: $59.95 / £38.99 eBook ISBN: 978-1-4665-8643-7 August 2013, 6-1/8 x 9-1/4, 200 pp., Soft Cover Suggested Price: $29.95 / £19.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2005,7x10,816pp. eBook ISBN:978-1-4200-2546-0 Print ISBN:978-1-57444-306-6 changes. Commission requirements,andregulatory organizational culture,behavioralsafety, root causeanalysis,newOSHAandJoint improvement,riskmanagement, information onleadership,performance that canbereadilyputtouse.Updates tothesecondeditionincludeadditional digested information,theauthorhasconstructedpracticalchecklistsandforms improvement, andriskmanagementpositions.Inadditiontoprovidingeasily insafety,serving occupationalhealth,hazardmaterialsmanagement, quality presents expansive coverage for healthcare professionals Hazard Control andSafety Management, Second Edition Surpassing thestandardsetbyfirstedition,Healthcare Helena, Alabama,USA International BoardforCertificationofSafetyManagers, James T. Tweedy Second Edition and SafetyManagement Healthcare HazardControl Suggested Price: October 2015,6-1/8x9-1/4,248pp. Print ISBN:978-1-4822-9917-5 process improvement. patient safety, clinical process improvement, patient engagementand workflow for thereadertoapplyanduseinreallifeproblemsprocessesimprove to improvecarewhiledecreasingcosts.Shealsoincludespracticalapplications discussion aboutthesources andusesofdataneeded them intoday’s environment.Theauthorprovidesa applications andthetheoriesbehindhowtoapply This bookintroducesdataanalyticswithhow-to Global Targeting Inc.,Ogden,Utah,USA Suzanne MossRichins Data AnalyticsinTransforming Care An IntroductiontotheRoleof Healthcare Analytics Suggested Price: 2014,6-1/8x9-1/4,292pp.,SoftCover January eBook ISBN:978-1-4822-1475-8 Print ISBN:978-1-4822-1474-1 problems. book outlinesinnovativepublicpolicysolutionstoawiderangeofcommunity between populationsthatsufferfromhighlevelsofpublichealthconcerns,the be utilizedbythegovernment,providers,andindividualstobridgegap lack ofhealthcarefortheeconomicallydisadvantaged.DescribinghowHITcan problems ofchronicdiseaseintheU.S.,societalwelfare,childhoodobesity, and (HIT) intheUnitedStates.Itinvestigatesconverging the currentstateofHealthInformationTechnology electronic medical records (EMRs), this book illustrates Discussing electronichealth,healthinformatics,and Divya SrinivasanSridhar Health Policies Prevention inPublic Health ITasaTool for $172.95 /£110.00 $59.95 /£38.99 $59.95 /£38.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Suggested Price: June 2012,8-1/2x11,408pp.,SoftCover eBook ISBN:978-1-4665-6797-9 Print ISBN:978-1-4398-7296-3 management system. but nowwantto movebeyondjustdoingeventsintoamorecompleteLean to healthcareorganizationsthathaveembracedweeklongimprovementevents, with manycolorpicturesand illustrationsofKaizens.Thisbookwillbehelpful shared byFranciscanAllianceHealthSystemandotherleadingorganizations, an organization-wide program. All of the examples are real healthcare examples and philosophiesrequiredtomakeKaizenworkeffectivelyinadepartmentoras for facilitatingKaizen,butmoreimportantlycoversthemanagementmindsets Kaizen, forhealthcareprofessionalsandorganizations.Itsharessomemechanics This Shingo Prize-winningbookfocusesondailycontinuousimprovement,or Francis Health,Indianapolis,Indiana,USA Director ofBusinessTransformation, FranciscanSt. Joseph E.Swartz Chief ImprovementOfficer, KaiNexus,SanAntonio, Texas, USA Mark Graban Improvements Sustainable Continuous Engaging Front-LineStaffin Healthcare Kaizen Suggested Price: 2015,6-1/8 x9-1/4,408pp. February Print ISBN:978-1-4822-5209-5 their implicationstotheworld. management,productionanddelivery,innovations inhealthservice anddiscuss contributions ofpractitionersandacademics todescribeandanalyzeemerging care--have attractedglobalattention.Thisbookbringstogetherexperiences and healthcare--particularly low-cost, high-volume solutions that improve access to in needofarevolutionorganizationandmanagement.InnovationsIndian Although newtechnologies,devices,andmethodsarepromising,healthcare is Paul Lillrank Simpler Consulting,Gurgaon,India Vijai KumarSingh Edited by and SustainableSolutions Cost-Effective Management Innovations inHealthcare Suggested Price: May 2015,7x10,275pp.,SoftCover Print ISBN:978-1-4822-2514-3 implemented, accepted,andsustained. and project management principles to ensure that the resulting work is and new technologies. The approach is well groundedin organization change initiatives, redesigncaremanagement,andimplementcentralizedscheduling lineprocesses,prepareforpopulationhealth organizations createnewservice Sigma. Theprovenapproachpresentedinthebookhasalreadyhelpedmany methods andtools,includingPDSA,Lean,Six or parallel other process and continuousimprovement effective, methods and tools described may precede processes in the healthcare industry. The simple, yet to redesigning existing processes and creatingnew This bookprovidesateam-based,practicalapproach Jean AnnLarson Methods andApproaches Healthcare ProcessRedesign $65.95 /£41.99 $59.95 /£38.99 $59.95 /£38.99
19 Healthcare Process Improvement Just-in-Time for Healthcare Leading the Lean Healthcare Thomas L. Jackson Journey Rona Consulting Group, Mercer Island, Washington, USA Lean Tools for Healthcare Series Driving Culture Change to Increase Value Joan Wellman, Howard Jeffries, and Pat Hagan Part of the Lean Tools for Healthcare series, this user- friendly book is designed to improve understanding of Blending case studies with theory, this book describes just-in-time, a system for producing and delivering the how the healthcare value proposition can be changed by right items to the right place at the right time in the reducing waste, variation, and complexity in healthcare. right amounts. This text discusses why JIT is important It reveals the leadership tenacity and culture change
Healthcare Process Improvement for healthcare by explaining how it establishes a system of supplying service required to remove waste from healthcare processes and eliminate the root to the customer, patient, or healthcare provider at precisely the right time, in cause of soaring costs, poor quality and safety, and limited access. It provides the correct amounts and without errors. Presented in practical terms, this book, practical, applicable advice alongside personal and organizational stories and through the use of margin assists, contains key terms and points, healthcare case studies told by physician and administrative leaders, all students of the examples and how-to steps. Toyota Production System. Print ISBN: 978-1-4398-3745-0 Print ISBN: 978-1-4398-2865-6 June 2015, 7 x 10, 120 pp., Soft Cover eBook ISBN: 978-1-4398-2866-3 Suggested Price: $28.95 / £18.99 December 2010, 6-1/8 x 9-1/4, 292 pp., Soft Cover Suggested Price: $68.95 / £43.99
Kaizen Workshops for Lean Design Handbook for Lean Healthcare Healthcare Facilities Edited by Michael Hogan Thomas L. Jackson Managing Member, Progressive Business Solutions, LLC, Plainfield, Illinois, USA Rona Consulting Group, Mercer Island, Washington, USA Series: Lean Tools for Healthcare Series John K. Laur Dekker/Perich/Sabatini, Albuquerque, New Mexico, USA Part of the Lean Tools for Healthcare series, this book describes exactly what a kaizen event is and details Healthcare organizations are realizing the need not all the phases necessary for implementing continuous only for Lean improvements but also for getting the improvement practices in your healthcare organization. It walks readers through best design possible to enhance what Lean can give them. This book describes the steps of conducting an effective kaizen workshop-one that is well planned, a method to assist hospitals and healthcare facilities in designing their buildings well implemented, and well monitored. The information is presented in an easy- and spaces with higher efficiencies and better staff and patient flows. Teaching to-assimilate format. Numerous illustrations reinforce the text and margin assists leadership engagement in the design process and beyond, the book identifies call your attention to key terms, healthcare examples, and how-to steps. ways to achieve commitment for durable and sustainable change as well as the continuous improvement required for more efficient design. Print ISBN: 978-1-4398-4152-5 eBook ISBN: 978-1-4398-4155-6 Print ISBN: 978-1-4822-1546-5 August 2012, 7 x 10, 120 pp., Soft Cover May 2015, 7 x 10, 300 pp. 20 Suggested Price: $31.95 / £19.99 Suggested Price: $69.95 / £44.99
Leading Healthcare The Lean Healthcare Dictionary Transformation An Illustrated Guide to Using the A Primer for Clinical Leaders Language of Lean Management Maulik Joshi in Healthcare Health Research & Educational Trust, Chicago, Illinois, USA Rona Consulting Group Rishi Sikka In today’s economy, with reduced reimbursement and Advocate Health Care, Downers Grove, Illinois, USA higher scrutiny on quality patient care, those in traditional A succinct and practical primer on health care management engineering roles are required to change transformation, this book is a key resource for any clinician who finds themselves from manufacturing positions to roles as process improvement specialists. Nurses in a leadership position at any point in the organization hierarchy. Topics include are participating in Lean training and coming out thinking the consultants don’t a discussion on various quality improvement processes including Lean and Six understand their work. This book combines Lean terminology and healthcare Sigma; specific strategies and tools to both sustain and spread improvement; terms. Each entry provides a complete description of a Lean term and provides how to build a culture of safety; principles and practices for creating a high an example of its use in healthcare. Conversely, healthcare terms are related back reliability organization; how to leverage health information technology for clinical to its use within a Lean environment. It’s a dual-faceted book which explains Lean improvement; and how to improve care coordination to reduce readmissions. and healthcare terminology. Print ISBN: 978-1-4987-0018-4 Print ISBN: 978-1-4822-3289-9 July 2015, 6-1/8 x 9-1/4, 175 pp. November 2014, 6 x 9, 117 pp., Soft Cover Suggested Price: $49.95 / £31.99 Suggested Price: $39.95 / £25.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2014,6-1/8x9-1/4,183pp. Print ISBN:978-1-4822-4638-4 implementation. Itincludeshelpfulexercises andexamplesofLean applications. the Leanphilosophyandtools,book outlinesadetailedapproachtoLean centers, callcentersandparamedics.Providinganaccessibleexplanation of system thatincludesnotonlyahospitalbutalsoHMO,communityhealth complete how-tobookonimplementingaLeantransformationinhealthcare and scientistwhowastheCEOofalargeintegratedsystemfor20years.It isa This book is written by a seasoned physician, teacher, Denver Health,Colorado,USA Director (Retired),LeanSystemsImprovementDepartment, Philip L.Goodman University ofColorado,SchoolMedicine,Denver, USA Patricia A.Gabow Healthcare System MedicineforOurAiling Powerful The LeanPrescription Suggested Price: April 2013,6x9,254pp.,SoftCover eBook ISBN:978-1-4665-1555-0 Print ISBN:978-1-4665-1554-3 improvement tocorporatestrategyachieveoperationalexcellence. the fundamentalsofLeanandexplainshowtolinkastrategycontinuous the leadershipbehaviorsrequiredforsustainablesuccess,bookreviews roadmap forinitiating Leanimprovements.Illustrating andlaysoutaclear improvements inthiscomplexindustry lessons learnedbytheauthoroveryearsofleading clinical andnon-clinicalprocesses.Itpresentsvaluable this bookexplainshowtoapplyLeanimprovement Written byaShingoPrize-winningauthorand Leansensei, Ronald G.Bercaw Approaches toLeanTransformation Lean LeadershipforHealthcare Suggested Price: November 2011,7x10,268pp.,SoftCover eBook ISBN:978-1-4665-1142-2 Print ISBN:978-1-4398-7043-3 on patientsafetyandmedicalerrors. deployment. It containsnewandupdatedcasestudiesaswellrevisedchapters measures,employeesuggestionmanagement,andstrategy audits, performance retention, andpatientsafety. This editionincludesnewmaterialonprocess health systems,includingrisingcosts,fallingreimbursementrates,employee Lean healthcareexpertMarkGrabanexaminesthechallengesfacingtoday’s safety, quality, access,andmoralewhilereducingcosts. how tousetheLeanmanagementsystemimprove first edition,LeanHospitals,SecondEditionexplains Building onthesuccessofShingoPrize-Winning Chief ImprovementOfficer, KaiNexus,SanAntonio, Texas, USA Mark Graban Employee Engagement,SecondEdition Improving Quality, PatientSafety, and Lean Hospitals $39.95 /£25.99 $49.95 /£31.99 $55.95 /£35.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Suggested Price: March 2012,7x10,338 pp. eBook ISBN:978-1-4665-5834-2 Print ISBN:978-1-4398-6828-7 hospital leadersandarchitects. with healthcare facilitydesignandconstructionprojects,aswellinterviews architectural designandLeanworkdesign.Itincludesexamplesfromseveralreal the variousstagesofLeandesigndevelopmentphilosophy, includingLean timeline ofarchitectural planning—fromstarttofinish—toguidereadersthrough and easingsomeofhealthcare’s mostpersistentproblems.Itsuppliesasimplified patient safety and reduce wait times while eliminating waste, lowering costs, Lean-Led HospitalDesignexplainshowhospitalscanbebuilttoincrease Gallatin, Tennessee, USA President &Founder, Partners,Inc. HealthcarePerformance Charles Hagood Bellingham, Washington, USA Naida Grunden,L.L.C.-MedicalCommunications, Naida Grunden of theFuture Creating theEfficientHospital Lean-Led HospitalDesign Suggested Price: December 2014,7x10,272pp.,Soft Cover Print ISBN:978-1-4822-3447-3 implemented andthetoolsusedtoachieve thedesiredresults. second halfcontainsadetailedcase study whichdemonstrateshowLeanwas ofLeanwithindividualdescriptionseach theleantools.The an overview and conceptsasappliedtothelaboratory. Thefirstpartof thebookprovides This is a ‘how-to’ book for a Lean implementation that combines up efficienciesandqualitywithoutincreasingcostsorcompromisingquality. speed, efficiency, and quality. drives A Lean laboratory Lean principlescan helplaboratoriessignificantlyincrease and GeorgeMayzell,MD,MBA,FACP Charles Protzman,JoyceKerpchar, High Quality, Patient-FocusedOperation Creating aCostEffective,Standardized, Medical Laboratories Leveraging Leanin Suggested Price: December 2014,7x10,296pp.,SoftCover Print ISBN:978-1-4822-3729-0 departments. services identifies Leansolutionsspecifictotheneedsofhospitalsupportandancillary the desiredresults.DescribingLeantoolsandmethodologiesindetail,book describes how Lean wasimplementedandwhich tools wereusedtoachieve areas ofthehospital.Theauthorsincludeadetailedcasestudyforeachareathat and radiology—explaining inpatientfloors,pharmacy,applied tonutritionalservices, This how-tobook examinesLeantoolsandconceptsas and GeorgeMayzell,MD,MBA,FACP Charles Protzman,JoyceKerpchar, High Quality, Patient-FocusedOperation Creating aCostEffective,Standardized, Hospital Services Leveraging LeaninAncillary $76.95 /£49.99 $59.95 /£38.99 $59.95 /£38.99 how tools implemented in one area can benefit other
Lean tools Lean tools 21 Healthcare Process Improvement Leveraging Lean in mHealth Multidisciplinary Surgical Services Verticals Creating a Cost Effective, Standardized, Edited by High Quality, Patient-Focused Operation Sasan Adibi School of Information Technology, Burwood, Australia Joyce Kerpchar, Charles Protzman, and George Mayzell, MD, MBA, FACP This book provides an overview of the emerging mHealth industry where various verticals are covered under a The result of implementing Lean in the surgical suite is a single volume. It links applications and technologies powerful and proven mix that enables members of cross- to key market and vendor players and also highlights Healthcare Process Improvement functional teams to improve their processes, increase efficiency and financial interdependencies and synergies between various stakeholders. From the performance. This is a ‘how-to’ book for a Lean implementation that combines business perspective, this book provides an exposure to various business models Lean tools and concepts as applied to the surgical suite. The first part of the and highlights the trends and directions where this vertical market is headed. In book provides an overview of Lean with detailed description of the tools used addition, it also considers the social perspectives. in a Lean implementation. The second half contains a detailed case study which demonstrates how Lean was implemented and the tools used to achieve the Print ISBN: 978-1-4822-1480-2 desired results. November 2014, 7 x 10, 754 pp. Suggested Price: $169.95 / £108.00 Print ISBN: 978-1-4822-3449-7 December 2014, 565, 320 pp., Soft Cover Suggested Price: $59.95 / £38.99
Management Engineering Mistake Proofing A Guide to Best Practices for Industrial for Lean Healthcare Engineering in Health Care Thomas L. Jackson Rona Consulting Group, Mercer Island, Washington, USA Edited by Lean Tools for Healthcare Series Jean Ann Larson Mistake-proofing is an improvement technology that uses Increasing costs and higher utilization of resources make a device or procedure, also called a poka-yoke, to prevent the role of process improvement more important than defects or errors during a process. Mistake-proofing in ever in the health care industry. This book provides an healthcare can improve the quality of patient care and overview of the practice of industrial engineering (management engineering) in services; correct conditions in the process that allow for errors or mistakes; the health care industry. It explains how to maximize the skills of management support ideas from knowledgeable staff to improve a process or area; and reduce engineers in a health care setting and supplies tried and true techniques that can costs to the organization by eliminating duplication of work. This user-friendly be implemented easily in most organizations. Filled with tools and documents to book introduces the concepts of Zero Quality Control (ZQC) and Poka-Yoke help readers communicate more effectively, it includes case studies that illustrate Systems. Using healthcare examples, this practical text explains the concept of the proper application of these tools and techniques. mistake-proofing through the use of margin assists, key terms, and how-to-steps. Print ISBN: 978-1-4665-7990-3 Print ISBN: 978-1-4398-3743-6 eBook ISBN: 978-1-4665-7991-0 April 2015, 7 x 10, 120 pp., Soft Cover November 2013, 7 x 10, 319 pp., Soft Cover 22 Suggested Price: $28.95 / £18.99 Suggested Price: $59.95 / £38.99
Mapping Clinical Value Streams Paradox and Imperatives Thomas L. Jackson in Health Care Rona Consulting Group, Mercer Island, Washington, USA Lean Tools for Healthcare Series Redirecting Reform for Efficiency and Effectiveness, Revised Edition The value stream mapping methods described in Mapping Clinical Value Streams will help you achieve Jeffrey C. Bauer Independent Health Futurist and Medical Economist, more efficient healthcare processes and will pave the Chicago, Illinois, USA way to an improved medical system with significantly reduced medical errors and other costly waste. The medical sector of the American economy has Presented in an easy-to-assimilate format, the book includes examples from suddenly stopped growing. This unexpected outcome creates serious problems actual healthcare processes, plus numerous illustrations and margin assists that that cannot be solved by the Affordable Care Act and other one-size-fits- call your attention to key points. Value stream mapping icons make it easy to see all reforms. In this concise and clearly written book, a leading health futurist/ and understand the ebb and flow of healthcare processes. medical economist takes a new, unbiased look at health care’s dysfunctions and proposes three specific actions to create the best health care system that 17 Print ISBN: 978-1-4665-5184-8 percent of GDP can buy. Dr. Bauer shows how the principles of efficiency and eBook ISBN: 978-1-4665-5186-2 effectiveness can be used first to create a world-class delivery system, and then to May 2013, 8-1/2 x 11, 123 pp., Soft Cover provide care for all Americans. Suggested Price: $31.95 / £19.99 Print ISBN: 978-1-4665-9324-4 eBook ISBN: 978-1-4665-9325-1 August 2014, 6-1/8 x 9-1/4, 159 pp. Suggested Price: $39.95 / £25.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: March 2013,6-1/8x9-1/4,128pp.,SoftCover eBook ISBN:978-1-4665-8342-9 Print ISBN:978-1-4665-8341-2 it maylie. conversation onsupportandresiliencewheretheresponsibilitiesforcreating do notalienatesecondvictimsormakethemfeelevenworse.Itentersinto a the secondvictim.Itdiscusseshowtoconductinvestigationsofincidents that about trauma,guilt,forgivenessandinjusticehowthesemightbefelt by the first victims.This bookgoesthrough whatweknow incident or adverse event can be as traumatic as that of too. Theyaresecondvictimswhoseexperiencesofan cause incidentsandaccidents,buttheyarevictims We tendtoblameandforgetthoseprofessionalswho Griffith University, NathanCampus,Australia Sidney Dekker Error, Guilt,Trauma, andResilience Second Victim Suggested Price: November 2014,6-1/8x9-1/4,178pp.,SoftCover Print ISBN:978-1-4665-6770-2 The textillustrateskeyconceptswithexamples,casestudies,andflowcharts. waste, it guidesreaders to select the bestcourseofactionfortheirorganization. Describing howtoidentifydepartment’s functionaldeficits,shortcomings,and functional interrelationshipsandinteractionswithinanorganizationalstructure. book providesadetailedpresentationofFunctionalTree Structures (FTS)andthe influence on the productivity and quality of an entire healthcare organization. This Improvements madeinastableenvironmentwilllastandhavesignificant Vice President,BusinessResearch Group,Detroit,Michigan,USA James S.Bologna,MBA Catholic HealthcareWest, LasVegas, Nevada,USA Reza Ziaee,MA,MSE,PhD,FHIMSS Tree Structures Sustainability throughFunctional for Healthcare Quality Improvement Preparing forContinuous Suggested Price: December 2007,6x9,224pp. eBook ISBN:978-1-4356-2822-9 Print ISBN:978-1-56327-367-4 reviews fromalargenumberofpublicpolicyandhealthexperts. of patientsandthesatisfactionemployees.Thisbookhasalreadyreceivedrave the Pittsburghregionthatsuccessfullyappliedindustrialprinciplestobenefit The bookisacompilationofcasestudiesfromunitsindifferenthospitalsaround can be applied to make healthcare safer, as well as more effective and less costly. specific borrowed fromindustry—in Toyota’s conceptofleanmanufacturing— to Efficient Healthcarechangesthat. This book providesa look athow principles hands-on informationabouthowtofixit.ThecriticallyacclaimedPittsburgh Way in Americafallsshort,itcanbeachallengetofindpractical, While thereisplentyofdataidentifyingwherehealthcare Bellingham, Washington, USA Naida Grunden,L.L.C.-MedicalCommunications, Naida Grunden Using Toyota BasedMethods Improving PatientCare to EfficientHealthcare The PittsburghWay $36.95 /£22.99 $49.95 /£31.99 $49.95 /£28.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Transform Healthcare The PowerofIdeasto Suggested Price: July 2011,7x10,124pp.,SoftCover eBook ISBN:978-1-4398-9201-5 Print ISBN:978-1-4398-3741-2 continuous improvementefforts. daily work and why it should be the cornerstone for all of for your performing Itillustrateshowstandardizationcanhelpyouestablishbestpractices services. Lean tooltoincreasepatientsafetyandreducethecostofprovidinghealthcare Healthcare Series,thisreader-friendlybookexplainshowtoapplypowerful PartoftheLeanToolsimproving healthcareservices. for reducing process waste, ensuringpatientsafety, and sector, Proven toincreaseefficienciesinthemanufacturing Lean Tools forHealthcareSeries Rona ConsultingGroup,Mercer Island,Washington, USA Thomas L.Jackson Healthcare Standard Work forLean Suggested Price: November 2010,6x9,248pp. eBook ISBN:978-1-4398-6309-1 Print ISBN:978-1-56327-375-9 care whilecontrolling costs. way totakeonthechallengeswefaceinU.S. providequalitymedical center transformed.Ultimately, ofanewand possiblybetter itisthestory ofamedical determination toimprove.Itisthestory and leaders blessedwithvision,courage,arelentless clinicians, administrators,frontlineworkers,trustees, ofagroup This Shingo Prizewinnertellsthestory Virginia MasonMedicalCenter, SeattleWashington, USA Charles Kenney PatientExperience of thePerfect Virginia MasonMedicalCenter’s Pursuit Transforming HealthCare Suggested Price: March 2015,7x10,250 pp.,SoftCover Print ISBN:978-1-4987-0740-4 cost ofhealthcareandmotivatestaffintheprocess. forms, tools,andtipstogetyourteamengagedexploreideascanreducethe without takingvaluabletimeawayfromwork.Theysharehundredsofpictures, of inspiredstaffinputthroughprojects,problemsolving,anddaily“huddles” it. Emphasizingthe“currency”ofideas,authorsshowhowtogetmost biggest problemsbyfocusingonwhatneedstobedoneandwhodo TPS inhealthcare,thisbookoffersthekeytohealthcare’s The firsttrulyhow-todeploymentmanualforLeanand Baylor Scott&WhiteHealthcareSystem,Temple, Texas, USA Steven E.HoeftandRobertW. Pryor Daily LeanManagementSystems Engaging StaffbyBuilding Standard Work hasbecomeakeyelementin $31.95 /£20.99 $45.95 /£29.99 $39.95 /£25.99
23 Healthcare Process Improvement Unlocking Sustained Innovation Food Safety Healthcare Process Imp. / Hospitality & Tourism Management Success in Healthcare Researching the Hazard Gregory C. McLaughlin in Hazardous Foods Global Targeting Inc. Fort Lauderdale, Florida, USA Edited by Suzanne Richins Barbara Almanza, Richard Ghiselli, Global Targeting Inc., Ogden, Utah, USA and Mahmood A. Khan Outlining the critical need to apply innovation to reduce Series: Advances in Hospitality and Tourism costs and improve efficiency in the healthcare industry, The book provides a thorough review of current food Unlocking Sustained Innovation Success in Healthcare safety and sanitation information with practical applications of current research details the reasons why innovation management is a must for all healthcare findings included. The book surveys and examines the prevailing research and organizations. It describes how innovation, when implemented as a strategy, can applications and reviews specific operational issues such as power or water yield sustainable success. This is the first in a series of books on how ENOVALE™ emergencies. It also covers food safety and sanitation in various environments, innovation process management operates for a specific market group. The book such as restaurants, schools, and fairs and festivals. It is multidisciplinary in that it demonstrates how the ENOVALE process is used and how it can provide for comprises culinary, hospitality, microbiology, and operations analysis. innovation success in the healthcare sector. Print ISBN: 978-1-926895-70-3 Print ISBN: 978-1-4822-3980-5 eBook ISBN: 978-1-4822-2353-8 October 2014, 6-1/8 x 9-1/4, 247 pp. April 2014, 6 x 9, 510 pp. Suggested Price: $59.95 / £38.99 Suggested Price: $149.95 / £95.00
Value Stream Mapping for Management Science Applications Healthcare Made Easy in Hospitality and Tourism Cindy Jimmerson Edited by Lean Healthcare West, Missoula, Montana, USA Muzaffer Uysal and Zvi Schwartz Value Stream Mapping for Healthcare Made Easy Virginia Polytechnic Institute & State University, Blacksburg, USA introduces readers to the simple but essential method Series: Advances in Hospitality and Tourism from the Toyota Production System: the well-known This book goese beyond revenue management topics and Value Stream Mapping (VSM) system. It offers an easy- presents a broad range of topics in management science to-learn introduction to VSM that can be used in every applications as they relate to hospitality and tourism aspect of healthcare to identify, understand, and improve processes. Information cases. It covers data analytics, e-commerce and technology, revenue and yield included illustrates the simplicity and completeness of the tool and describes its management, optimization methods, resource allocation, goal programming, applications to staff communication, regulatory documentation, and activities dynamic programming, Markov chain models, trends analysis and detection, of daily work. The book also highlights simple-to-use data collection and measuring potential and attractiveness in tourism development, performance interpretation as part of the VSM process. measures and use of indices in hospitality and tourism, and more. There is a Print ISBN: 978-1-4200-7852-7 heightened interest in these areas of business applications in today’s data driven eBook ISBN: 978-1-4416-2390-4 business environment, and this book addresses that interest. August 2009, 8-1/2 x 11, 119 pp., Soft Cover Print ISBN: 978-1-926895-71-0 Suggested Price: $68.95 / £43.99 24 January 2015, 6-1/8 x 9-1/4, 327 pp. Suggested Price: $129.95 / £82.00
The 21st Century Meeting and Event Managing Sustainability in the Technologies Hospitality and Tourism Industry Powerful Tools for Better Planning, Marketing, Paradigms and Directions and Evaluation for the Future Seungwon “Shawn” Lee, Dessislava Boshnakova, and Joe Goldblatt Edited by This is the first book in the field of meeting and event education to specifically Vinnie Jauhari and comprehensively address the area of technology. It includes examples of Series: Advances in Hospitality and Tourism technology platforms, software, cloud-based systems, case studies, checklists, As the world’s natural resource base is limited, the world is financial investments, educational resources, and other valuable information. looking for solutions in the domains of energy, water, alternate building materials, Each chapter addresses the key competencies (standards) of the Meeting resource redeployment, and sustainable livelihoods as well. The tourism and Professionals International Event Management International Competency hospitality industry is a large deployer of natural and created resources. The book Standards (EMICS). Each technology platform will directly support one of the discusses constituents of the hospitality sector and analyzes each of those from a standards identified through EMICS to ensure a correct fit with current and sustainability standpoint. The book includes case studies that are global in nature future industry expectations. and that show how sustainable applications can be used and how concerns can Print ISBN: 978-1-77188-023-7 be addressed. December 2014, 6-1/8 x 9-1/4, 450 pp. Print ISBN: 978-1-926895-72-7 Suggested Price: $129.95 / £82.00 eBook ISBN: 978-1-4822-2356-9 April 2014, 6 x 9, 522 pp. Suggested Price: $129.95 / £82.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2015,6x9, 450pp. January Print ISBN:978-1-926895-67-3 travel, meetings,andothers,withauthors fromallfivecontinents. case studiesandaddressessustainability issuesfromhotels,restaurants,tourism, topic with universal appeal to many disciplines beyond hospitality. It includes book covers sustainabilityin the context of public policy andethics,apopular can expecttofindseveralnewways topursueresearch in sustainability.The scholars onthistopic,providinganexcellentsource ofqualityresearch. Readers sustainability, state-of-the-artresearch byleadinginternationallyrecognized hospitality and tourism, this book presents innovative research methods in A Daniels CollegeofBusiness,Denver, Colorado,USA Vijaya (Vi) Narapareddy University ofDenver, Colarado,USA H. G.Parsa Edited by in theHospitalityIndustry Responsibility andInnovations Sustainability, Social Suggested Price: September 2014,6-1/8x9-1/4,328pp. Print ISBN:978-1-926895-68-0 management. tourismandwinery foundations ofwinery professionals,thepurposeofbookistoexploretheoretical industry room management.With chapterswrittenbyacademicresearchers andwinery tasting tourismdevelopmentto winery of topicsranging from strategic winery managementandencompassesavariety tourismandwinery strategic winery management.Ithighlightsthemajortheorieson tourismandwinery winery The book presents cutting-edge knowledge and research related to strategic Series: AdvancesinHospitalityandTourism Sonoma StateUniversity, RohnertPark,California,USA Kyuho Lee Edited by and Winery Management Strategy Building CompetitiveWinery Tourism and Management Strategic Winery Tourism Suggested Price: October 2014,7-1/2x9-1/2,618pp. Print ISBN:978-1-926895-69-7 franchise concepttodemystifyingthelegalintricaciesofagreements. explains how to operate a successful franchise, from developinga winning the helpofvignettesandcasehistories,thiscompletelyupdatednewedition and stayafloatinthegrowing,ever-changingseaoffranchiseoperations. With professionalswiththeknow-howtodiveinto food service phenomenon. Opportunitiesaboundforrestaurateursand the restaurantfranchisehasbecomeaworldwide Since the late 1800s, when the idea was first conceived, Pamplin CollegeofBusiness,FallsChurch, Virginia, USA Mahmood A.Khan Third Edition Concepts, RegulationsandPractices, Restaurant Franchising reference on sustainability, social responsibility, and green practices in $139.95 /£89.00 $149.95 /£95.00 $149.95 /£95.00
For more informationand acompletelistof titles,visitusat www.crcpress.com
escalate disputesbeforetheybecome volatile. the discussionofintenseemotionalissuessoyoucanlearntopreemptand de- Designed specificallyfortheworkplace,thishighlystructuredprocessfacilitates model usedformorethan25yearsattheNationalConflictResolutionCenter. a four-stageprocessderivedfromtheconflictresolution emotionally chargeddisputes,thisgo-to-guidedetails Supplying readerswithproventoolsforresolving who istiredofusingtrialanderrortoputoutfires. Cybervetting Suggested Price: September 2014,6x9,396pp. eBook ISBN:978-1-4822-6214-8 Print ISBN:978-1-77188-055-8 marketing andtourism. invaluable source forbothpractitionersandacademicianswhoareininternational potential andcharacteristicsastourismdestinations.Thisbookaimstobean There is limited research that focuses on thesecountrieswithrespectto their Tajikistan. Thesecountriesaregainingmoreattentionasemergingdestinations. Asian countriesofKazakhstan,Uzbekistan,Turkmenistan, Kyrgyzstan,and issuesintheCentral challenges, andpolicyregulatory with thedevelopmentoftourism,itspotentialand researchers andpractitionersinterestedinissuesdealing This bookwillbeamajorresource forallacademic and Vincent P. Magnini Kemal Kantarci, MuzafferUysal, Edited by Cultural PotentialandChallenges Tourism inCentralAsia Suggested Price: April 2011,6-1/8x9-1/4,138pp., Soft Cover eBook ISBN:978-1-4398-5299-6 Print ISBN:978-1-4398-5298-9 This book Steven Dinkin,BarbaraFilner, andLisaMaxwell Resolving Workplace Conflict A BoldandProvenApproachto The Exchange Suggested Price: November 2014,6-1/8x9-1/4,320pp. Print ISBN:978-1-4822-3885-3 relating todiscoverableinformationonsocialmedia. and prospectiveemployees.Thebookincludesoutcomesofrecentlegalcases comb theInternetforanyandallinformationonindividualstoscreencurrent intelligence ontheInternet.Theauthoroutlinesnewtoolsandtacticstolegally guidelines forproperuseofInternetvetting,investigations,andopen-source includes about25percent newinformationprovidingthelatesttacticsand and backgroundcompanies do to vet their employees.This second edition shooting havecastabrightlightonwhatemployers The SnowdenintelligenceleakandtherecentNavyYard iNameCheck LLC,BethanyBeach,Delaware,USA Edward J.Appel Intelligence, SecondEdition Investigations, andOpen-Source Internet Searches forVetting, is for every director,is forevery manager, andsupervisor $119.95 /£76.99 $45.95 /£28.99 $79.95 /£49.99
25 Hospitality & Tourism Management / Human Resources & Training Incidental Trainer Six Sigma for Powerful A Reference Guide for Training Design, Improvement Development, and Delivery A Green Belt DMAIC Training System Human Resources & Training / Leadership & Strategy Margaret Wan with Software Tools and EOH Consulting, Saint Petersberg, Florida, USA a 25-Lesson Course This book guides the incidental trainer through the process Charles T. Carroll of training in order to help them achieve effectiveness Independent Consultant, Olathe, Kansas, USA in their program. The first part of the text explains the fundamental steps, from assessing the training needs to The Six Sigma Define-Measure-Analyze-Improve- validating the training program. The second part covers advanced topics such Control (DMAIC) philosophy and procedures are widely accepted as valuable as how to build a business case for the training budget and training in the tools for achieving the most economical and rigorous possible understanding virtual environment. Providing ready-to-use checklists and templates, the author and management of all aspects of operations. This book presents methods presents universal training techniques, including instructional strategies that can and strategy that should alleviate unwarranted concerns about the perceived be applied to the changing workplace. complexity and training and implementation costs of DMAIC. The author clarifies the long-accepted statistical and logical processes of Six Sigma. He uses the Excel Print ISBN: 978-1-4398-5790-8 environment to illustrate how modern business people can properly execute its eBook ISBN: 978-1-4398-5798-4 doctrine and procedures to improve any venture. November 2013, 6-1/8 x 9-1/4, 216 pp. Suggested Price: $83.95 / £53.99 Print ISBN: 978-1-4665-6469-5 eBook ISBN: 978-1-4665-6470-1 May 2013, 8-1/2 x 11, 524 pp. Suggested Price: $104.95 / £65.99
Managing Workers’ Compensation Workplace Safety and Health A Guide to Injury Reduction and Assessing Current Practices and Effective Claim Management Promoting Change in the Profession Keith Wertz and James J. Bryant Thomas D. Schneid Midwestern Insurance Alliance, Louisville, Kentucky, USA Eastern Kentucky University, Richmond, USA Occupational Safety & Health Guide Series Occupational Safety & Health Guide Series
Laying out management and safety procedures that The safety profession often clings to the basic believes and reduce injuries and the aggravation that follows, this book covers hiring, practices which evolved during the early years after the training, and managing employees with injury avoidance in mind. The authors announcement of the Occupational Safety and Health Act provide a blueprint for dealing with injured employees and their families, and in 1970. This book reviews and challenges many of the commonly accepted for determining the correct time for the employee to return to work. The book practices as well as misconceptions about safety in the workplace and provide discusses the all-important issues of fraud, modified duty, substance abuse new and innovative options for safety professionals to consider. It examines many testing, and accident investigations. It also provides guidance for managing of the basic assumptions in the safety profession and challenge the reader to safety efforts in a manner that controls workers’ compensation cost. The book assess and evaluation their activities in search of a better and more effective way shows readers how they can impact - favorably - the amount their organization of achieving the results necessary to be competitive in today’s workplace. 26 pays in premiums. Print ISBN: 978-1-4398-7410-3 Print ISBN: 978-1-56670-348-2 eBook ISBN: 978-1-4398-7411-0 December 2000, 6-1/8 x 9-1/4, 312 pp. May 2014, 6-1/8 x 9-1/4, 227 pp., Soft Cover Suggested Price: $132.95 / £85.00 Suggested Price: $79.95 / £49.99
Security Management for The “Success or Die” Ultimatum Occupational Safety Saving Companies with Blended, Michael Land Long-Term Improvement Formulas Eastern Kentucky University, Richmond, USA Steven Borris Occupational Safety & Health Guide Series Productivity Jigsaw, Ltd. This book is written for the Occupational safety managers Daniel Borris who want to be more effective managers as well as for the Improvement techniques are like spices: better when students who would like to become occupational safety blended. Many organizations seem to lose sight of managers as their profession. A critical thinking approach the techniques that still work in addition to Lean & provides a methodical process to look at the occupational safety management Six Sigma and TPM. This book is a collection of simple stories that show the functions so they can better tailor safety to any organization. This book presents best ways to find and fix four companies’ problems. The authors use the most the most accurately balanced picture of occupational safety management appropriate tools for the problems. It shows that four different companies all functions by using a critical thinking approach to interpret data as a tool for suffer much the same issues but explains why they think are unique. providing more effective safety management. Print ISBN: 978-1-4822-9903-8 Print ISBN: 978-1-4665-6120-5 March 2015, 6-1/8 x 9-1/4, 304 pp. eBook ISBN: 978-1-4665-6121-2 Suggested Price: $39.95 / £25.99 November 2013, 6-1/8 x 9-1/4, 204 pp. Suggested Price: $94.95 / £59.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2010,8-1/2x11,183pp., Soft Cover eBook ISBN:978-1-4398-3490-9 Print ISBN:978-1-4398-3489-3 be reproducedandusedinfutureproblem solvingefforts. actions todecisionmakers.Theworkbookincludes worksheettemplatesthatcan its rootcause,selectappropriate countermeasures, and communicate necessary employees atalllevelswithamethod toquicklyidentifyproblem,analyze of paperusedbyLean companiestopromoteefficiency. TheA3providesall development ofanA3report,asingle-sidedpiece readers step-by-stepthroughthedisciplined entire organization,thisone-of-a-kindworkbook takes Facilitating participationandresponsibility acrossan National InstituteofStandardsandTechnology Manufacturing ExtensionPartnership, Daniel D.Matthews Unlock Your Problem-SolvingMind The A3Workbook Suggested Price: November 1995,7x10,312pp. Print ISBN:978-1-56327-109-0 manufacturer. demonstrate effectiveusebybothaJapanesecompanyandanAmerican that will guide your company to world-class status. Two valuable case studies goals throughafive-levelscoringsystem.Itprovidescriteriaforthefive-levels to achieve ambitious fewer errors. This program provides the strategies necessary that will lead to enhanced quality and productivity and coordinated systemfordrasticandcontinualimprovement integrate severalofthebestimprovementmethodsintoa volume, hehashelpedmanymanufacturingcompanies adopted hisreorganizationstrategies.Throughthis Kobayashi isconsideredageniusbythosewhohave Iwao Kobayashi Improvement 20 KeystoWorkplace Suggested Price: October 2011,6-1/8x9-1/4,266pp. eBook ISBN:978-1-4398-7605-3 Print ISBN:978-1-4398-7604-6 sample CommunicationsPlan,andaTraining Plan. of the images in the text as well as a sample Manufacturing Excellence Audit, a It provides amethodfortrackingprogressandincludesCDwithcolorversions pathway toexcellenceviathe12PrinciplesofManufacturingExcellence. vertical andhorizontalalignmentacrossyourorganization detailsthe right culturethroughleadershipandmentoring.Itdescribeshowtoachieve while cultivatingthe a provenapproachfordeliveringworld-classperformance strategy formanufacturingexcellence,thisbookprovides Explaining howtoimplementandsustainatop-down Pathways toManufacturingExcellenceLLC E.Fast Larry and SustainingExcellence A Leader’s GuidetoAchieving Manufacturing Excellence The 12Principlesof $59.95 /£37.99 $74.95 /£47.99 $45.95 /£28.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Beyond LeanProduction Suggested Price: August 2014,6-1/8x9-1/4,165pp.,SoftCover eBook ISBN:978-1-4822-1870-1 Print ISBN:978-1-4822-1869-5 determine thefocusoftheircorporatestrategy. a methodformeasuringoverallbusinesseffectivenessthatcanhelpreaders system forstrategicplanning.Identifyingadifferentpathtosuccess,itoutlines deployment with anewconceptualunderstandingofHoshinKanriaspowerful The book provides readers of the organization forward. execution systemwhilesimultaneouslymovingtheculture important tool for improving the existing planning and the stepsofHoshinKanri,itadvocatesusingasan and explain Hoshin Kanri. Supplying clear explanations of formattosimplify This bookusesaneasy-to-followstory General DynamicsATP, Charlotte,NorthCarolina,USA Randy K.Kesterson The BasicsofHoshinKanri Suggested Price: May 2014,6-1/8x9-1/4,264pp. eBook ISBN:978-1-4822-2028-5 Print ISBN:978-1-4822-2027-8 most obstinatecompetitiveproblems. universal lessonsofstrategy, thebookuncoverspotentialsolutionstosomeof to helptoday’s executivesand managersthinklikestrategists.Tapping intothe book transposesClausewitz’s mostenduringconceptsonleadershipandstrategy distinguished Western workonwar ever written. This considered bymanyeminentscholarsasthemost von Clausewitz’s monumental 1832classicOnWar— Thinking LikeaStrategistdistillsthewisdomofCarl Clausewitz Talks Business: AnExecutive’s Guideto Norton Paley Thinking LikeaStrategist An Executive’s Guideto Clausewitz Talks Business Suggested Price: 2014,6-1/8x9-1/4,108pp.,SoftCover February eBook ISBN:978-1-4822-1583-0 Print ISBN:978-1-4822-1582-3 quality,even exceedtheircustomers’expectationsregardingservice, andcost. the factory. It explains how to eliminate waste so readers will be able to meet and understanding requiredtoaddspeedandurgencyalltasksintheoffice todomesticcustomers,thebookprovidesreaderswith speed ofdelivery overseas factoriescan’t compete withU.S.factoriesin percent effectivenessinLean production.Explainingthat with thetoolstohelptheirorganizationsachieve100 in today’s marketplace,thisbook Covering thefundamentalsneededtobecompetitive Roger G.Lewandowski to BeattheCompetition Emphasizing SpeedandInnovation $19.95 /£13.99 $49.95 /£31.99 $29.95 /£25.99
provides readers provides readers
27 Leadership & Strategy Closing the Communication Gap Freedom from Command An Effective Method for and Control Achieving Desired Results Rethinking Management H. James Harrington for Lean Service Harrington Institute, Los Gatos, California, USA John Seddon Robert Lewis VP, Mission Support Development, Marketplace Missions, Inc., Proving that top-down decision making within service- Citrus Heights, California, USA oriented businesses leads to managers who are detached Series: The Little Big Book Series from employees and daily operations, John Seddon This book can help readers improve communication by closing the communication demonstrates that decision-making based on purpose-related measures (such gap—the gap between what the communicator means and what the listener as putting customers first and improving services) can help managers reconnect actually understands. It supplies a complete overview of the various elements with operations, see waste, and exploit opportunities for improvement. Through Leadership & Strategy and dimensions of effective communication. Defining and discussing both the case material, this Toyota Production Systems adherent illustrates how systems formal and the informal communication systems within an organization, it details thinking leads to improved service, revenues, and staff morale. He also posits that the four types of poor-quality communication. It explains how to be a better the service industry fundamentally differs from manufacturing, and shows how listener, how to use social media in marketing, how to deal with difficult people, Toyota production principles can be transformed for application in that arena. and helpful tips for public speaking. Print ISBN: 978-1-56327-327-8 Print ISBN: 978-1-4665-7488-5 August 2005, 6 x 9, 256 pp. eBook ISBN: 978-1-4665-7489-2 Suggested Price: $62.95 / £39.99 October 2013, 6-1/8 x 9-1/4, 316 pp., Soft Cover Suggested Price: $31.95 / £19.99 Hoshin Kanri for The Expanded and Annotated the Lean Enterprise My Life and Work Developing Competitive Capabilities and Managing Profit Henry Ford’s Universal Code for World-Class Success Thomas L. Jackson Rona Consulting, Mercer Island, Washington, USA William A. Levinson, Henry Ford, and Samuel Crowther Winner of a Shingo Research and Professional Publication Award, this book facilitates an Henry Ford’s My Life and Work remains one of the most understanding of hoshin kanri as a grand design implemented through a comprehensive books on management ever written: system of team agreements. It defines an improved X-matrix that incorporates a a universal code, to use Ford’s words, that applies to every human field of scorecard for identifying improvement opportunities and converting them into endeavor. It contains not only all the basic elements of what is now called the bottom line results in terms that financial managers can support. Beyond theory, Toyota Production System, but also the organizational and human relations it demonstrates the mechanics of hoshin kanri to accelerate brand equity while principles necessary to gain buy-in and engagement from all participants. This initiating lean manufacturing and Six Sigma improvements. Accompanying the annotated edition intersperses Ford’s original material with detailed explanations text is a CD containing forms, meeting agendas, and examples of X-matrices that and contemporary examples that put it into context for 21st century business are applicable to marketing, design engineering, and manufacturing. leaders and Lean manufacturing practitioners. Print ISBN: 978-1-56327-342-1 28 Print ISBN: 978-1-4665-5771-0 August 2006, 8-1/2 x 11, 224 pp., Soft Cover April 2013, 6-1/8 x 9-1/4, 319 pp. Suggested Price: $68.95 / £43.99 Suggested Price: $49.95 / £31.99
The Four Components of a How to Outthink, Outmaneuver, Fast-Paced Organization and Outperform Your Going Beyond Lean Sigma Tools Competitors Robert Baird Lessons from the Masters of Strategy This book examines the four components that must be Norton Paley in place for manufacturing and service organizations Providing readers with a firm grasp of the roots of to achieve world-class business results: leadership and strategy, this book details how to develop strategies and mentoring, process design and visual value streams, the skills needed to apply them to a range of volatile organization structure for sustainment, and fast knowledge sharing. The book competitive conditions. The author interweaves the classic works of the masters illustrates the author’s actual experience working on a special Lean Sigma of strategy, such as Sun Tzu’s The Art of War and Carl von Clausewitz’s On War as transformation at an organization going through a market alteration and having well as the writings of Jomini, Machiavelli, the renowned 20th Century historian to consider outsourcing production to low-cost countries. The text illustrates B. H. Liddell Hart, and others blending historical lessons with modern business how the four key components helped them achieve a doubling of productivity, a practice. Their collective insights provide longevity, general acceptance, and 75% improvement to their yield, and on time delivery above 90%. authority to the workings of strategy. Print ISBN: 978-1-4822-0600-5 Print ISBN: 978-1-4665-6540-1 eBook ISBN: 978-1-4822-0602-9 eBook ISBN: 978-1-4665-6541-8 November 2013, 6-1/8 x 9-1/4, 228 pp. April 2013, 6-1/8 x 9-1/4, 301 pp. Suggested Price: $41.95 / £26.99 Suggested Price: $49.95 / £31.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: March 2014,6-1/8x9-1/4,151pp.,SoftCover eBook ISBN:978-1-4822-1996-8 Print ISBN:978-1-4822-1995-1 themselves managing adiversegroupofemployees. managers whowanttosharpentheir leadershipskills,andanyonewhofinds situations, this is an idealreference for anyonenew immediately. Illustratingkeyconceptswithscenariosdrawnfromactualwork management skilland concludes with bulletpointstohelpreaderstakeaction to employees,customers,andbosses.Eachchapterdissectsadifferent to improvehowreaderscommunicateandrelate Basics forFrontlineManagersexplainswhatittakes Focused oninterpersonalmanagementskills,Leadership Bill Templeman Effectiveness andCommunication Tips forRaisingYour Levelof Frontline Managers Leadership Basicsfor Suggested Price: March 2010,6-1/8x9-1/4, 228pp. eBook ISBN:978-1-4398-0596-1 Print ISBN:978-1-4398-0595-4 to supportthedesignofyourQRMstrategy. through implementationissues—includingsimplecalculationmethodsandtools for implementation.ItalsoincludesaCDwithtime-savingtipstohelpyouwork accounting strategies,novelcost-justificationapproaches,andastepwiseprocess wage countriesandprovideshelpfulpointersforQRMimplementation,including advanced nationscanuseQRMstrategytocompetewithmanufacturersinlow- enable companiestogaina substantialmarketshare.Itexplainshowfactoriesin only reduceleadtimesbutalsoimprovequality, reduceoperatingcosts,and Manufacturing, thisbookillustrateshowQRMcannot publication ofRajanSuri’s landmarktext,Quick Response Presenting thedevelopmentsinQRMsince Manufacturing, Madison,Wisconsin, USA Founding Director, CenterforQuickResponse Rajan Suri Quick ResponseManufacturing The CompetitiveAdvantageof It’s AboutTime Suggested Price: September 2013,7x10,332pp.,SoftCover eBook ISBN:978-1-4665-6405-3 Print ISBN:978-1-4665-6404-6 insights onforeigncompetitionthatfewareabletoprovide. national andinternationalassignments,putshiminauniquepositiontosupply this trend. Theauthor’s background in engineeringand manufacturing, in both inundated manufacturersandoutlinesthestepscompaniescantaketoreverse the implementationofmultitudeimprovementmethodologiesthathave explains why many companies have not reaped the benefitspromised from outflow ofmanufacturingjobsandprosperityfromourshores.Thebook outlines concretesuggestionsthatcanhelpstopthe including theunsustainabletradeimbalance,thisbook Examining thecurrentU.S.manufacturingenvironment, R. BickLesser Electric andGeneralMotors Lessons LearnedfromDelphiPackard Reviving U.S.ManufacturingIncluding Intelligent Manufacturing $29.95 /£18.99 $47.95 /£29.99 $49.95 /£31.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
management, experienced experienced The LeanExpert Suggested Price: September 2012,6-1/8x9-1/4,264pp. eBook ISBN:978-1-4398-5988-9 Print ISBN:978-1-4398-5987-2 leadership toolsanddiscusseshowtobuildaLeanculture. review structure in support of a lean transformation. The book introduces key improvements, itexploresthedevelopmentofacorporateassessmentand improve thevaluestream.Presentingtacticalorganizationalstepstosustain at theleadershiplevelanddemonstrateshowtostructurekaizeneventsthat good direction.Itexplainstheuseofvaluestreamanalysis how themetricsusedbyToyota lineitemina driveevery second editionofthisbestsellingreferencedescribes Updated withnewfiguresandinformation,the Simpler Consulting,Inc.,Ottumwa,Iowa,USA George Koenigsaecker Second Edition Transformation Leading theLeanEnterprise Suggested Price: July 2010,7x10, 527 pp. eBook ISBN:978-1-4398-2099-5 Print ISBN:978-1-4398-2096-4 to Leanproduction. pull productionandthesupplychain, the textprovidesacompleteintroduction case studies.Fromfundamentalconcepts tointegratedplanningandcontrolin philosophy andillustratestheeffective applicationofLeantoolswithreal-world experience, Ford’s system did for mass manufacturing. Based on three decades of teaching manufacturing practiceandbusinessconductinamannersimilartowhatHenry The Lean conceptsand principles described in this book have revolutionized Loyola University, USA John Nicholas Management Practices Lean Methodologiesand A ComprehensiveGuideto Competitive Advantage Lean Productionfor Textbook Suggested Price: December 2014,7x10,184pp.,SoftCover Print ISBN:978-1-4822-5365-8 discipline. people workingtowardstheachievementof“expertstatus”intheirspecific to provideamethodwithdefinedstepsforthedevelopmentofLean-minded an army of Lean resources withintheirorganization.The book’s main focus is that theybelievetheirassociatesaregreatestassets,butcreating By implementingtheLeanDisciplineExpertprocess,companiesnotonlyshow in specificareas,includingstandardizedwork,valuestreammapping,andTPM. engage associatesandhelpthembecomeLeanexperts This bookprovides a methodtohelporganizations Gates Corporation,Suzhou,China Joseph Niederstadt Your Organization Practitioners Throughout Educating andElevatingLean introduces the Lean Lean ProductionforaCompetitiveAdvantage introducestheLean $54.95 /£34.99 $94.95 /£59.99 $39.95 /£25.99
29 Leadership & Strategy Make Your Business Performance Acceleration a Lean Business Management (PAM) How to Create Enduring Rapid Improvement to Market Leadership Your Key Performance Drivers Paul C. Husby H. James Harrington 3M Company, St. Paul, Minnesota, USA Harrington Institute, Los Gatos, California, USA Jerome Hamilton The Little Big Book Series Written by business leaders for business leaders, this The first book in the Little Big Book Series, Performance book is a how-to guide on transforming a business and building enduring market Acceleration Management (PAM): Rapid Improvement to Your Key leadership. Based on the authors more than 60 years of experience, it provides Performance Drivers, explains how to accelerate the rate of change and the tools required to plan, align, and transform businesses, starting with the improvement in your organization to exceed your customers’ expectations. It
Leadership & Strategy core business value proposition, and continuing through business planning, introduces the PAM approach to accelerated performance improvement and disciplined goal and resource alignment, and implementation management. explains how to use it to bring about significant change to your organization’s It delineates a logical path to apply initial strategy to every detailed activity, long-term performance. Delving into more than 50 years of experience helping engaging the entire organization to become more competitive day by day. organizations implement improvement approaches, H. James Harrington highlights key opportunities to add value to your organization. Print ISBN: 978-1-4398-2999-8 June 2015, 6 x 9, 250 pp. Print ISBN: 978-1-4665-7257-7 Suggested Price: $49.95 / £31.99 eBook ISBN: 978-1-4822-0595-4 March 2013, 6-1/8 x 9-1/4, 220 pp., Soft Cover Suggested Price: $31.95 / £19.99
Making the Case for Change The Product Wheel Handbook Using Effective Business Cases to Creating Balanced Flow in Minimize Project and Innovation High-Mix Process Operations Failures Peter L. King Christopher F. Voehl, H. James Harrington, Lean Dynamics LLC, Newark, Delaware, USA and Frank Voehl Jennifer S. King The Little Big Book Series The product wheel (PW) design process has practical Making the Case for Change provides executive methods for finding the optimum sequence, therefore teams and project managers with the information required to decide whether minimizing changeover costs and freeing up useful proposed projects should have resources applied to them. The book supports capacity. This book describes this proven technique for dealing with all of the the development of strong business cases that link investments with program issues related to multiple product situations. It walks the reader through a logical, results and, ultimately, with the strategic outcomes of an organization. Ideal detailed, step-by-step process for designing and implementing the PW technique. for executives and project/initiative managers seeking approval of an activity, Breaking down a fairly complex design process down into discrete, practical, initiative, program, or project, the book presents proven tips, advice, suggestions, manageable steps, it includes a case study from actual practice that illustrates the templates, case studies and recommended courses of action on developing design process and the benefits. effective business cases. Print ISBN: 978-1-4665-5418-4 30 Print ISBN: 978-1-4665-8051-0 eBook ISBN: 978-1-4665-5419-1 eBook ISBN: 978-1-4665-8052-7 April 2013, 8-1/2 x 11, 219 pp., Soft Cover September 2014, 6-1/8 x 9-1/4, 265 pp., Soft Cover Suggested Price: $49.95 / £31.99 Suggested Price: $29.95 / £18.99
Maximizing Value Propositions Quick Response Manufacturing to Increase Project Success Rates A Companywide Approach H. James Harrington and Brett Trusko to Reducing Lead Times The Little Big Book Series Rajan Suri Founding Director, Center for Quick Response Manufacturing, In order to thrive in today’s increasingly competitive global Madison, Wisconsin, USA environment, all sources of new and creative ideas within an organization must be considered. Value propositions Developed by the author and now being employed by allow innovators, who may otherwise be intimidated to a number of businesses, Quick Response Manufacturing voice their ideas, to prepare a document that outlines (QRM) is an expansion of time-based competition, aimed the potential value of their ideas. This book explains how to foster creativity in at a single target with the goal of reducing lead times. The key difference employees and encourage them to actively search for and document ideas that between QRM and other time-based programs is that QRM covers an entire will add value to their organizations. Focusing on the necessary data collection organization, from the shop floor to the office, to sales and beyond. Providing efforts, it supplies readers with the understanding to create value propositions guidelines for establishing a QRM enterprise, this volume builds upon kaizen, that separate profitable from unprofitable ideas. TQM, TPM, and other practice to help organizations streamline all functions of their operation. It shows how to quickly introduce products, along with ways to Print ISBN: 978-1-4665-7075-7 rethink materials and production management. eBook ISBN: 978-1-4665-7076-4 April 2014, 6-1/8 x 9-1/4, 220 pp., Soft Cover Print ISBN: 978-1-56327-201-1 Suggested Price: $29.95 / £18.99 June 1998, 6 x 9, 576 pp. Suggested Price: $74.95 / £47.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: May 2013,7x10,293pp.,SoftCover eBook ISBN:978-1-4665-6746-7 Print ISBN:978-1-4665-6745-0 areasofabusiness. strategies inthefiveperformance monitoring, andmeasurement.Thetext includesastrategybankwith150 study illustrates theentirestrategyformulationprocess—includingexecution, the impactofstrategicplanningandexecution.Acomprehensive case signals. It also introduces the Entrepreneurial Score Card – a tool for improving for monitoring strategyexecutionthatgiveearlywarning and measurement.Itprovidesreaderswithmethods the completeprocessofstrategicplanning,execution, Considering theentirevaluechain,thisbookcovers Girish P. Jakhotiya ToolA Powerful forCEOs and Measurement(SPEM) Strategic Planning,Execution, Suggested Price: June 2013,6-1/8x9-1/4,333pp.,SoftCover eBook ISBN:978-1-4665-9098-4 Print ISBN:978-1-4665-9097-7 surprising andessentialelementscommontoallofthem. case studies,theyanalyzeseverallandmarkinnovationsindetail,revealing challenges intoopportunitiesforpractical,scalableinnovation.Usingillustrative thinking todiscoverreal-lifechallenges,andprovidetoolsforturningthese of opportunitiesandrisksonthepathtosuccess.Theauthorsapplysystems inventors, investors,andentrepreneurstounderstandthenaturetiming introduces amodelfortheinnovationprocess,helping Based onrecentadvancesincognitivesciences,thisbook University ofMichigan,AnnArbor, USA Max Shtein Stanford University, California,USA Eugene Shteyn and IPProfessionals A GuideforInventors,Entrepreneurs, Scalable Innovation Suggested Price: December 2014,7x10,288pp.,SoftCover Print ISBN:978-1-4822-5235-4 Association ofFacilitators(IAF)certificationprocess. detail andalsohighlightsimportantfactorsnotcoveredintheInternational the planning,conducting,andcompletingofmeetingresponsibilitiesinexplicit objectives ofalong-termprogram.Thebookexamines (CSFs) formeasuringprogresstowardsachievingthe successful, itillustratestheuseofcriticalsuccessfactors and techniquesthatfacilitatorsneedtomasterbe characteristics oftoday’s facilitator. Discussingthetools This bookexplainsandoutlinesthenewrole T.Marvin Howell Expert, Manager, Mentor The ResultsFacilitator $71.95 /£45.99 $49.95 /£31.99 $39.95 /£25.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Management System A CriticalComponentofToyota’s PDCA Understanding A3Thinking Suggested Price: March 2015,6-1/8x9-1/4,240pp.,SoftCover Print ISBN:978-1-4665-7726-8 use thesetoolseffectively. are providedwherethereadercanacquiredetailedknowledgerequiredto little bigbooksmanyofthemarenotdiscussedindetail.Inthesecasesreferences due tothelargenumberoftoolsandtechniquessizelimitation ofeachtheseimportanttoolsbut organization. Itprovidesashortoverview or externalconsultantassignedtomanageanimprovementprojectwithin and techniquesthatmustbemasteredbyaninternal briefform,thetools This bookpresents,inavery The LittleBigBookSeries Business SystemsArchitects, SantaClara,California,USA Chuck Mignosa Harrington Institute,LosGatos,California,USA H. JamesHarrington Sample Outputs Techniques and Suggested Price: June 2015,6-1/8x9-1/4,350pp. Print ISBN:978-1-4398-3948-5 features thedatasetsusedinexamples alongwithvariousexercises. as forpractitionersinthefieldsoffinance andinsurance.Thebook’s website mathematical finance/financial engineering, economics, and statistics as well the authors:activeriskmanagement. Itissuitableforgraduatestudentsin This bookintroducesaninnovativeconcept andmethodologydevelopedby professionals inindustry, government,andacademiaareof timely relevance. and discussion.Novelmodelingapproachescoursestoeducatefuture in financialinstitutions,particularlybanks,hasattractedwidespreadattention Following therecentfinancialcrisis,riskmanagement Chapman andHall/CRCFinancialMathematicsSeries SUNY, StonyBrook,NewYork, USA Haipeng Xing Stanford University, California,USA Tze LeungLai and StatisticalMethods Financial Models Active RiskManagement Suggested Price: March 2008,6x9,184 pp. Print ISBN:978-1-56327-360-5 includes practical adviceonhowtowriteandreviewA3reports. implemented inconjunctionwithaPDCA-basedmanagementphilosophy. It in theA3process.Theauthorsshowthatreportis especiallyeffectivewhen manual highlightsthedeeplearningandprofessionaldevelopmentthatoccurs an A3system.Winner ofa ShingoResearch and Professional Publication Prize, this from thedevelopmentofdynamicculturerequiredforimplementation power oftheA3report,however, derivesnotfromthereportitself,butrather successful movetowardorganizationalefficiency. The The A3reporthasproventobeakeytoolinToyota’s Art ofLean,HuntingtonBeach,California,USA Art Smalley University ofMontana,Bozemont,USA K.SobekII. Durward $29.95 /£18.99 $89.95 /£57.99 $49.95 /£28.99
31 Leadership & Strategy / Mathematics & Statistices for Finance Textbook Applied Time Series Modelling Actuarial Models with Unobserved Components The Mathematics of Insurance, Matteo Maria Pelagatti Second Edition Unobserved Components Models (UCMs) are a Vladimir I. Rotar special class of time series models that have many San Diego State University, California, USA advantages compared with other models in that they tend to provide more accurate forecasts and can be Preparing students to take their actuarial exams, this Mathematics & Statistices for Finance easily implemented. This book provides an overview of text covers the basic models of insurance processes and time series modelling using UCMs with an emphasis presents the mathematical frameworks and methods used in actuarial modeling. on real-world applications and solutions to practical problems. Detailed worked It contains the standard material taught in actuarial modeling courses as well examples, primarily from economics and business, provide additional guidance as several advanced topics. This second edition revises all chapters, especially on the use of appropriate software for each method. material on the surplus process, and takes into account recent developments in teaching actuarial modeling. It includes a new chapter on pension models and Print ISBN: 978-1-4822-2500-6 new problems from Casualty Actuarial Society exams. May 2015, 6-1/8 x 9-1/4, 250 pp. Suggested Price: $99.95 / £63.99 Print ISBN: 978-1-4822-2706-2 eBook ISBN: 978-1-4822-2709-3 August 2014, 7 x 10, 654 pp., Pack - Book and Ebook Suggested Price: $99.95 / £63.99
Commodities Edited by M. A. H. Dempster Adversarial Risk Analysis Cambridge Systems Associates Limited, UK David L. Banks, Jesus M. Rios Aliaga, Ke Tang and David Rios Insua Renmin University of China, Beijing Chapman and Hall/CRC Financial Mathematics Series Adversarial risk analysis is a relatively new area of research concerning decision making when there are This book covers the fundamental theory of and intelligent opponents and uncertain outcomes. This derivatives pricing for major commodity markets as book develops methods for the analysis of allocation well as the interaction between commodity prices and the real economy and decisions when there are intelligent adversaries aiming other financial markets. After an extensive theoretical and practical introduction, at increasing risk. In addition, the book provides a the book is divided into four parts covering oil products, natural gas, wine, framework for adversarial risk analysis with examples throughout that illustrate soybeans, corn, gold, silver, copper, stocks, bonds, futures, currency markets, its application. index products, and electricity markets. Print ISBN: 978-1-4987-1239-2 Print ISBN: 978-1-4987-1232-3 June 2015, 6-1/8 x 9-1/4, 200 pp. April 2015, 6-1/8 x 9-1/4, 448 pp. Suggested Price: $89.95 / £57.99 Suggested Price: $149.95 / £95.00 32
Textbook Computational Actuarial Science The Analysis of Time Series with R An Introduction, Sixth Edition Edited by Chris Chatfield Arthur Charpentier University of Bath, UK University of Québec at Montreal, Canada Series: Chapman & Hall/CRC Texts in Statistical Science Chapman & Hall/CRC The R Series
Now in its sixth edition, this book provides an accessible, This book demystifies the computational aspects comprehensive introduction to the theory and practice of actuarial science, showing that even complex of time series analysis. It covers a wide range of topics, computations can usually be done without too much including ARIMA probability models, forecasting methods, spectral analysis, trouble. Using simple R code, the book helps readers understand the algorithms linear systems, state-space models, and the Kalman filter. It also addresses involved in actuarial computations. It also covers more advanced topics, such as nonlinear, multivariate, and long-memory models. Building on the success of parallel computing and C/C++ embedded codes. Datasets used in the text are earlier editions, the sixth edition was thoroughly revised and updated, and available in an R package from CRAN. all of the data sets are available for download from the Internet. Its polished Print ISBN: 978-1-4665-9259-9 presentation and broad coverage make this simply the best introductory text on eBook ISBN: 978-1-4665-9260-5 the subject available. August 2014, 7 x 10, 656 pp. Print ISBN: 978-1-58488-317-3 Suggested Price: $89.95 / £57.99 July 2003, 6-1/8 x 9-1/4, 352 pp., Soft Cover Suggested Price: $83.95 / £42.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2014,7x10,480pp. eBook ISBN:978-1-4665-8323-8 Print ISBN:978-1-4665-8322-1 available ontheauthor’s website. methods, andalgorithmsforcopulaapplications.Softwarecode area selection. He also covers inference,diagnostics,model comparison, numerical presents dependence and tail properties to assist readers in copula model discusses othermultivariateconstructionsandparametriccopulafamilies, and author developsvinecopulamodelsandgeneralizations, vine copulamodelingofhigh-dimensionaldata.The This book coversrecent advances in the field, including & AppliedProbability Series: Chapman&Hall/CRCMonographsonStatistics University ofBritishColumbia,Vancouver, Canada Joe Harry with Copulas Dependence Modeling Suggested Price: June 2014,7x10,388pp. eBook ISBN:978-1-4665-1646-5 Print ISBN:978-1-4665-1645-8 andcollateral. replacement cost(RC),wrong-wayrisk,multiplefundingcurves, and ratingvaluationadjustment(CVA, DVA, FVA, LVA, andRVA) aswell contracts underfundingconstraints.Theyexplorecredit,debt,funding,liquidity, hedging ofbilateralcounterpartyriskonover-the-counter(OTC)derivative methodology ofdynamicvaluation,mitigation,and authors provideananalyticalbasisforthequantitative transactions betweenthebankanditscounterparty. The This bookexplainshowtostudyriskembeddedinfinancial Chapman andHall/CRCFinancialMathematicsSeries and DamianoBrigo Stéphane Crépey, Tomasz R.Bielecki, A Tale ofTwo Puzzles Counterparty RiskandFunding Suggested Price: September 2012,7x10,444pp. eBook ISBN:978-1-4398-2958-5 Print ISBN:978-1-4398-2957-8 techniques, suchasKalmanandparticlefilters,forparameterestimation. University, thebookalsocoversmodelcalibrationandoptimizationdescribes author’s coursesatColumbiaUniversityandtheCourantInstituteofNewYork the finite difference method, and Monte Carlo simulation. Developed from the addresses key computational methods in finance, including transformtechniques, functional equationsthroughnumericalmethods.It this self-containedtextexplainshowtosolvecomplex Helping readers accurately price a vast array of derivatives, Chapman andHall/CRCFinancialMathematicsSeries Caspian CapitalManagement,LLC,NewYork, USA Ali Hirsa in Finance Computational Methods Textbook $89.95 /£57.99 $89.95 /£57.99 $93.95 /£62.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Textbook Suggested Price: December 2013,6x9,302pp. eBook ISBN:978-1-4822-1267-9 Print ISBN:978-1-926895-56-7 was suggested. and theircontrolatuncertaintyconditionsinafinite-dimensionalvectorspace was developed,andacriterionofmultivariatepredictioneconomicprocess onconstructingpiecewise-lineareconomic-mathematicalmodels special theory economic process at uncertainty conditions in finite-dimensionalA vector space. space andtheprinciplepiecewise-linearhomogeneityof at uncertaintyconditionsinfinite-dimensionalvector postulate spacial-timecertaintyofeconomicprocess This bookcoversmathematicalprogramming,usingthe National AcademyofScienceAzerbaijan,Baku A. G.Aliyev under Uncertainty Methods andModels Economic-Mathematical Suggested Price: March 2014,7x10,829pp. eBook ISBN:978-1-4398-9243-5 Print ISBN:978-1-4398-9242-8 of financialderivatives. approaches, linkingrelatedcomprehensive techniquesforpricingdifferenttypes way. Unlikesimilartextsinthefield,this one presentsmultipleproblem-solving and relevantmathematicalmethodsinamathematicallyrigorousyetengaging problems, andfullyworkedoutsolutions,thetextintroducesfinancialtheory behind modern-dayfinancialmathematics. With anabundanceofexamples, andapplicationofmethods account ofthemaintheory experiences, thistextprovidesaunified,self-contained Tested andrefinedthrough yearsoftheauthors’teaching Chapman andHall/CRCFinancialMathematicsSeries Wilfrid LaurierUniversity, Waterloo, Ontario,Canada Giuseppe CampolietiandRomanN.Makarov A ComprehensiveTreatment Financial Mathematics Textbook Suggested Price: December 2013,5-1/2x8-1/2,186pp.,SoftCover eBook ISBN:978-1-4665-8480-8 Print ISBN:978-1-4665-8478-5 available onthebook’s CRCPresswebpage. explain thetechniquesandanExceladd-intoenablebasicanalyses,withboth advanced mathematicalformulae.Itusesaneasilyunderstooddatasettohelp forthosewhoareunfamiliarwith analyseseasytoperform straightforward applied research. Unlike most booksonmultivariatemethods,thisonemakes text explainstheusefulnessofmultivariatemethodsin substantial background in statisticsor mathematics, this Accessible tostudentsandresearchers withouta de HavillandCampus,Hatfield,UK University ofHertfordshireBusinessSchool, Neil H.Spencer Data Analysis Essentials ofMultivariate $129.95 /£82.00 $89.95 /£57.99 $62.95 /£35.99
33 Mathematics & Statistices for Finance Financial Modelling Introduction to with Jump Processes Risk Parity and Budgeting Second Edition Thierry Roncalli Lyxor Asset Management, Paris, France Peter Tankov Chapman and Hall/CRC Financial Mathematics Series Universite Paris VII, France Rama Cont Written by a well-known expert of asset management and Chapman and Hall/CRC Financial Mathematics Series risk parity, this book provides an up-to-date treatment
Mathematics & Statistices for Finance of the risk parity approach, an alternative method to Including a new chapter on credit risk modeling and Markowitz optimization. It builds financial exposure to new developments in econometrics, this new edition of a bestseller provides an equities and commodities, considers credit risk in the management of bond accessible overview of financials models based on jump processes used in risk portfolios, and designs long-term investment policy. The first part of the book management and option pricing. After presenting the necessary mathematics, gives a theoretical account of portfolio optimization and risk parity. Each chapter the text addresses theoretical, numerical, and empirical issues. It demystifies in the second part presents an application of risk parity to a specific asset class. technical difficulties for a better understanding of applications while presenting mathematical results in a rigorous, self-contained manner, accessible to readers Print ISBN: 978-1-4822-0715-6 with basic knowledge of the Black-Scholes model. Many numerical and empirical eBook ISBN: 978-1-4822-0716-3 examples illustrate the concepts. July 2013, 6-1/8 x 9-1/4, 440 pp. Suggested Price: $83.95 / £53.99 Print ISBN: 978-1-4200-8219-7 June 2015, 6-1/8 x 9-1/4, 606 pp. Suggested Price: $89.95 / £57.99
Introduction to Handbook of Discrete-Valued Spatial Econometrics Time Series James LeSage Edited by McCoy College of Business Administration, San Marcos, Texas, USA Richard A Davis, Scott H. Holan, Robert Lund, and Nalini Ravishanker Robert Kelley Pace Louisiana State University, Baton Rouge, USA Series: Chapman & Hall/CRC Handbooks of Modern Statistical Methods Statistics: A Series of Textbooks and Monographs
The analysis of discrete-valued time series encompasses Introduction to Spatial Econometrics presents a variety of a broad array of methodologies for dealing with the regression methods for analyzing spatial data samples that violate the traditional temporal dependencies that arise in modeling discrete data. This book covers an assumption of independence between observations. It explores a range of extensive set of approaches, motivated by a broad and diverse set of application alternative topics, including maximum likelihood and Bayesian estimation, areas, including epidemiology, business, genetics, and the environmental and various types of spatial regression specifications, and applied modeling situations ecological sciences. Providing a comprehensive, coherent, and unified overview involving different circumstances. The authors clarify the often-mystifying of the subject, it contains rigorously-edited chapters from leading researchers phenomenon of simultaneous spatial dependence. MATLAB® toolboxes useful and gives a balanced treatment of theory and applications with numerous case for spatial econometric estimation are made available on the authors’ websites. studies and examples. Print ISBN: 978-1-4200-6424-7 Print ISBN: 978-1-4665-7773-2 eBook ISBN: 978-1-4200-6425-4 34 August 2015, 7 x 10, 650 pp. January 2009, 6-1/8 x 9-1/4, 374 pp. Suggested Price: $119.95 / £76.99 Suggested Price: $109.95 / £69.99
Introduction to Textbook Credit Risk Modeling Introduction to Stochastic Second Edition Calculus with Applications Christian Bluhm, Ludger Overbeck, Gregory F. Lawler and Christoph Wagner University of Chicago, Illinois, USA Chapman and Hall/CRC Financial Mathematics Series This text balances accessibility and rigor in teaching While continuing to focus on common mathematical stochastic calculus to advanced undergraduate and approaches to model credit portfolios, this second graduate students in mathematics, economics, and edition presents updates on model developments that have occurred since the finance. Avoiding the measure-theoretic formalism, the publication of the best-selling first edition. It contains a new section on multi- author presents the material in a natural order and keeps technical ideas to a period models and discusses recent developments in structured credit. Along minimum. Any technical material is covered in sections that are separate from with many worked out examples and numerical results, this edition also includes the main text. Students are encouraged to write computer programs using C++, ® ® an expanded section on techniques for the generation of loss distributions as MATLAB , or Mathematica . well as discussions of new topics, such as spectral risk measures, an axiomatic Print ISBN: 978-1-4665-7080-1 approach to capital allocation, and nonhomogeneous Markov chains. March 2015, 6-1/8 x 9-1/4, 250 pp. Print ISBN: 978-1-58488-992-2 Suggested Price: $59.95 / £38.99 eBook ISBN: 978-1-58488-993-9 June 2010, 6-1/8 x 9-1/4, 384 pp. Suggested Price: $94.95 / £59.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2014,6-1/8x9-1/4,363pp. Print ISBN:978-1-4665-9409-8 a summary, reviewquestions, andnumericalexercises. think aboutstatisticsasmorethanatoolboxoftechniques.Eachchapterincludes statistics conceptsformthebasisofeconometricformulationsandhelpsthem course onclassicaleconometrics.Thebookshowsstudentshowmathematical basics ofstatisticalinferenceinsupportasubsequent statistical toolsandeconometricapplications.Itcoversthe textbook developsstudents’theoreticalunderstandingof Avoiding acookbookapproachtoeconometrics,this University ofFlorida,Gainesville,USA Charles BMoss Applied Econometrics Mathematical Statisticsfor Textbook Suggested Price: April 2015,6-1/8x9-1/4,256pp. Print ISBN:978-1-4398-1190-0 Markowitz optimizationmethodology, assessmenttools. andperformance The book also coversthe asset selectionprocess, efficient portfoliosbuilding, asset pricesandexplainstheeconomicgroundsofstockportfoliooptimization. introduces thebasicnotionsoffinancesuchasmarkets,uncertainty, andrandom exercises toenforce understandingofconceptsandprinciples.Theauthor underlying portfolio management theory, followedbyexamplesandapplied to moneymanagement.Itpresentskeyconcepts shouldprecedemathematicswhenitcomes theory inportfoliomanagement,thistextexplainswhy theory Emphasizing theneedforknowledgeofmodernfinance Rouen SchoolofManagement,France Gatfaoui Hayette Management Introduction toStockPortfolio Textbook Suggested Price: May 2006,6-1/8x9-1/4,248pp. Print ISBN:978-1-58488-651-8 well asstudents. It remains an ideal reference for professional mathematicians and statisticians as chapter onmartingalesandselfsimilarityintheBrownianmotion. includes newandexpandedtopicssuchasDoob’s maximalinequalityinthe applications fromthefieldofmathematicalfinance.Thisneweditionalso Feynman-Kac formula,andanexpositionontheBlack-Scholesformulawith with expandeddiscussionofGirsanovtransformation,anintroductiontothe This secondedition features additional material on stochastic integration, this book provides access to important fundamentals of stochastic processes. Focusing onmathematicalideasratherthanproofs, Chapman &Hall/CRCProbabilitySeries University ofChicago,Illinois,USA F.Gregory Lawler Second Edition Stochastic Processes Introduction to Textbook $89.95 /£57.99 $79.95 /£49.99 $99.95 /£63.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Julien Guyon Nonlinear OptionPricing Suggested Price: August 2014,6-1/8x9-1/4,134pp. eBook ISBN:978-1-4665-7757-2 Print ISBN:978-1-4665-7756-5 sizes. Empiricaldataillustratestheapplicabilityofbothmethods. samplingwithdevicestomitigateunmanageableexpandingsample subsidiary explores how adaptive sampling is strengthened in information content through inaccessible entitiesthroughlinkedauxiliaries.Thetextalso how networksamplingisareliableguideincapturing sparsely locatedelementsinunknownpockets.Itshows advantages ofusingthemintandemtoeffectivelycapture sampling andadaptivesampling,thisbookillustratesthe Combining thetwostatisticaltechniquesofnetwork Indian StatisticalInstitute,Kolkata,India Arijit Chaudhuri Network andAdaptiveSampling Suggested Price: 2014,6-1/8 x9-1/4,551pp. January eBook ISBN:978-1-4822-2878-6 Print ISBN:978-1-4665-0225-3 filtering, andnumericalmethodsforinference. and smoothing, parametric and nonparametric inference, advanced particle parameters, andGLMs.Movingonto HMM models,thebookexaminesfiltering for Markov chains, useful inequalities, statistical techniques to infer model approaches. They discuss the main limit theorems well as several complementary functional autoregressive,ARCH,thresholdAR,anddiscretetimeseriesmodels as Markov chains,Poissonprocesses,andARMAmodels,theauthorscover time series analysis. After introducing stochastic processes, This textemphasizesnonlinearmodelsforacoursein Series: Chapman&Hall/CRCTexts inStatisticalScience Randal Douc,EricMoulines,andDavidStoffer with RExamples Theory, MethodsandApplications Nonlinear Time Series Textbook Suggested Price: December 2013,6-1/8x9-1/4,484pp. eBook ISBN:978-1-4665-7034-4 Print ISBN:978-1-4665-7033-7 intuition throughnumerousreal-worldexamplesofnumericalimplementation. helps quantsdevelopboththeiranalyticalandnumericalexpertise,building novel techniquesforpricingoptions,calibratingmodels,andmore.Thebook Scholes PDEsandcomparetheefficiencyofmanydifferentmethods,including Designed forpractitioners,itisthefirstauthoredbooktodiscussnonlinearBlack- dimensional nonlinearproblemsarisinginoptionpricing. compares variousnumericalmethodsforsolvinghigh- Written bytwoleadersinquantitativeresearch, thisbook Chapman andHall/CRCFinancialMathematicsSeries Société Générale,Paris,France Pierre Henry-Labordere Bloomberg LP, NewYork, NewYork, USA $79.95 /£49.99 $99.95 /£63.99 $83.95 /£53.99
35 Mathematics & Statistices for Finance Textbook Textbook Pricing in General Insurance Quantitative Equity Portfolio Pietro Parodi Management Swiss Re, London, UK Modern Techniques and Applications This book is based on the syllabus of the actuarial industry Edward E. Qian, Ronald H. Hua, course on general insurance pricing. It delivers a practical and Eric H. Sorensen introduction to all aspects of general insurance pricing, Chapman and Hall/CRC Financial Mathematics Series
Mathematics & Statistices for Finance covering data preparation, frequency analysis, severity analysis, Monte Carlo simulation for the calculation of This text reviews quantitative investment strategies aggregate losses, and burning cost analysis. Providing case studies, examples, and factors that are commonly used in practice, including value, momentum, exercises, and step-by-step methods, this text presents pricing as a formalised and quality, accompanied by their academic origins. It presents advanced process that starts with collecting information about a particular policyholder or techniques and applications in return forecasting models, risk management, risk and ends with a commercially informed rate. portfolio construction, and portfolio implementation that include examples Print ISBN: 978-1-4665-8144-9 such as optimal multi-factor models, contextual and nonlinear models, factor October 2014, 7 x 10, 584 pp. timing techniques, portfolio turnover control, Monte Carlo valuation of firm Suggested Price: $99.95 / £59.99 values, and optimal trading. In many cases, the book frames related problems in mathematical terms and illustrates the mathematical concepts and solutions with numerical and empirical examples. Print ISBN: 978-1-58488-558-0 eBook ISBN: 978-1-4200-1079-4 May 2007, 6-1/8 x 9-1/4, 464 pp. Suggested Price: $99.95 / £65.99
Principles of Copula Theory Textbook Fabrizio Durante and Carlo Sempi This book presents a much-needed synthesis of Quantitative Finance recent research on copulas, a statistical tool widely An Object-Oriented Approach in C++ used in applications in financial risk assessment and Erik Schlogl actuarial analysis. The text provides an overview of the University of Technology, Sydney, Australia mathematical properties of copulas with an emphasis Chapman and Hall/CRC Financial Mathematics Series on recent developments. It contains numerous examples using real data, especially from finance and insurance. This This text provides readers with a foundation in the key unique resource not only provides up-to-date information on this growing field, methods and models of quantitative finance. Through an but it also covers the multidimensional case. approach based on C++ classes and templates, the text highlights the basic principles common to various methods and models while Print ISBN: 978-1-4398-8442-3 the algorithmic implementation guides readers to a more thorough, hands-on May 2015, 6-1/8 x 9-1/4, 352 pp. understanding. It also presents recipes and extensible code building blocks for Suggested Price: $99.95 / £63.99 some of the most widespread methods in risk management and option pricing. C++ code and other materials are available on the author’s website. Print ISBN: 978-1-58488-479-8 36 eBook ISBN: 978-1-4200-1042-8 November 2013, 6-1/8 x 9-1/4, 354 pp. Suggested Price: $83.95 / £52.99
Textbook Textbook Probability, Statistics, and Quantitative Finance Reliability for Engineers A Simulation-Based Introduction and Scientists Using Excel Third Edition Matt Davison Bilal M. Ayyub and Richard H. McCuen University of Western Ontario, London, Canada University of Maryland, College Park, USA Accessible to students with a relatively modest level of The third edition of this bestselling text presents mathematical background, this book guides them in probability, statistics, reliability, and risk methods with an ideal balance of theory becoming successful quants. The text not only enables students to practice and applications. It places increased emphasis on simulation, particularly as a with the basic techniques of financial mathematics, but it also helps them gain modeling tool, applying it progressively with projects that continue in each significant intuition about what the techniques mean, how they work, and what chapter. This edition also features expanded discussions of the analysis of happens when they stop working. It uses both hand calculations and Excel variance and a thorough treatment of Monte Carlo simulation. The authors not spreadsheets to analyze plenty of examples from simple bond portfolios. The only clearly establish the limitations, advantages, and disadvantages of each spreadsheets are available on the book’s CRC Press web page. method, but also show that data analysis is a continuum rather than the isolated Print ISBN: 978-1-4398-7168-3 application of different methods. eBook ISBN: 978-1-4822-3782-5 Print ISBN: 978-1-4398-0951-8 May 2014, 6-1/8 x 9-1/4, 532 pp. eBook ISBN: 978-1-4398-0952-5 Suggested Price: $79.95 / £49.99 April 2011, 7 x 10, 663 pp. Suggested Price: $132.95 / £85.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: November 2012,7x10,524pp. eBook ISBN:978-1-4398-0911-2 Print ISBN:978-1-4398-0910-5 present theessentialalgorithmsinanappendix. probability andstatistics systems. Theauthorsintroduceallthenecessary covered includeprobabilitytables,continuousvariables,anddecision-support examples from the areas of operational risk, software risk, and reliability. Topics commercial software tool. The text includes real-life practical modelbuildingusingAgenaRisk,apowerful book focusesonapplicationsofBayesiannetworksand technologyforhandlingriskassessment.This powerful Bayesian networksarewidelyrecognizedasexcitingand UniversityofLondon,UK Queen Mary Norman FentonandMartinNeil Analysis withBayesianNetworks Risk AssessmentandDecision Suggested Price: March 2014,7x10,640 pp. eBook ISBN:978-1-4665-1826-1 Print ISBN:978-1-4665-1825-4 security applicationsareincorporatedthroughout. diverse 110 examples, numerous end-of-book references, andabibliography. over Plus, homeland figures, and tables 320+ problems, end-of-chapter updated techniques intoreal-worldsolutions,thebookincludesawealthofnewand and aggregationwithinariskframework.To helpreaderstranslatediscussed segregation risk finance, predictive risk management, and performance hurricane-prone regionsandcriticalinfrastructure,thesecondeditioncovers casestudies,suchasprotecting Containing contemporary and applicationsofriskanalysismanagement. This bookdescribesthefundamentalconcepts,methods, CollegePark,USA University ofMaryland, Bilal M.Ayyub Second Edition and Economics Risk AnalysisinEngineering Suggested Price: April 2013,6-1/8x9-1/4,357pp. eBook ISBN:978-1-4398-6719-8 Print ISBN:978-1-4398-6718-1 to financialmodelsandoptionpricingformulas. attractors. TheyalsodeveloptechniquesforimplementingRDSasapproximations differential/difference equationsintermsofstability, invariantmanifolds,and the asymptoticandqualitativebehaviorofsystemsrandomstochastic of RDS can describe numerous examples, the authors explain how the theory these models,andstudiesthestabilityoptimalcontrolofRDS.Through models, presentsnumerousoptionpricingformulasfor provides avarietyofRDSforapproximatingfinancial With extensiveend-of-chapterreferences,thisbook University ofPrinceEdwardIsland,Charlottetown,Canada Shafiqul Islam University ofCalgary, Alberta,Canada Anatoliy Swishchuk in Finance Random DynamicalSystems $87.95 /£44.99 $129.95 /£82.00 $104.95 /£65.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Soccermetrics Suggested Price: June 2013,6-1/8x9-1/4,523pp. eBook ISBN:978-1-4398-3595-1 Print ISBN:978-1-4398-3594-4 experiments, andconductinganalysis. Topics coveredincludedevelopingandvalidatingmodels,designingsimulation author walksyouthroughtheconcepts,models,andcomputationaltechniques. credit, operational,business,andstrategicrisk.Makingsimulationaccessible,the analysis canhelpyousolveproblemsofriskmanagementrelatedtomarket, tools. This book shows how simulation modeling and understanding ofsophisticatedquantitativeandanalytical combine training in traditional finance disciplines with an the needforanewgenerationofprofessionalswho The challengesofthefinancialenvironmenthaverevealed Rensselaer PolytechnicInstitute,Troy, NewYork, USA Aparna Gupta and Simulation Risk Management Suggested Price: April 2013,6-1/8x9-1/4,496pp. eBook ISBN:978-1-4398-5695-6 Print ISBN:978-1-4398-5694-9 models. Throughoutthetext,examplesusingMATLAB toimplementthe andpracticalstatisticaltoolsnecessary introduces powerful the most useful stochastic models used in financial engineering. Eachchapter guides currentandfuturepractitionersonimplementing to afewwell-knowncases.Thisself-containedbook models usedinthefieldareoftenoverlookedorrestricted statistical aspectsbehindtheimplementationofstochastic While manyfinancialengineeringbooksareavailable,the HEC Montreal,Quebec,Canada Bruno Remillard Financial Engineering Statistical Methodsfor Suggested Price: April 2015,6-1/8x9-1/4,226pp.,SoftCover Print ISBN:978-1-4398-8420-1 before thegameandduringseparately. teams. Inaddition,whenthebettingmarketisinplay, thebooktreatsbetting by thinkingaboutbettingoddsintermsoftheexpectednumbergoalsboth complex worldofsoccerbetting.Theauthorpresentsaninnovativeperspective addresses theprobabilisticintuitionneededinmore management. Itintroducesbettingingeneralandthen techniques of probability, statistics, finance, andportfolio and hedgingsoccerbettingcontractsusingthemodern This bookpresentsacomprehensivetreatmentofpricing Columbia University, NewYork, NewYork, USA Jan Vecer Science ofSoccerStatistics are availableontheauthor’s website. of thetechniquestosolvereal-worldfinancialproblems.MATLAB andRprograms $104.95 /£65.99 $89.95 /£57.99 $49.95 /£31.99
® illustrate the application illustratetheapplication 37 Mathematics & Statistices for Finance Statistical Methods with Stochastic Cauchy Problems Applications to Demography in Infinite Dimensions and Life Insurance Generalized and Regularized Solutions Estáte V. Khmaladze Irina V. Melnikova Victoria University of Wellington, New Zealand Institute of Mathematics and Computer Sciences, Ural Federal University, Yekaterinburg, Russia Suitable for statisticians, mathematicians, actuaries, and Alexei Filinkov students interested in the problems of insurance and University of Adelaide, Australia Mathematics & Statistices for Finance analysis of lifetimes, this book presents contemporary Series: Monographs and Research Notes in Mathematics statistical techniques for analyzing life distributions and life insurance problems. It mainly focuses on the analysis of an individual life and Accessible to non-specialists, this book provides a self-contained, complete describes statistical methods based on empirical and related processes. The text introduction to the modern theory of stochastic differential equations in infinite- not only contains traditional material but also incorporates new problems and dimensional spaces. It describes various approaches to solve abstract stochastic techniques not discussed in existing actuarial literature. Coverage ranges from Cauchy problems. The authors compare these approaches and illustrate them analyzing the tails of distributions of lifetimes to modeling population dynamics with numerous examples of applications in physics and financial mathematics, with migrations. including the mathematics of bond markets requiring the infinite-dimensional setting. Print ISBN: 978-1-4665-0573-5 eBook ISBN: 978-1-4665-0574-2 Print ISBN: 978-1-4822-1050-7 March 2013, 6-1/8 x 9-1/4, 242 pp. April 2015, 6-1/8 x 9-1/4, 300 pp. Suggested Price: $83.95 / £53.99 Suggested Price: $99.95 / £63.99
Statistical Studies of Income, Textbook Poverty and Inequality in Europe Stochastic Finance Computing and Graphics An Introduction with Market Examples in R using EU-SILC Nicolas Privault Nicholas T. Longford Nanyang Technological University, Singapore Chapman and Hall/CRC Financial Mathematics Series Series: Chapman & Hall/CRC Statistics in the Social and Behavioral Sciences This comprehensive text presents an introduction to This book shows how to use statistical computing in pricing and hedging in financial models, with an emphasis survey analysis. It presents a linked set of analyses of European Union statistics on on analytical and probabilistic methods. It demonstrates income and living conditions using the statistical environment R. The book covers both the power and limitations of mathematical models in finance. The book informative graphics and advanced analytical and programming skills for dealing starts with the basics of finance and stochastic calculus and builds up to special with large-scale databases. It also focuses on the application of complex methods topics, such as options, derivatives, and credit default and jump processes. Many to survey data, such as longitudinal analysis of continuous and categorical data, real examples illustrate the topics and classroom-tested exercises are included in mixture modeling, and small-area estimation. each chapter, with selected solutions at the back of the book. Print ISBN: 978-1-4665-6832-7 Print ISBN: 978-1-4665-9402-9 eBook ISBN: 978-1-4665-6833-4 eBook ISBN: 978-1-4665-9404-3 38 July 2014, 6-1/8 x 9-1/4, 375 pp. December 2013, 6-1/8 x 9-1/4, 441 pp. Suggested Price: $79.95 / £49.99 Suggested Price: $83.95 / £49.99
Textbook Textbook Statistics for Finance Stochastic Processes with Erik Lindström, Henrik Madsen, Applications to Finance and Jan Nygaard Nielsen Second Edition Series: Chapman & Hall/CRC Texts in Statistical Science Masaaki Kijima Bridging the gap between theoretical books on Tokyo Metropolitan University, Japan stochastic finance and applied books on financial Chapman and Hall/CRC Financial Mathematics Series engineering, this text provides an introduction to statistical methods for finance. Designed for This accessible text presents the mathematical theory mathematics and statistics students, the book discusses the role that statistics and of financial engineering using only basic mathematical tools that are easy to mathematics play in financial engineering. It covers the necessary mathematical understand even for those with little mathematical expertise. This second edition and statistics background and explores security markets, interest rate models, covers several important developments in the financial industry. Along with and term structure. Many data examples illustrate the methods and lots of many more examples, it includes a new chapter on the change of measures problems enable the book to be used as a course text or for self-study. and pricing of insurance products, a new section on the use of copulas, and two new chapters that offer more coverage of interest rate derivatives and credit Print ISBN: 978-1-4822-2899-1 derivatives. March 2015, 6-1/8 x 9-1/4, 320 pp. Suggested Price: $89.95 / £57.99 Print ISBN: 978-1-4398-8482-9 eBook ISBN: 978-1-4665-9283-4 April 2013, 6-1/8 x 9-1/4, 343 pp. Suggested Price: $94.95 / £59.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 and othermaterialareavailableontheauthors’websites. Suggested Price: May 2013,8-1/2x11,196pp.,Soft Cover Print ISBN:978-1-4200-8858-8 accounting. industries,and apracticalstep-by-stepguidefortransitioningtoLean service studies, andcompanystories.Italsoincludesspecialsectionsonhealthcare and businesses. Winner ofaShingoPrize,itincludeschecklists,exercises, case the needs ofLean-minded develop informationandfinancialreportsthatserve of the Lean mission. This step-by-step workbook demonstrates how to service accountants mustbeempoweredwithLeantoolsin When yourorganizationoptstogoLean,its Fullerton and Rosemary Gloria McVay, FrancesKennedy, Decision-Relevant Information Providing Simple,Practical,and Lean Enterprise Accounting inthe Suggested Price: May 2010,6-1/8x9-1/4,368pp. eBook ISBN:978-1-4200-9337-7 Print ISBN:978-1-4200-9336-0 impact ofthemodelsandmethods.Manydatasets,RMATLAB in numerousexamplesandcasestudiestoillustratetheflexibilitypractical of structuredtimeseries,theauthorspresentanalysesrealseriesdata dynamic models.Emphasizingmodel-based,computationallyintensiveanalysis such asdynamicgraphicalmodels,SMCmethods,andnonlinear/non-Gaussian methods. Italsodiscussesrecenttechniquesformodelingtimeseriesdata, including timeandspectraldomainunivariatemultivariateseries This textcoversthemajorareasofmoderntimeseriesmodelsandtheory, Series: Chapman&Hall/CRCTexts inStatisticalScience Duke University, Durham,NorthCarolina,USA Mike West University ofCalifornia,SantaCruz,USA Raquel Prado Modeling, Computation,andInference Time Series Textbook Suggested Price: April 2015,6-1/8x9-1/4,356pp. Print ISBN:978-1-4665-5646-1 pseudo-code, exercises, andsolutionstoselectedproblems. issues stemmingfromstochasticvolatilityprocesseswithjumps.Itincludes their careers.Thebookalsocoverscutting-edgemodelingandriskmanagement fundamentals of pricing theory, ideal for students and practitioners beginning pricing algorithmsandmodelsforderivativemarkets.Itdiscussesthe This bookpresentsathoroughtreatmentoftractable Chapman andHall/CRCFinancialMathematicsSeries Imperial College,London,UK Martijn Pistorius University ofWarwick, UK Aleksandar Mijatovic Implementation Models, Algorithmsand Stochastic Volatilty withJumps $46.95 /£29.99 $109.95 /£69.99 $79.95 /£49.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
® code, code, The LeanCFO Suggested Price: September 2013,7x10,181pp.,SoftCover eBook ISBN:978-1-4822-0357-8 Print ISBN:978-1-4822-0356-1 the value-creationpractice. and operate value management systems, and how to re-orient practitioners on document an organizational culture, how to prepare production systems to build firms duringthisnextcriticaldecade.Itsuppliesstep-by-setguidanceonhowto book providesanimplementationguideforaccounting an enormousintellectualandfinancialdrainonfirms.This accounting firmpartnerswillretire.Thisexodusput During thenextdecade,nearlyhalfofallpublic KDV, Ltd. Paul D.Fisher Succession inToday’s CPA Firms Solving theCrisisofGrowthand Beyond theDaysofGiants Suggested Price: March 2013,7x10,185pp.,SoftCover eBook ISBN:978-1-4665-7135-8 Print ISBN:978-1-4665-7134-1 the bookcanbeappliedtonewtechnologies andprocesses. that demonstrate howthemappingandmeasurementtechniquesdescribedin scales. Itincludescasestudiesfromarangeofoperationalandindustrialsettings mapping andmeasurementtechniquesatwidelydifferingspatialtemporal these criticalfewmapsintothishandbook.Thebookexplainsperformance that will work in most settings. As such, he’s gathered maps L. Harbourdiscoveredahandfulofperformance oftheirprocesses,Jerry and improvetheperformance clients acrossvariousindustriesunderstand,measure, During nearlyfourdecadesofexperiencehelping Vector Resources, Inc.,Trinidad, Colorado,USA L.Harbour Jerry and MeasurementHandbook Mapping The Performance Suggested Price: September 2013,6-1/8x9-1/4,151pp. eBook ISBN:978-1-4665-9941-3 Print ISBN:978-1-4665-9940-6 management systemwithaLeanbusinessstrategytodrivefinancialsuccess. measurementsystem.ItalsoexplainshowtointegrateaLean Lean performance measuresbasedontraditionalmanufacturingpracticesandintoa performance strategy. It describeswhy CFOs should move their companies away from management systemintotheoverallLeanbusiness the processofbuildingandintegratingaLean adopting aLeanbusinessstrategy, thisbookillustrates Explaining whytheCFOroleissocriticalforcompanies Brian MaskellAssociates,Inc. Nicholas S.Katko Lean ManagementSystem Architect ofthe $41.95 /£26.99 $41.95 /£26.99 $41.95 /£26.99
39 Mathematics & Statistices for Finance / Metrics & Finance Practical Lean Accounting Applying Guiding Principles of A Proven System for Measuring Effective Program Delivery and Managing the Lean Enterprise, Kerry R. Wills Second Edition Southington, Connecticut, USA Best Practices and Advances in Program Management Series Brian H. Maskell, Bruce Baggaley, and Larry Grasso While today’s programs continue to grow in size and The methods and concepts presented in the bestselling Metrics & Finance / Project Management complexity, their success rates remain low. To manage first edition revolutionized the approach to the programs effectively in this environment, project managers management and control of Lean companies. Enhanced and program managers must take a consultative approach with extensive end-of-chapter exercises and a CD-ROM with Lean accounting that applies a core set of guiding principles across every function of the program. tools, the second edition of this preeminent practitioner’s guide is now suitable This book explains what it means to take a consultative approach. Instead of for classroom use. This edition explains what it takes to transform a traditional focusing on specific program management techniques, it covers the guiding accounting system to one that supports and enhances a company’s Lean efforts. principles required to make those techniques effective—making it applicable to Defining the fundamental principles of Lean accounting, it demonstrates how to any program in any industry. use them to identify and eliminate wasteful transactions. Print ISBN: 978-1-4665-8789-2 Print ISBN: 978-1-4398-1716-2 eBook ISBN: 978-1-4665-8790-8 eBook ISBN: 978-1-4665-0622-0 July 2013, 6-1/8 x 9-1/4, 247 pp. August 2011, 7 x 10, 475 pp., Soft Cover Suggested Price: $71.95 / £45.99 Suggested Price: $68.95 / £43.99
Textbook The Art of Systems Architecting Agile for Project Managers Third Edition Denise Canty Mark W. Maier Best Practices and Advances in Program Management Series Aerospace Corporation, Chantilly, Virginia, USA Series: Systems Engineering This book outlines the agile project management methodology. It presents general agility concepts and Extensively revised to reflect the latest developments, does not apply to any one particular method; however the third edition of this bestselling text explains how to the focus of the book aligns with the Project Management create a system from scratch, presenting invention/design Institute’s (PMI) Agile Certified Practitioner (ACP). The rules together with clear explanations of how to use them. The author supplies book focuses on the project management component of practical guidelines for avoiding common systematic failures while implementing agility, concentrating on industry standards, certifications, and plain agile. This new mandates. He uses a heuristics-based approach that provides an organized book will assist the certified project manager with the transition to agile project attack on very ill-structured engineering problems. Examining architecture as management and will indirectly prepare readers with the basic knowledge more than a set of diagrams and documents, but as a set of decisions that either needed to pass the PMI-ACP exam. drive a system to success or doom it to failure, the book provides methods for integrating business strategy with technical architectural decision making. Print ISBN: 978-1-4822-4498-4 February 2015, 6-1/8 x 9-1/4, 232 pp. Print ISBN: 978-1-4200-7913-5 Suggested Price: $59.95 / £38.99 eBook ISBN: 978-1-4398-8758-5 40 January 2009, 6-1/8 x 9-1/4, 472 pp. Suggested Price: $125.95 / £79.99
Antipatterns Business Continuity Planning Managing Software Organizations A Project Management Approach and People, Second Edition Ralph L. Kliem Colin J. Neill, Philip A. Laplante, LeanPM, LLC, Redmond, Washington, USA and Joanna F. DeFranco Gregg D. Richie Applied Software Engineering Series P8, LLC, Orting, Washington, USA
Using real and hypothetical case studies, this book Earthquakes. Tsunamis. Pandemics. Firestorms. Hacker illustrates poor management approaches, unpleasant attacks. Not only do such events have socio-political work environments, and bad manager traits that lead impact but financial impacts, too, to firms of all sizes to failure. For each antipattern, the text describes the situation and symptoms, in all industries. Yet, the number of firms that do not prepare themselves is gives examples, and offers a refactoring solution. The authors provide real-world unbelievable. This book presents an integrated approach that firms can follow to anecdotes that illustrate key concepts. They also include thought-provoking become more resilient. The book provides diagrams, checklists, and other tools exercises that describe a situation and ask which antipatterns are present, as to help readers determine what they need to do for their firm to withstand or well as how to refactor the situation. Coverage includes leadership principles, recover from a serious event. environmental antipatterns, group patterns, management antipatterns, and Print ISBN: 978-1-4822-5178-4 team leadership. June 2015, 6-1/8 x 9-1/4, 224 pp. Print ISBN: 978-1-4398-6186-8 Suggested Price: $79.95 / £49.99 eBook ISBN: 978-1-4398-6216-2 December 2011, 6-1/8 x 9-1/4, 327 pp. Suggested Price: $83.95 / £51.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: July 2013,6-1/8x9-1/4,199pp. eBook ISBN:978-1-4665-7505-9 Print ISBN:978-1-4665-7504-2 outlined inthebook. book includescasestudiesthatillustrate the properimplementationofsteps challenge.The feellikeanoverwhelming to bringorderwhatcanotherwise based approachtoconstructionprogrammanagementthatleveragesstructure principles could boostconstructionprogramsuccessrates.Itoutlinesaprocess- implemented. Thisbookexploreshowanimprovedunderstandingofthese Standard forProgramManagementarestillnotwidely management principles, such as those contained in PMI®’s enterprises intheUnitedStates,widelyaccepted isoneofthelargest Although theconstructionindustry Best PracticesandAdvancesinProgramManagementSeries President andGeneralManager, CMSDelany Joseph Delaney Management Construction Program Suggested Price: September 2013,6-1/8x9-1/4,741pp. eBook ISBN:978-1-4665-6633-0 Print ISBN:978-1-4665-6631-6 business practicesintotheprojectmanagementenvironment. apply professionalpracticesinprojectmanagement,andtoadaptintegrate book helpsbothprojectmanagersandtheorganizationtounderstand management interestsintheorganization.ThePMOmodeldefinedthis bothprojectandbusiness multiple projectsasaprogram,orexpandedtoserve the PMO as a business integrator, whether that role is limited to managing inthiscapacity.project managementoffice(PMO)—toperform Italsopositions support. Itrecognizestheneedforacentralizedorganizationalentity—the management” intotherealmofprojectmanagementoversight,control,and the conceptsandconsiderationsof“modernproject Expanded andthoroughlyrevised,thisbookextends ESI InternationalProjectManagementSeries Principal, HillConsultingGroup,Woodbridge, Virginia, USA Gerard M.Hill Third Edition Management OfficeHandbook The CompleteProject Suggested Price: October 2013,6-1/8x9-1/4,320pp. eBook ISBN:978-1-4665-7776-3 Print ISBN:978-1-4665-7775-6 are notnecessarilyengineers. tool touseandwhenhoweffectivelyteachthetoolsemployeeswho includes aContinuousImprovementToolkit thatisaneasyreferenceforwhat management makethemethodologiesofLeanSixSigmawork.Thisbookalso competitive inthebusinessmarket.Thepropertools,communication,and change agent using tools thatmake sense while being improvements. Thisbookshowshowtobeaneffective methodologies arebeingusedandhowtosustainthe plan iscommunicatingwhyContinuousImprovement An importantstepthatisoftenmissedinanimprovement Industrial InnovationSeries Tina Agustiady Improvement Projects Communication forContinuous $83.95 /£53.99 $94.95 /£59.99 $94.95 /£59.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Design ofEnterpriseSystems Textbook Suggested Price: October 2013,6-1/8x9-1/4,320pp. eBook ISBN:978-1-4665-7693-3 Print ISBN:978-1-4665-7692-6 of Knowledge(PMBOK®). relate to the Project Management Institute’s (PMI®) Project Management Body the concepts presented. The book also indicates face. Eachchapterincludesachecklistandcasestudyontheapplicationof provides suggestionsforovercoming commonchallengesthatprojectmanagers for developingprojectmanagementdeliverables. It also common andnotsometoolstechniques five processes executed in a project, its relationshiptoprojectmanagement. Examiningthe This bookprovidesanin-depthdiscussionofcreativityand LeanPM, LLC,Redmond,Washington, USA Ralph L.Kliem Effective ProjectManagement Creative, Efficient,and Suggested Price: November 2003,235x155,340pp. eBook ISBN:978-0-203-91324-6 Print ISBN:978-0-8247-4808-1 objectives andmaximizingbusinessbenefits. both opportunities and threats if they are to assist in accomplishing project management specialist,thisguideemphasizes thatriskprocessesmustcover in yourbusinessandprojects.Written byanexperiencedconsultantandrisk capture opportunities,minimizethreats,anddealwithalltypesofuncertainty alongside threats.Itoffersvaluabletoolsandtechniquesthatexpose and expanding thetraditionalriskmanagementprocesstoaddressopportunities discusses themanagementofprojectopportunitiesby With step-by-stepguidelines,thisbestsellingreference Series: PMSolutionsResearch Risk Doctor&Partners,Petersfield,UK David Hillson Exploiting PositiveRisk Management forProjects Effective Opportunity Suggested Price: 2010,7x10,447pp. January eBook ISBN:978-1-4398-1824-4 Print ISBN:978-1-4398-1823-7 each chapter, and solutions for the 200 problems that are presented in the book. MS Word andExcel,abusinessprocessanalyzerinPowerPoint®slidesfor overall enterprisedesign.Theauthoralsoincludesprojecttemplatesin design eachviewandthendemonstrateshowtointegratethemarriveatthe process, information,andorganization.Thetextincludesmethodstoanalyze enterprise systemandpresentsanarchitecture thathasthreeviewsof book describesasystematicmethodologytodesignan toleadenterpriseengineeringprojects.The necessary courses, thisbookprovidestheknowledgeandskills Specifically writtenforgraduateandundergraduate Florida InternationalUniversity, Miami,USA Ronald E.Giachetti Theory, Architecture, andMethods $71.95 /£45.99 $209.95 /£134.00 $121.95 /£77.99
it discusses it discusses how the topics of discussion 41 Project Management Empowering Project Teams The Influential Project Manager Using Project Followership Winning Over Team Members to Improve Performance and Stakeholders Marco Sampietro Alfonso Bucero,MSc,PMP, PMI-RMP, PMI F Business School of Bocconi University, Milan, Italy BUCERO PM Consulting Tiziano Villa Best Practices and Advances in Program Management Series Project Management LAB All best practice recommendations and key success Examining the project environment from the perspective criteria point to the importance of developing soft skills of project team members, this book re-interprets project as a project manager, but few sources exist about how to management methodologies and behaviors using a bottom-up approach. develop the power of influence for achieving better project and business results. It explores the application of project followership in the key stages of project Filling this need, this book supplies readers with guidance on how to improve management and details the methods and techniques that all project team their influence skills to achieve better business results. It explains how to set and
Project Management members need to know. Outlining the behaviors team members should adopt meet ambitious goals for you, your team, and your stakeholders. It describes how for project success, the text considers project closure and transfer and explains to listen actively to influence people and how to build partnerships that can pay why this is an ideal time to evaluate if efforts invested have been rewarded. dividends for a lifetime. Print ISBN: 978-1-4822-1755-1 Print ISBN: 978-1-4665-9633-7 eBook ISBN: 978-1-4822-1756-8 eBook ISBN: 978-1-4665-9634-4 February 2014, 6-1/8 x 9-1/4, 300 pp. July 2014, 6-1/8 x 9-1/4, 219 pp., Soft Cover Suggested Price: $69.95 / £44.99 Suggested Price: $49.95 / £31.99
From Projects to Programs Textbook A Project Manager’s Journey Introduction to Samir Penkar Software Project Management FutureofProjectManagement.com Adolfo Villafiorita Best Practices and Advances in Program Management Series Bruno Kessler Foundation
This book tells the story of an up-and-coming project Providing the know-how to manage software projects manager that’s been handed a large program to lead. effectively, this book supplies an accessible introduction to Readers follow along as she struggles, leads, stumbles, software project management. It begins with an overview and grows into the program manager role. Introducing of the fundamental techniques of project management key program management concepts throughout, the book provides a backstage and the technical aspects of software development. The second part of the view into the workings of program management, program organization, team book illustrates the technical activities of software development in a coherent dynamics, and the skills required to manage programs. Told through the eyes process—describing how to customize this process to fit a wide range of software of a program manager, readers will experience the ins and outs of program development scenarios. The book examines open source development practices management. and tools so readers can adopt best practices and get started with tools that are Print ISBN: 978-1-4665-9181-3 available for free. eBook ISBN: 978-1-4665-9182-0 Print ISBN: 978-1-4665-5953-0 September 2013, 6-1/8 x 9-1/4, 157 pp., Soft Cover eBook ISBN: 978-1-4665-5955-4 42 Suggested Price: $49.95 / £31.99 February 2014, 6-1/8 x 9-1/4, 296 pp. Suggested Price: $89.95 / £57.99
Implementing Program Leading Virtual Project Teams Management Adapting Leadership Theories and Templates and Forms Aligned with the Communications Techniques to Standard for Program Management, 21st Century Organizations Third Edition (2013) and Margaret R. Lee Other Best Practices Best Practices and Advances in Program Management Series Ginger Levin and Allen R. Green Leading Virtual Project Teams addresses the challenges the virtual project management environment Based on PMI’s Standard for Program Management—Third poses to traditional methods of leadership and communication.It explores many Edition (2013) and other best practices, the updated edition of this bestselling facets of e-leadership–from traditional leadership theories to virtual project reference provides a program management methodology consisting of reports, communications.The book provides fresh approaches for adapting existing forms, templates, and documents. It includes identifiable documents referenced leadership theories to e-leadership as well as progressive tools to improve virtual in the latest Standard for Program Management as well as other helpful ones project communications. For educational institutions, this text can be used omitted from prior editions. The authors have updated the templates and forms to increase the body of knowledge for project management leadership and in this book to complement what is included in the Third Edition and to include communications outside the traditional project environment. what they feel are best practices for managing programs. Print ISBN: 978-1-4665-7688-9 Print ISBN: 978-1-4665-9771-6 eBook ISBN: 978-1-4665-7689-6 eBook ISBN: 978-1-4665-9774-7 July 2013, 6-1/8 x 9-1/4, 217 pp. June 2013, 6-1/8 x 9-1/4, 328 pp. Suggested Price: $69.95 / £44.99 Suggested Price: $83.95 / £53.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: September 2014,6-1/8x9-1/4,255 pp. eBook ISBN:978-1-4822-1272-3 Print ISBN:978-1-4822-1270-9 projectinvestment. and financialimplicationsthatareat the essenceofevery approach whereprogramsandprojects aremanagedforthecrucialeconomic application of various techniques and metrics to an incisive and integrated transform programandprojectmanagementfromthecurrenthaphazard ofexperience.Thesetechniqueshave thepotentialto than aquartercentury used. Thisbookprovidesinsightsandinnovativetechniquesdrawnfrommore are not being improve project selection and performance of projects,techniquesandmetricsthatcouldhugely Due toalackofappreciationthetrueeconomicidentity Industrial InnovationSeries Stephen A.Devaux Earned Value toBusinessValue as Investments Managing Projects Suggested Price: June 2014,6-1/8x9-1/4,167pp. eBook ISBN:978-1-4398-5144-9 Print ISBN:978-1-4398-5142-5 organizations. provides reallifeexamplesandcasestudiesfromavarietyofprofessionalservices tobedelivered,evaluationoftheresultswithclient.Thebook services that addresseachstepofthelifecycleanengagement-fromdefinition experience in the management field to layout procedures, tools, and techniques industry.the professionalservices Theauthorsdrawontheirmanyyearsof engagementsandlong-termssuccessin to manageprofessionalservice to achievetheinternaldisciplineandcontrolnecessary A step-by-stepguide,thisbookdescribesindetailhow Industrial andSystemsEngineeringSeries and StephenD.EganJr. M.Mundt,FrancisJ.Smith, Barry 9 RulesforSuccess Delivery Managing ProfessionalService Suggested Price: 2015,6-1/8x9-1/4,232pp. February Print ISBN:978-1-4822-0666-1 successful delivery. techniques formanagingexpectations andacquiringthesupportrequired and weaknessesofexistingprojectcontrolsoutlineseffectivecommunication maintain successfulrelationships with stakeholders.Ithighlightsthe strengths describes howtocraftappropriatecommunicationstrategiesdevelopand as thestartingpointfordecisionsonwhatworkneedstobedone.Thebook readers developanunderstandingofgovernanceanditsconnectiontostrategy and programoutcomes.Itpresentsguidelinestohelp managing factorsrequiredforachievingsuccessfulproject This bookprovidesaframeworkforunderstandingand Best PracticesandAdvancesinProgramManagementSeries,19 Stake holderManagementPtyLtd,Australia Lynda Bourne and Communication Effective StakeholderManagement Making ProjectsWork $89.95 /£57.99 $89.95 /£57.99 $69.95 /£44.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
and StudyGuide Challenge! and StudyGuide practice testsasmanytimesnecessary. practice testsareavailableinthebook andonlinesoreaderscanretakethe a bibliographicreferenceforfurtherstudy. Thetwochallenging,170-question features practicalstudyhints,alistof majortopicscoveredontheexam,and domains. The book incorporates the concepts from the five performance use format,thisisanidealresource forthosepreparingtotakethePgMPexam. It alsoexaminesallofthesubdomainslifecycledomain.With aneasy-to- Life Cycle,BenefitsManagement,StakeholderandGovernance. management domains:StrategicProgramManagement,Management readers honetheirknowledgeandtestskills.Itcoversallfiveoftheprogram proficiency ineachdomain. scoringalgorithmtohelpreadersdeterminetheirlevelof feature aproprietary and referencestothelateststandard.Thetwoaccompanyingonlinetests simulate thecertificationexamination.Italsoincludesanswerkeyswithrational Management, ThirdEdition.Itincludestwo170-questionpracticeteststhat this bookprovidescoveragethatiscurrentwithTheStandardforPortfolio prepare forandpassthePfMPcertificationexam, comprehensive resource availabletohelpreaders PgMP Suggested Price: June 2014,8-1/2x11,336pp.,SoftCover eBook ISBN:978-1-4822-5101-2 Print ISBN:978-1-4822-5100-5 Management Professional (PfMP launched anewcertificationentitledthePortfolio The ProjectManagementInstitute(PMI)recently Best PracticesandAdvancesinProgramManagementSeries Ginger Levin,PMP, PgMP PfMP Suggested Price: June 2013,8-1/2x 11,400pp.,SoftCover eBook ISBN:978-1-4822-0136-9 Print ISBN:978-1-4822-0135-2 the PgMP this isthemostcomprehensiveresource availabletohelppreparereadersfor Up todatewiththethirdeditionofPMI’s StandardforProgramManagement, SESI InternationalProjectManagementSeries ESI International,NewYork, NewYork, USA J. LeRoyWard Lighthouse Point,Florida,USA Project ManagementConsultant, Ginger Levin Fourth Edition PgMP Suggested Price: June 2013,8x5,544pp.,SoftCover eBook ISBN:978-1-4822-0209-0 Print ISBN:978-1-4822-0208-3 PgMP Up todatewiththethirdeditionofPMI’s ProgramManagementStandard, Management Series ESI InternationalProject New York, USA ESI International,NewYork, J. LeRoyWard, PMP, PgMP Lighthouse Point,Florida,USA Project ManagementConsultant, Ginger Levin,PMP, PgMP ® contains more than 300 practice questions to help ExamChallenge!containsmorethan300practicequestionstohelp ® ® ® ® ExamPracticeTests Exam.Updatedwithnewandchangedterminology, thisedition Exam Exam ExamPracticeTest $69.95 /£44.99 $69.95 /£44.99 $49.95 /£31.99
® ). The most ). Themost
The The 43 Project Management PMP® Exam Portfolio Management Challenge! A Strategic Approach Sixth Edition Edited by J. LeRoy Ward, PMP, PgMP Ginger Levin, PMP, PgMP ESI International, New York, Project Management Consultant, Lighthouse Point, New York, USA Florida, USA Ginger Levin, PMP, PgMP John Wyzalek, PfMP Project Management Consultant, Senior Acquisitions Editor, Taylor & Francis, Lighthouse Point, Florida, USA New York, New York, USA Series: ESI International Project Management Series Best Practices and Advances in Program Management Series
Preparing for and passing the PMP® exam is no small feat. Although the number Presenting information that is current with The Standard for Portfolio of certified PMP®s continues at a phenomenal rate, the exam failure rate remains Management, Third Edition (2013), this book supplies in-depth treatment of ® Project Management uncommonly high. PMP Exam Challenge! is designed to help you pass the the five domains and identifies best practices to ensure the organization has a exam by giving you an easy-to-use, highly portable publication, containing balanced portfolio that is critical to organizational success. This book is an ideal key relevant topics you are certain to encounter on your exam. Featuring 660 reference for those pursuing the new portfolio management credential from the ® practice questions, this sixth edition completely reflects the PMBOK® Guide, Fifth Project Management Institute (PMI ). It is also suitable as a reference guide for Edition and covers the guide’s ten knowledge areas. executives and practitioners in the field and as a textbook for universities offering courses on portfolio management. Print ISBN: 978-1-4665-9982-6 eBook ISBN: 978-1-4665-9987-1 Print ISBN: 978-1-4822-5104-3 June 2013, 8 x 5, 636 pp., Soft Cover October 2014, 7 x 10, 358 pp. Suggested Price: $49.95 / £31.99 Suggested Price: $69.95 / £44.99
PMP® Exam Practice Test Textbook and Study Guide Problem Solving for Engineers Ninth Edition David G. Carmichael University of New South Wales, Sydney, Australia J. LeRoy Ward, PMP, PgMP ESI International, New York, New York, USA This book takes a systematic approach to problem Ginger Levin definition, generation of alternative solutions, analysis, Project Management Consultant, and selection of the preferred solution. The book Lighthouse Point, Florida, USA introduces some fundamental terms needed to think ESI International Project Management Series systematically and undertake systematic problem solving. It covers both individual and group problem solving. Selection of the preferred PMP® Exam: Practice Test and Study Guide, Ninth Edition uses self-study to solution involves decision making, and fundamental concepts of decision making help readers increase their chances of passing the PMP certification exam the first are introduced, including decision making in the presence of multiple criteria time. This spiral-bound edition includes 40 multiple-choice practice questions in and uncertainty. The treatment embodies decision making for sustainability, with each of the ten knowledge areas and in the professional and social responsibilities its blend of economics, social and environmental considerations. It also identifies domain. It presents a 200-question practice test that simulates the actual PMP and embodies the specific problem solving of management and planning. exam, fully referenced answers keyed to the five project management process groups, and a study matrix to help readers key in on areas that require further Print ISBN: 978-1-4665-7061-0 study. eBook ISBN: 978-1-4665-7063-4 44 June 2013, 6-1/8 x 9-1/4, 439 pp., Soft Cover Print ISBN: 978-1-4822-0224-3 Suggested Price: $83.95 / £52.99 eBook ISBN: 978-1-4822-0225-0 June 2013, 6-1/8 x 9-1/4, 536 pp., Soft Cover Suggested Price: $69.95 / £44.99
The Portable PMP® Program Governance Exam Prep Muhammad Ehsan Khan Conversations on Passing the Best Practices and Advances in Program Management Series PMP® Exam, Fourth Edition Program Governance provides a thorough understanding of governance while reviewing the underlying theories of J. LeRoy Ward governance. One of the first books on the subject, it caters ESI International, New York, New York, USA to the needs of practitioners, researchers, and students of Carl L. Pritchard management and governance. The book supplies a holistic Pritchard Management Associates, Frederick, Maryland, USA view of program governance while covering multiple elements of program governance. Topics covered include the governance Completely updated to reflect the PMBOK® Guide–Fourth Edition, this three- structure, governance roles, governance functions, governance mechanisms, volume set of nine CDs addresses the nine areas of the PMBOK® Guide, as well factors influencing the governance framework, and different domains of as professional and social responsibility. To make listening easy, there are two programs that come under the jurisdiction of a governance framework. roughly 25-minute sessions for each knowledge area, plus a bonus session with Print ISBN: 978-1-4665-6890-7 test-taking tips. Ward and Pritchard’s approach is straightforward: to help readers eBook ISBN: 978-1-4665-6891-4 understand what’s important and what’s not to pass the PMP® exam. They have September 2014, 6-1/8 x 9-1/4, 220 pp. captured the critical issues of the exam and share those insights in an informative, Suggested Price: $69.95 / £44.99 engaging and sometimes humorous style. Print ISBN: 978-1-890367-53-4 December 2011, Audio CD Suggested Price: $115.95 / £73.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 practitioners cancustomizeanduseintheirprojects. several downloadabledocument,spreadsheet,andschedulingtemplates that critical successfactorpointsthroughnumerouscasestudies.Italsoprovides satisfaction, andincreasethelikelihoodofprojectsuccess.Thebookillustrates managers toreduceprojectrisk,improvestakeholder The findingsfromsuchassessmentscanhelpproject Suggested Price: October 2014,7x10,382pp. Print ISBN:978-1-4822-5282-8 factors based on PMI’s PMBOK project processes through a set of ten critical success This bookpresentsaninnovativeapproachforassessing Best PracticesandAdvancesinProgramManagementSeries Proactive RiskManagement Paul S.Royer, PMP Project HealthAssessment Suggested Price: December 2013,6-1/8x9-1/4,226pp. eBook ISBN:978-1-4665-7710-7 Print ISBN:978-1-4665-7709-1 team tomakesureyourremainsfocusedontherightthings. instill acompetitivespiritandcultureofcooperationmutualrespectinyour Teamdescribes howtobuildandmaintainaHighPerforming aswell howto bring disparatepeopletogethertoworktowardscommongoalsandvisions.It leaders areoftenforced to make.Next,itexaminesteamsandexplainshowto and traits—providinghelpfulinsightsonthetoughchoices management, this book examines various leadership styles Identifying criticalsuccessfactorsspecifictoprogram Best PracticesandAdvancesinProgramManagementSeries Mark C.Bojeun Creating SuccessfulTeam Dynamics Leadership Program Management Suggested Price: April 2015,6-1/8x9-1/4,224pp. Print ISBN:978-1-4822-0838-2 and external. succeed. Much moreimportantly, itprovidesinsightsastohowprogrammanagerscan helpful ideasandinsightsintowhyprogramsprogrammanagerscanfail. oftheentireprocessandincludes to successfulcompletion.Itoffersanoverview cycle oftheprogram—fromcustomer’s originalconcept art asitisscience.Thisbookilluminatestheentirelife Managing technicalprogramssuccessfullyisasmuch Best PracticesandAdvancesinProgramManagementSeries Northrop GrummanCorporation Charles ChristopherMcCarthy Environments Defense andHighTech Program Managementin The book also deals directly withidentifying scope creep—bothinternal $59.95 /£38.99 $69.95 /£44.99 $89.95 /£57.99 ® knowledge areas. Guideknowledge areas.
For more informationand acompletelistof titles,visitusat www.crcpress.com
Studies andLessonsLearned Project ManagementCase Suggested Price: March 2015,6-1/8x9-1/4,120pp.,SoftCover Print ISBN:978-1-4822-6212-4 never-ending streamofinspirationtoanorganization. setofquestionshaveproventodelivera proposals. Thissimple,butpowerful problems. Thisbookdescribesaprocessforturning“greatideas”intoactionable Today’s employeesareeducatedandabletoseeopportunitiesorsolutions often overlookthemostsignificantsource ofnewthought–theiremployees. customers. Intheirsearch forfreshideas,organizations ataratethatsatisfiestheir new productsandservices relevant in their marketplace. They fail to introduce typestruggletoremain Organizations ofevery Tryon andAssociates,BrokenArrow, Oklahoma,USA Charles A.Tryon, Jr. Improve Your Organization Capturing GreatIdeastoDramatically Project Identification Suggested Price: April 2011,6-1/8x9-1/4,283pp. eBook ISBN:978-1-4398-1954-8 Print ISBN:978-1-4398-1953-1 of healthcaresettings. hints, reviewquestions,andcasestudies, itillustratesapplicationsacrossa range project planning activities. Complete with chaptersummaries, exercises, helpful stakeholders to constructing aprojectplan,thetextcovers spectrum of plan, execute,andcontrolanyhealthcare-basedproject.Fromidentifying project processandprovidesthetoolstechniquesrequiredtosuccessfully ensure thehighestpossiblequalityofcare.Itdissects of projectmanagementtomaximizelimitedresources and This bookexplainshow toapplythetime-testedprinciples ESI InternationalProjectManagementSeries Literature Award Winner ofthe2011PMIDavidI.ClelandProjectManagement David Shirley for Healthcare Project Management Suggested Price: December 2014,6-1/8x9-1/4,224pp.,SoftCover Print ISBN:978-1-4987-0040-5 present challengesbasedonculturaldifferences. especially helpful to project managers whose teams are globally dispersed and to craftingsolutionsuniquechallengesinmanagingprojects.Thisbookis common projectproblems.Italsohelpsmanagerstogaininsightin schedules. Theaimofthebookistohelpprojectmanagerswithsolutions lessons learned on managing projectstakeholders, teams, resources, and management, thisbookisfilledwithcasestudiesand Based ontheauthor’s 35yearsofexperienceinproject Independent Consultant,SantaBarbara,California,USA M. KemalAtesmen Resource andTeam Management Stakeholder, Scope,Knowledge,Schedule, $49.95 /£31.99 $69.95 /£44.99 $59.95 /£38.99
45 Project Management Project Management for Project Management Research and Development Maturity Model Guiding Innovation for Third Edition Positive R&D Outcomes J. Kent Crawford Lory Mitchell Wingate Project Management Solutions, Inc., Glen Mills, Pennsylvania, USA Best Practices and Advances in Program Management Series Series: PM Solutions Research Many successful research and development (R&D) Project Management Maturity Model, Third Edition companies have already realized the benefits of applying provides a roadmap to help organizations move to higher project management processes for achieving better project results. The key is levels of organizational behavior. It covers the areas critical to organizational to apply proven project management principles in a way that enables R&D and improvement, such as the project management office, management oversight, innovation. This book explains how to apply project management to obtain and professional development. The book describes the Project Portfolio positive outcomes in R&D and innovation projects. Each chapter includes Project Management Management Maturity Model, which covers best practices for determining diagrams, surveys, checklists, and question-answer forms to guide readers in portfolio maturity, setting short-term priorities, improving portfolio management determining where their activity falls within a project spectrum, and to help them processes, and tracking progress. Chapters are based on the 10 knowledge areas structure their own R&D or innovation project. specified in PMI’s standard, PMBOK® Guide, Fifth Edition. Print ISBN: 978-1-4665-9629-0 Print ISBN: 978-1-4822-5544-7 eBook ISBN: 978-1-4665-9630-6 November 2014, 6-1/8 x 9-1/4, 247 pp. August 2014, 6-1/8 x 9-1/4, 517 pp. Suggested Price: $79.95 / £49.99 Suggested Price: $89.95 / £57.99
Project Management for the Oil and Gas Industry Textbook A World System Approach Project Management Theory Adedeji B. Badiru and Practice Air Force Institute of Technology, Dayton, Ohio, USA Samuel O. Osisanya Second Edition The University of Oklahoma, Norman, USA Gary L. Richardson Industrial Innovation Series University of Houston, Texas, USA
This book presents an integrated approach to project management for oil and Updated to reflect PMI’s Project Management Body of gas projects. It covers concepts, tools, and techniques of project management Knowledge (PMBOK® Guide), Fifth Edition, the second based on the elements of the Project Management Body of Knowledge. The edition of this bestselling text continues to provide a practical overview of project book also contains case examples of applications of project management tools management theory. It integrates the organizational environment that surrounds and techniques to real-life project scenarios. The book is intended to serve as a a project to supply the well-rounded knowledge of theories, organizational reference book for planners, project operators, stakeholders, designers, project issues, and human behavior needed to manage real-world projects effectively. managers, business managers, consultants, project analysts, senior executives, This edition contains a new chapter on Stakeholder Management, which is a new project team members, members of project management office, project knowledge area covered in the latest PMBOK® Guide. customers, functional managers, trainers, and researchers. Print ISBN: 978-1-4822-5495-2 46 Print ISBN: 978-1-4200-9425-1 October 2014, 7 x 10, 670 pp. eBook ISBN: 978-1-4200-9426-8 Suggested Price: $89.95 / £57.99 January 2013, 6-1/8 x 9-1/4, 781 pp. Suggested Price: $125.95 / £79.99
Project Management Textbook in Extreme Situations Project Management Tools and Techniques Lessons from Polar Expeditions, Miltary and Rescue Operations, A Practical Guide and Wilderness Explorations Deborah Sater Carstens, Gary L. Richardson, and Ronald B. Smith Edited by Monique Aubry and Pascal Lievre This book provides a practical understanding of the tools Best Practices and Advances in Program Management Series and techniques for planning and controlling projects. It emphasizes the difference between various tools and techniques and determines The growing complexity of projects and the uncertainty that reigns in today’s how these can be applied during different phases of the project lifecycle. This global economy are rendering ineffective traditional project practices and book presents not only an understanding of necessary project management processes. These outdated techniques are based on the premise that knowledge tools and techniques but also videos to demonstrate the concepts. If readers do about a project is complete before it ever starts—this is nearly impossible in not have the Microsoft Project software, they can still view the text and videos today’s ever-changing world. New methods are needed to allow projects to on the companion website known as the “Library” http://www.tech.uh.edu/ adapt to changing conditions. Simply said, project management has to evolve! projectnmotion/. This book presents the latest steps in this evolution. Print ISBN: 978-1-4665-1562-8 Print ISBN: 978-1-4822-0882-5 eBook ISBN: 978-1-4665-1566-6 May 2015, 6-1/8 x 9-1/4, 224 pp. April 2013, 6-1/8 x 9-1/4, 494 pp. Suggested Price: $69.95 / £44.99 Suggested Price: $119.95 / £76.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 published bytheProjectManagementInstitute. Suggested Price: 2015,6-1/8 x9-1/4,424pp. January Print ISBN:978-1-4822-5845-5 The bookhasbeenupdatedtoreflectthefiftheditionofPMBOK ofriskpractice. of currentinformation,whileremaininggroundedinthehistory topeerintothefuture.Italso viewsriskinlight apply “plannedclairvoyance” pragmatic perspective—withanewfocusontheabilityto edition emphasizesgreaterclarityonriskpracticefroma management tools,practices,andprotocols.Thisfifth is consideredacomprehensivereferenceofrisk Risk Management: Concepts and Guidance USA Pritchard ManagementAssociates,Frederick,Maryland, Carl L.Pritchard,PMP, PMI-RMP, EVP Concepts andGuidance,FifthEdition Risk Management Suggested Price: December 2014,6-1/8x9-1/4,360pp. Print ISBN:978-1-4822-5948-3 growing listofuserrequirements. also examinesmanaging project stakeholdersto minimize theriskof an ever elicit, document, and manage requirementsto control projectscope creep. It and poorproductquality, aswellkilltheproject.Thisbookexplainshowto requirements—can ruinaproject.Itcanresultincostoverruns,missedschedule, Scope creep—thecontinualadditionoffeaturesand Best PracticesandAdvancesinProgramManagementSeries Thinktank ConsultingInc.,Burnaby, Canada Jamal Moustafaev IT andEnterpriseProjects Engineering, Product,Construction, A PracticalGuidetoRequirementsfor Project ScopeManagement Suggested Price: November 2014,6-1/8x9-1/4,224pp. Print ISBN:978-1-4822-0552-7 negative impactonprojectsuccess. is requiredforprojectsuccessandthatshortchangingplanningwillhavea under-studied area ofknowledge to the forefront.It emphasizes that planning that analyzeddatafrommorethan1,300globalprojects.Thebookbringsthis of planningthatcoversmorethan270sources. Italsodiscussesnewresearch area ofprojectmanagementresearch. Thisbookdrawsonaliteraturereview project success,itremainsarelativelyunder-studied Although projectplanningisknowntobecritical Best PracticesandAdvancesinProgramManagementSeries Serrador ProjectManagement,Mississauga,Canada Pedro Serrador The 25%Solution and ProjectSuccess Project Planning $59.95 /£38.99 $69.95 /£44.99 $69.95 /£44.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
® Guide, Architecture inAction Software andSystems Suggested Price: May 2015,6-1/8x9-1/4,192pp. Print ISBN:978-1-4822-3313-1 the organization.Thebookconcludesbysummarizingkeypoints. discusses leadershipperceptions forthosethatdonothaveformalauthorityin or influencewillnotwork.Afterexplaininghowtogaininfluence,thebook take theindividualthoughprocessofshowingthatleadingwithoutauthority project managertodeliverinanorganizationwithoutauthority. Thisbookwill A wholenewplanofattackhastobeexecutedforthe project managementisthatthisnotalwaysthecase. authority overtheirteammembers.Thechallengein Almost allleadershipbooksassumetheleaderhas Best PracticesandAdvancesinProgramManagementSeries Konverge DigitalSolutionsCorp.,Mississauga,Canada Steve Tkalcevich Taking ChargeinMatrixOrganizations The Self-MadeProgramLeader Suggested Price: December 2008,6-1/8 x9-1/4,688pp. eBook ISBN:978-1-4398-3436-7 Print ISBN:978-1-4200-8073-5 development. relation betweenchangingbusiness strategies andchangestoapplicationsin metrics. Thebookalsoexaminesallaspects offunctionaltestingandlooksatthe on testingmetrics.Newchaptersaddress process,application,andorganizational sections ontesteffortestimationarefullyupdated,providinggreateremphasis helps anITorganizationmeetSarbanes-OxleyandBaselIIrequirements. The on thesuccessofpreviouseditions,textexplainshowcompliancetesting process, emphasizingtestingandqualitygoalsearlyonindevelopment.Building look atsoftware testing aspart of theproject management This thirdeditionof abestsellerprovidescomprehensive President andCEO,SmartwareTechnologies Inc.,Plano,Texas William E.Lewis Third Edition Improvement Continuous Quality Software Testing and Suggested Price: October 2014,6-1/8x9-1/4,232pp. Print ISBN:978-1-4398-4916-3 shape thearchitecture of a givensystem. tactics forqualityattributesthatinformthearchitect’s designchoicesandhelp goals ofthesystem.Thisapproachutilizesanalyticallyderivedpatternsand systemic qualityattributesdeterminedfromboththebusinessandtechnical engineering, itdetailsanapproachtoarchitecture designthatisdrivenfrom the synergies that exist between software and systems in whichsoftwareisamajorcomponent.Examining development ofarchitectures oflarge-scalesystems This bookexplorespracticesthatcanbehelpfulinthe Applied SoftwareEngineeringSeries Malvern, Pennsylvania,USA Raghvinder S.Sangwan $69.95 /£44.99 $99.95 /£63.99 $89.95 /£49.99
47 Project Management Stakeholder Engagement Successful Program The Game Changer Management for Program Management Complexity Theory, Communication, Amy Baugh and Leadership Best Practices and Advances in Program Management Series Wanda Curlee This book discusses the difference between the “science” Deloitte, Philadelphia, Pennsylvania, USA and the “art” of program management as it relates to Robert Lee Gordon setting and managing stakeholder expectations. It is American Public University System, Charlestown, loosely tied to the five domains of program management West Virginia, USA as established by PMI, with a heavy emphasis on program stakeholder Successful Program Management: Complexity Theory, Communication, engagement. The interdependencies between stakeholder engagement and and Leadership identifies the best leadership types for complex program the other domains are also highlighted. The book describes how to go about environments. It goes beyond what is currently available in program management Project Management enabling stakeholder engagement tactics to drive program success. It details standards to outline powerful solutions to the macro and micro program issues specific actions to be taken throughout the program life cycle and includes case facing program managers. Using language that is easy to understand, it explains studies. what it takes to communicate strategically to all parties involved and addresses Print ISBN: 978-1-4822-3067-3 the communication issues common to most programs, including stakeholder February 2015, 6-1/8 x 9-1/4, 216 pp. communication, project team communication, and shareholder communication. Suggested Price: $69.95 / £44.99 Print ISBN: 978-1-4665-6879-2 eBook ISBN: 978-1-4665-6880-8 October 2013, 6-1/8 x 9-1/4, 246 pp. Suggested Price: $71.95 / £45.99
The Strategic Project Leader Mastering Service-Based Project Sustainable Program Leadership, Second Edition Management Jack Ferraro Gregory T. Haugan This second edition of the Strategic Project Leader Best Practices and Advances in Program Management Series prepares project managers to develop leadership The world is undergoing major transitions due to competencies that translate into increased confidence changes in three driving forces—population, climate, and to lead in a demanding environment. Like the first energy resources—making it essential for us to achieve edition, this book motivates readers to take ownership of sustainability in the implementation of projects and their leadership agenda and become disciplined in the processes of building a programs as well as our everyday life. This book provides framework of leadership skills. This in turn will move readers beyond the basics essential information on the three major driving forces of the coming decades of project management to true project leadership, positioning themselves for and presents options to assist us in moving toward a sustainable future. It uses a greater leadership opportunities. format that makes it easy to understand and apply to medium and long-range Print ISBN: 978-1-4665-9977-2 planning. eBook ISBN: 978-1-4665-9978-9 Print ISBN: 978-1-4665-7516-5 48 September 2014, 6-1/8 x 9-1/4, 367 pp. eBook ISBN: 978-1-4665-7517-2 Suggested Price: $69.95 / £44.99 October 2013, 6-1/8 x 9-1/4, 384 pp. Suggested Price: $83.95 / £53.99
The Strategic Project Office Transforming Business with Second Edition Program Management J. Kent Crawford Integrating Strategy, People, Project Management Solutions, Inc., Glen Mills, Pennsylvania, USA Process, Technology, Structure, Series: PM Solutions Research and Measurement
The second edition of this award-winning reference Satish P. Subramanian provides step-by-step instructions for establishing and Best Practices and Advances in Program Management Series maturing a project management office (PMO). Concise In a fast evolving, flat world operating environment, and easy to read, the text covers the four primary areas of knowledge and enterprises need to constantly innovate and improve products and services to practice regarding the PMO: governance and portfolio management, resource maintain a strong competitive position in the market place. The vehicle used by optimization, organizational change, and performance measurement. Winner enterprises for such constant reinvention is a business transformation program. of the 2001 David I. Cleland Project Management Literature Award, the first A highly disciplined, rigorous and holistic program leadership and program edition introduced the concept of PMO as a strategic resource. This edition adds management practice is critical to make business transformation happen and reporting on cutting-edge research on the status and roles of today’s PMO, stick. This book enumerates the proven program management approach highlights best practices, and includes case studies of award-winning PMOs. and techniques enterprises need to adopt for driving successful business Print ISBN: 978-1-4398-3812-9 transformation program. eBook ISBN: 978-1-4398-3813-6 Print ISBN: 978-1-4665-9099-1 September 2010, 6-1/8 x 9-1/4, 394 pp. March 2015, 6-1/8 x 9-1/4, 216 pp. Suggested Price: $87.95 / £55.99 Suggested Price: $59.95 / £38.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2013,6-1/8x9-1/4,328pp. eBook ISBN:978-1-4665-5596-9 Print ISBN:978-1-4665-5595-2 tobillionsofconsumers. content, products,orservices devices’ desiresandpreferencesthatcanleadtothetriangulatedmarketing of software. Italsodiscussesthemonetizationofmobile mined data through the use of artificial intelligence data fromwebsitesandapps,itexplainshowtomodel social behavior. DescribinghowtoanalyzeWi-Fi andGPS machine-sensed environmental data pertaining to human Data MiningMobileDevicesdefinesthecollectionof Triangular Marketing,ElPaso,Texas, USA Jesus Mena Data MiningMobileDevices Suggested Price: April 2014,7x10,438pp. eBook ISBN:978-1-4822-0362-2 Print ISBN:978-1-4822-0360-8 and internationalco-developmenteffortsofnewproductsservices. addresses theroleofsocialnetworksininnovation,openinnovationstrategies, and incorporatethesefindingsintotheirnewproductdevelopmentprocess.It that canhelpfirmsidentifythevoiceofcustomer The bookemphasizesmarketingresearch techniques inaninternationalmarketplace. products andservices principles neededtosuccessfullydesignandlaunchnew This textbookteachesthekeybusinessandmarketing Rosanna Garcia New ProductsandServices Creating andMarketing Textbook Suggested Price: March 2015,7x10,152pp.,SoftCover Print ISBN:978-1-4987-0771-8 Blue Oceansandberecognizedasa‘ConsultativeSeller’. competition irrelevant.Thisbookdefinesanapproachonhowonecancreate while unlockingnewdemandandmakingthe value forthecompany, itsbuyers,andemployees, market space.Thesestrategicmovescreatealeapin but ratherbycreating“blueoceans”ofuncontested Companies cansucceednotbybattlingcompetitors, Venkatesh Upadrista a StepFurther Taking BlueOceanStrategy The ArtofConsultativeSelling $71.95 /£45.99 $99.95 /£63.99 $39.95 /£25.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Satellite Marketing Suggested Price: April 2015,7x10,250pp. Print ISBN:978-1-4822-5314-6 value andprocesseffectiveness. 3-dimensional measurementsystemthatlooksbeyondrevenuetoincludeclient usinga sales teamcollaboration,andmanageprocessperformance andcontinuousclientvalidation,improve sales proposalsusingstoryboarding qualify anddocumentaclient’s uniquebusinessproblemandgoal,develop the principlesofLean,itoutlinesproventechniquesto: delivering confirmedbusinessvaluetocustomers.Using based approachtoimprovingsalescloseratesand This bookprovidesreaderswithastructuredandfact- and SreekanthRamakrishnan Michael V. Testani, Sr., SeanA.Gillespie, Lean totheArtofSelling Bringing theScienceof Lean forSales Suggested Price: December 2011,6-1/8x9-1/4,542 pp. eBook ISBN:978-1-4398-6092-2 Print ISBN:978-1-4398-6091-5 accommodate bigdata,aswellthe smalldataimpliedwithin. simpleyetinsightfulquantitativetechniquesthatreliably practical yetpowerful, sectors,delivering non-regression modelers,anddataminers acrossallindustry Model. The book highlights the needs of data analysts, regression modelers, expanded explanationsoftheauthor’s ownpopularmachine-learningGenIQ scale analyses,this revised editionincorporates13newchapters, as well appropriate predictivepowerinordertoyieldreliable,robust,relevantlarge that effectivelyconsiderbigdataidentifyingstructures(variables)with the Focusing onuniquelylarge-scalestatisticalmodels DM STAT-1 Consulting,NewYork, NewYork, USA Bruce Ratner Second Edition Modeling andAnalysisofBigData, Techniques forBetterPredictive Data Mining Statistical andMachine-Learning Suggested Price: April 2015,7x10,200pp.,SoftCover Print ISBN:978-1-4822-5614-7 assess andmeasurethesuccessoftheirsatellitemarketingcampaigns. strategy, createeffectivesatellites,deployandmaintainthose to: identifyandtargetrelevantmarkets,developawell-plannedsocialmedia and integratingitwithconventionalmarketingtactics.Readerswilllearnhow providing readerswithacomprehensivestrategyforleveragingnewmedia surroundingsocialmedia, stations, orsatellites.Thisbookdispelsthemystery multiple socialmediasitesasaseriesofmarketingsub- Satellite marketingisastrategythatuses ideahaus, DelMar, California,USA Kevin Popovic Engagement Customer Participationand Using SocialMediaforImproving $49.95 /£31.99 $92.95 /£58.99 $39.95 /£25.99
49 Sales, Marketing & Service 21st Century Security and CPTED A Comprehensive Look at Designing for Critical Infrastructure Fraud Identification and Protection and Crime Prevention, Prevention Second Edition James R. Youngblood Randall I. Atlas Bellevue University, Nebraska, USA Atlas Safety and Security Design, Inc., Fort Lauderdale, Florida, USA Designed to educate individuals, loss prevention associates, businesses, and consultants on the Based on the tenets of Crime Prevention Through many faces of fraud in today’s technologically Environmental Design (CPTED), the updated edition advanced society, this book presents tips, advice, of this popular reference blends new design elements with the latest best- and recommendations for fraud awareness, protection, and prevention. It practice security measures. Illustrated with hundreds of photographs and line covers employee theft, organizational fraud, consumer fraud, identity theft, drawings, the text emphasizes consideration of security aspects throughout Ponzi and Pyramid schemes, and cyber crime/ fraud. It also examines how Security Management the design process, including how to take stock of open spaces, avoid blind some fraud typologies can overlap and co-mingle and the best ways to make corners, and use landscaping to create secure spaces. The author updates these an organization’s or individual’s financial assets a harder target for fraud and classic principles to include the latest design capabilities given new security victimization. and building construction technologies. This edition includes new chapters on security and sustainability. Print ISBN: 978-1-4987-0032-0 May 2015, 6-1/8 x 9-1/4, 288 pp. Print ISBN: 978-1-4398-8021-0 Suggested Price: $69.95 / £44.99 eBook ISBN: 978-1-4398-8022-7 June 2013, 7 x 10, 954 pp. Suggested Price: $119.95 / £79.99 Conflict and Cooperation in Cyberspace Active Shooter Events The Challenge to National Security and Response Edited by Panayotis A Yannakogeorgos John P. Blair, Terry Nichols, David Burns, US Air Force Research Institute and John R. Curnutt Adam B Lowther Written by members of the Advanced Law Enforcement US Air Force Research Institute, Maxwell AFB, Alabama, USA Rapid Response Training (ALERRT) Center at Texas State Conflict and Cooperation in Cyberspace brings together some of the world’s University, this book is the culmination of more than a most distinguished military leaders, scholars, cyber operators, and policymakers decade’s worth of training and research into active shooter in a discussion of current and future challenges that cyberspace poses. Focusing events. Empowering law enforcement professionals by on policy-relevant solutions, it offers a well-reasoned study of how to prepare for leveraging the essential knowledge and experience of those who have gone war, while attempting to keep the peace in the cyberspace domain. Examining before us, the book also offers insight into the training methodologies and the truths and myths behind recent headline-grabbing malicious cyber activity, strategies used to prepare our nation’s first responders to address the active the book spells out the challenges involved with establishing a robust system shooter threat. In addition, the authors discuss the clear and present threat of of monitoring, controls, and sanctions to ensure cooperation amongst all terrorist organizations using these mass shooter tactics on American soil. stakeholders. Print ISBN: 978-1-4665-1229-0 Print ISBN: 978-1-4665-9201-8 eBook ISBN: 978-1-4665-1231-3 50 eBook ISBN: 978-1-4665-9202-5 June 2013, 6-1/8 x 9-1/4, 264 pp. July 2013, 6-1/8 x 9-1/4, 360 pp. Suggested Price: $71.95 / £45.99 Suggested Price: $59.95 / £39.99
Antiterrorism and Corporate Security Intelligence Threat Response and Strategic Decision-Making Planning and Implementation Justin Crump Founder, Sibylline Ltd., Andover, UK Ross Johnson Capital Power Corporation, Edmonton, Alberta, Canada Despite a clear and compelling need for an intelligence- led approach to security, operational, and reputational Providing security managers with a clear and simple risks, the subject of corporate security intelligence methodology to protect their organizations, this volume remains poorly understood. An effective intelligence uses an adaptation of the U.S. Department of Defense’s process can directly support and positively impact antiterrorism fundamentals and applies it to the private sector to protect operational activity and associated decision-making and can even be used to companies, facilities, and infrastructures. The book helps security managers drive the firm’s business in key markets. This volume outlines theory and supplies conduct a terrorism threat vulnerability assessment, understand how surveillance real practical solutions to implementing an effective intelligence process. While detection works, establish response plans for a wide variety of contingencies the book focuses on corporate security as the natural home of intelligence, the related to terrorist attack, and work with other security departments, the police, tools and techniques outlined are equally applicable for any decision-support and the public to create infrastructure protection zones that will enhance the process. detection of suspicious events and reduce the likelihood of terrorist attack. Print ISBN: 978-1-4665-9270-4 Print ISBN: 978-1-4665-1290-0 January 2015, 6-1/8 x 9-1/4, 279 pp. eBook ISBN: 978-1-4665-1291-7 Suggested Price: $79.95 / £49.99 February 2013, 6-1/8 x 9-1/4, 296 pp. Suggested Price: $83.95 / £53.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2015,6-1/8 x9-1/4,240pp. January Print ISBN:978-1-4665-7337-6 Working Group,SmartGridprivacysubgroupsinceJune2009. utilities businesssector, alongwiththeirwork withNISTintheCyberSecurity writing onprivacyissues,drawupontheirextensiveexperiencewithin the Smart Grid.Theauthors,whoareprivacyprofessionalsinsteadofengineers and privacyframeworkcomponentsfocusedonthe supplies guidanceforprivacymanagementactivities privacy intotheirdailyworkactivities.Thebook and cybersecurityprofessionalsastheyworktobuild them communicatemoreeffectivelywithIT, telecom, them withtoomuchtechnicaldetail.Itwillhelp This bookwillinformreaderswithoutoverwhelming Rebecca HeroldandChristineHertzog Data PrivacyfortheSmartGrid Suggested Price: December 2011,6-1/8x9-1/4,203pp. eBook ISBN:978-1-4398-0198-7 Print ISBN:978-1-4398-0196-3 solutions canbeusedandwhereSCADApracticesarerequired. security requirementsdifferfromITtoICSandexplainswhenstandard driversandtheconflictingprioritiesofconvergence.Itexplainswhy regulatory Starting withanintroductiontoICS,itdiscussesbusiness,cost,competitive,and tools toensurenetworksecuritywithoutsacrificingefficiencyandfunctionality. implement an effective cybersecurity program for ICS, this book provides the toattack.Explaininghowdevelopand facing, theyexposecrucialservices As industrial control systems (ICS) become Internet- Madison, Alabama,USA Principal Consultant,KenexisConsultingCorporation, L.Singer Bryan Security LiaisonOfficer, BellCanada,Ottawa,Ontario Tyson Macaulay SCADA, DCS,PLC,HMI,andSIS Control Systems Cybersecurity forIndustrial Suggested Price: November 2013,7x10,418pp. eBook ISBN:978-1-4665-8834-9 Print ISBN:978-1-4665-8832-5 delivering real-worldsolutionstoterroristthreatsandactsathomeabroad. provide practitionerknowledgefromthefieldstraightintoreader’s hands, to crisis management,andresponderissues.Thebookgoesbeyondtheory weapons ofmassdestruction,intelligenceandantiterrorismefforts,terrorism protection, terrorismfunding,andtargetselectionisdiscussed,alongwith terror threatsandacts.Policyissues,criticalinfrastructure on howtopreparefor, mitigate,counter, andrespondto from premiertitlesintheCRCPresscollection,itfocuses the ultimatereaderonterrorism.With informationdrawn From CRCPress’s unrivaledpoolofauthorexpertscomes John JayCollegeofCriminalJustice,NewYork, USA Marie-Helen Maras The CRCPressTerrorism Reader Textbook $79.95 /£49.99 $87.95 /£55.99 $44.95 /£29.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
(Online Version) Encyclopedia ofInformationAssurance Suggested Price: August 2013,6x9,350pp. Print ISBN:978-1-4822-1567-0 controlling theeffectsofadisasteroncompany’s operations. preparedness. This reference highlights theimportance of preventionas well as influencesandemergency issues,regulatory disaster planningandrecovery latest informationondirtybombs,chemicalandbiologicalagentsweapons, private sector, andinformationonmanagingdataprivacy. Italsoincludesthe of computeranddataprotectionexpandedtoincludecyber-attacksonthe ofnaturaldisasters,coverage edition includesanoverview continuity. Updatedwiththelateststatistics,new complexities ofdisasterpreparednessandbusiness This neweditionofabestsellerbookaddressesthe Consultant, Lilburn,Georgia,USA Joseph F. Gustin Sixth Edition A GuideforFacilityManagers, Planning Disaster andRecovery Suggested Price: March 2011,6-1/8x9-1/4,345pp. eBook ISBN:978-1-4200-7830-5 Print ISBN:978-1-4200-7829-9 complexities ofFISMAcompliance. delineates theprocesses,practices,and principlesinvolvedinmanagingthe for establishingandoperatinganeffective securitycomplianceprogram.It programs atthreemajorfederalagencies, thebookprovidesworkablesolutions and maintainingenterpriseFISMA-basedinformationtechnologysecurity requirements. Based on the author’s experience developing, implementing, maintain compliancewithFederalInformationSecurityManagementAct(FISMA) technical monitoring, and remediation efforts to explain how to achieve and program, thisbookintegratescompliancereview, implementing acomprehensiveinformationsecurity Detailing aprovenapproachforestablishingand Commission, USA Chief InformationSecurityOfficer, NuclearRegulatory Patrick D.Howard Beyond Compliance and BestPractices FISMA Principles Suggested Price: December 2010,8-1/2x11,2000pp.,Online/Web Print ISBN:978-1-4200-6622-7 any topiccoveredintheencyclopedia. links arepresentthroughouttheonlineversion,enablingindepthresearch on privacy, compliance,auditing,anddigitalforensics.Live legalandregulatory meaningfultopicininformationassuranceincludingriskmanagement, every new methods,techniques,andstrategies.Theentriesillustrationsaddress within thefield.Thisthree-volumesetisatimely, reliableresource thatpresents collection of articles and references that cover the wide range of subjects found Encyclopedia ofInformationAssuranceisacomprehensive,fullysearchable confidentiality, integrity, availability, of an entity’s and delivery data. The Information Assurance(IA)professionalsarechargedwithprotectingthe Purdue University, West Lafayette,Indiana,USA Marcus K.Rogers Rebecca Herold,LLC,Van Meter, Iowa,USA Rebecca Herold Edited by $129.95 /£82.00 $79.95 /£53.99 $995.00 /£559.00
51 Security Management Foundations of Handbook of Surveillance Psychological Profiling Technologies Terrorism, Espionage, and Deception Third Edition Richard Bloom J.K. Petersen Embry-Riddle Aeronautical University, Prescott, Arizona, USA Computer Consultant, Writer and Educator, Bellingham, Washington, USA Designed for a diverse audience including law enforcement officers, intelligence and security officers, attorneys, and From officially sanctioned, high-tech operations to budget researchers, this volume presents scientific theory and spy cameras and cell phone video, the third edition data on the notion of profiles. The book integrates essential interdisciplinary of this bestselling handbook reflects the rapid growth knowledge related to the practice and applications of profiling that is rarely in the surveillance industry. An essential comprehensive work chronicling found in books on the subject. The book concludes with the author’s speculation the background and current applications of a broad range of surveillance on how developments in scientific method and statistical procedures—as well as technologies, this fully revised and expanded edition offers the latest in Security Management the integration of interdisciplinary sources, politics, and the cyberworld—may surveillance and privacy issues, including workplace and school privacy, front impact the future of profiling. yard privacy, and transportation security issues. It addresses social media, GPS circuits in cell phones and PDAs, new GIS system use, Google street-viewing Print ISBN: 978-1-4665-7029-0 technology, and other new and emerging developments. eBook ISBN: 978-1-4665-7032-0 February 2013, 6-1/8 x 9-1/4, 226 pp. Print ISBN: 978-1-4398-7315-1 Suggested Price: $71.95 / £45.99 eBook ISBN: 978-1-4398-7316-8 January 2012, 7 x 10, 1040 pp. Suggested Price: $146.95 / £99.00
Fraud Prevention and Detection Industrial Espionage Warning Signs and the Red Flag System Developing a Counterespionage Program Rodney T. Stamler, Hans J. Marschdorf, Daniel J. Benny and Mario Possamai Embry-Riddle Aeronautical University Worldwide, Harrisburg, Pennsylvania, USA Most fraud cases could have been prevented or detected earlier if early warning signs had been taken seriously. Books on industrial espionage tend to focus on what the This volume enables officers and directors to protect threat is and will often review case studies of threats— themselves and their entities against fraud by effectively but they generally fail to provide guidelines on how to detecting, analyzing, and acting before any damage establish a program to prevent and thwart such threats. A can be done. Based on an empirically tested strategy, the book teaches readers comprehensive source of information, this book offers guidance on how to ensure how to find Red Flag indicators of fraud or suspicious transactions in financial the protection of company proprietary information and the development of a statements, budgets, and contracts and know how to ensure that, once a Red corporate counterespionage program. It fully addresses all aspects of industrial Flag has been identified, appropriate action is taken. espionage that must be considered when developing a counterintelligence program. Print ISBN: 978-1-4665-5454-2 eBook ISBN: 978-1-4665-5455-9 Print ISBN: 978-1-4665-6814-3 March 2014, 6-1/8 x 9-1/4, 316 pp. eBook ISBN: 978-1-4665-6815-0 52 Suggested Price: $69.95 / £44.99 September 2013, 6-1/8 x 9-1/4, 232 pp. Suggested Price: $71.95 / £45.99
The Frugal CISO Information Security Using Innovation and Smart Approaches Management Handbook to Maximize Your Security Posture 2013 CD-ROM Edition Kerry Ann Anderson Edited by At the same time that information security organizations James S. Tiller face significant budgetary challenges, both cyber security Raleigh, North Carolina, USA threats and compliance requirements have escalated. Rich O’Hanley This book describes actionable techniques for running Publisher—ICT, Business, and Security, an information-security management program during an CRC Press, New York, New York, USA era that has been known for cost-cutting to information security budgets. The concept is to allow practitioners to acquire skills at fiscal proficiency in managing Containing the complete contents of Volumes 1-7, the Information Security information security issues, allowing them to deliver effective and efficient service Management Handbook, 2013 CD-ROM Edition is an authoritative resource while working within the restricted budgetary environment that exists at many that is linked and searchable by keyword. This CD updates the benchmark information-security organizations. Volume 1 with information on the latest developments in information security and recent changes to the (ISC)2® CISSP Common Body of Knowledge (CBK®). In Print ISBN: 978-1-4822-2007-0 addition to the complete contents of the set, the CD contains an extra volume›s eBook ISBN: 978-1-4822-2008-7 worth of information—including chapters from other security and networking May 2014, 6-1/8 x 9-1/4, 381 pp., Soft Cover books that have never appeared in the print editions. Suggested Price: $49.95 / £31.99 Print ISBN: 978-1-4665-6726-9 October 2013, CD-ROM Suggested Price: $209.95 / £134.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2012,6-1/8 x9-1/4,603pp. February eBook ISBN:978-1-4398-1482-6 Print ISBN:978-1-4398-1480-2 boxed visuals. EachchapterbeginswithKeyLearningPointsandissupplemented techniques andcasestudies,thebookincludesnewdiagrams,checklists, and crime andmisconduct.Revisedupdatedwithmore for the proper and safe investigation of workplace investigators withessentialinformationontheprocesses this volumeprovidesbothnoviceandexperienced Gleaned from the author’s decades of experience, Business Controls,Inc.,GreenwoodVillage, Colorado,USA Eugene F. Ferraro Second Edition Investigations intheWorkplace Suggested Price: November 2012,7x10,374pp. eBook ISBN:978-1-4665-6652-1 Print ISBN:978-1-4665-0003-7 and emergingthreatschallenges. text coverslaw and ethics,writing briefing fortheintelligencecommunity, covert operations—anddemonstrateshowtheseworktogether. Inaddition,the of Americanintelligencesystems—collection,analysis,counterintelligence,and intelligence andsecurity, presentingacomprehensiveexaminationofthepillars of National Intelligence.Thisbookexploresthehistory including theformationofOfficeDirector community hasundergoneanextensiveoverhaul, Since theattacksof9/11,UnitedStatesintelligence and MelissaGraves Carl J.Jensen,III,DavidH.McElreath, Intelligence Studies Introduction to Textbook Suggested Price: September 2008,7x10,416pp. eBook ISBN:978-1-4200-6157-4 Print ISBN:978-1-4200-6156-7 system, aswellasystemsdesigntoolonDVD. volume includesacomprehensivechecklistforthosedesigningnetworkvideo flexible system at lower cost. A completeand practicalreference for the field, this systemsprovidebetterimagequalityandamorescalable video surveillance systems.PioneeringexpertFredrikNilssonexplainshowIP-based surveillance developing, implementing,andmaintainingthelatest the firstcomplete reference for thoseinvolvedwith edge digitalfuture,IntelligentNetworkVideo provides Offering readyaccesstothesecurityindustry’s cutting- Axis CommunicationsInc.,Chelmsford,Massachusetts,USA Fredrik NilssonandCommunicationsAxis Systems Surveillance Understanding ModernVideo Intelligent NetworkVideo reports, adviceondigitalevidence,and more. andinvestigative ofcommoninvestigativeterms,samplesurveillance glossary Tips, Traps, and $87.95 /£55.99 $87.95 /£55.99 $99.95 /£63.99 An exhaustive appendix includes a Common Mistakes.Anexhaustiveappendixincludesa
For more informationand acompletelistof titles,visitusat www.crcpress.com
Transportation Security Logistics and Suggested Price: July 2014,6-1/8x9-1/4,389pp. eBook ISBN:978-1-4665-9087-8 Print ISBN:978-1-4665-9086-1 bestpractices. illustrate industry thebook includes case studies based on actual investigationsthat interviewing, insights garneredovertheauthor’s decadesofexperienceininvestigationsand will helpyoutosignificantlydiminishthelikelihoodoffalseconfessions.Sharing time-tested methodologyiseasytolearnandreplicate proven toachieveadmissionratesabove90percent. This approach, usesnointimidationorcoercion, andhasbeen and process-driventechniquethattakesanon-accusatory Itoutlinesahighlystructured investigative interviews. This bookcoversmoderntechniquesforprivatesector Eugene F. Ferraro(CPP, SPHR) Psychology, MethodandPractice Investigative Interviewing Suggested Price: December 2013,6-1/8x9-1/4,244 pp. eBook ISBN:978-1-4398-7910-8 Print ISBN:978-1-4398-7909-2 information, processes,andpeoplesecure whenoutsourcing IT services. provides the fundamental understanding and guidance readers need to keep to doandwhatnotacrossavarietyofimplementationscenarios.Thisbook concrete examplesandillustrativecasestudiesthatdescribethespecificsof what itprovides your organization.Coveringonshore,offshore,andcloudservices, authoritative guidanceandexamplesonhowtotailortherightriskapproach for you with an understanding of the fundamentals, it supplies from outsourcing oradoptingcloudtechnology. Providing This bookexplainshowtoaddresstherisksthatcanarise 1 SecuritySolutionsApplied,LLC,Leesburg,Virginia, USA Frank Siepmann Onshore, OffshoreandtheCloud in Outsourcing ITServices Managing RiskandSecurity Suggested Price: April 2015,6-1/8x9-1/4,288pp. Print ISBN:978-1-4822-5307-8 and innovationthroughtechnology. chain security, framework,strategicplanning, riskassessments,theregulatory material handling,securingtransportationnetworks,logisticsessentials,supply transportation systemsandlinkages,thisbookincludescoverageofhazardous developments notcoveredinexistingbooks.Examiningsea,land,andair transportation security addresses the many regulatory, political, and technological flow of goods, without compromising security. This new book on logistics and must ensuretheirsupplychainsandtransportationnetworksanefficient and thetraffickingofhumansnarcotics, companies In aworldincreasinglyexposedtoterrorism,piracy, Texas SouthernUniversity, Houston,USA Maria G.Burns Operational GuidetoResilience A Strategic,Tactical, and $79.95 /£49.99 $69.95 /£45.99 $69.95 /£44.99
53 Security Management Modern Geopolitics and Security Port Security Management Strategies for Unwinnable Conflicts Second Edition Amos N. Guiora Kenneth Christopher The University of Utah, Salt Lake City, USA Park University, Parkville, Missouri, USA
This book draws on the author’s extensive experience in This fully updated edition of a bestseller covers the latest counterterrorism, negotiation, and the implementation on continuously changing legislation regarding federal of the Oslo Peace Process, with his more recent work in mandates, securing vessels, cargo security, and granting academia. The book uses an interdisciplinary case study employee credentials. Focusing on best practices, it details model to illustrate valuable lessons learned and best real-world solutions that law enforcement authorities and practices in strategic analysis and decision making in geopolitics. It examines security management professionals can put to use immediately. Assuming little international relations, international law, and negotiation/intervention as they prior knowledge of the industry, the book examines port security in the context pertain to recent and historical examples of global crises and security. of global transportation systems. It supplies practitioners and educators with
Security Management a framework for managing port security and also details risk assessment and Print ISBN: 978-1-4665-6923-2 physical security best practices for securing ships and ports. eBook ISBN: 978-1-4665-6926-3 December 2013, 6 x 9, 181 pp. Print ISBN: 978-1-4665-9163-9 Suggested Price: $83.95 / £53.99 eBook ISBN: 978-1-4665-9164-6 June 2014, 7 x 10, 376 pp. Suggested Price: $89.95 / £57.99
Personal Security PRAGMATIC Security Metrics A Guide for International Travelers Applying Metametrics Tanya Spencer to Information Security Training Solutions, Copenhagen, Denmark W. Krag Brotby This practical, user-friendly guide prepares international Enterprise Security Architect, Thousand Oaks, California, USA business travelers for the realities they might face while Gary Hinson working or living abroad. Concise and easy-to-read, Hastings, New Zealand this manual will be a huge time-saver for corporations who want to educate their staff on safety and security Light on mathematics and heavy on utility, this is the awareness when travelling overseas. The author has experience traveling the ultimate how-to-do-it guide for security metrics. Packed world, including to some historical hot zones and areas of conflict. The text with time-saving tips, the book offers easy-to-follow guidance for those struggling provides general advice along with tips targeted at specific readers, including with security metrics. Step by step, it clearly explains how to specify, develop, special considerations for women, VIPs, and those who are traveling with use, and maintain an information security measurement system. In addition to children and families. its obvious utility in the information security realm, the PRAGMATIC approach, introduced for the first time in this book, has broader application across diverse Print ISBN: 978-1-4665-5944-8 fields of management eBook ISBN: 978-1-4665-5945-5 July 2013, 6-1/8 x 9-1/4, 376 pp., Soft Cover Print ISBN: 978-1-4398-8152-1 Suggested Price: $59.95 / £39.99 eBook ISBN: 978-1-4398-8153-8 54 January 2013, 6-1/8 x 9-1/4, 512 pp. Suggested Price: $69.95 / £45.99
Physical Security and Safety Responsive Security A Field Guide for the Practitioner Be Ready to Be Secure Edited by Meng-Chow Kang Truett A. Ricks, Bobby E. Ricks, and Jeffrey Dingle Exploring the challenges, issues, and dilemmas of Occupational Safety & Health Guide Series, 17 managing information security risk, this volume introduces This book addresses the need for security, how to identify an approach for addressing concerns from both a the threat against and level of security needed to protect practitioner and organizational management standpoint. assets, and security theories and concepts used to provide Utilizing a research study generated from nearly a an acceptable level of security. Security practices are decade of action research and real-time experience, the intermingled with safety issues. OSHA and Fire Regulations complement an book discusses the issues and dilemmas that fueled the study, examines its key overall loss prevention program. This text introduces the security practitioner findings, and provides practical methods for managing information security to basic tenets of safety and safety management. Safety practitioners will find risks. It presents the principles and methods of the responsive security approach, this book of value in understanding physical security theories, concerns, and developed from the findings of the study, and details the research that led to the practices development of the approach. Print ISBN: 978-1-4822-2702-4 Print ISBN: 978-1-4665-8430-3 October 2014, 6-1/8 x 9-1/4, 179 pp., Soft Cover eBook ISBN: 978-1-4665-8431-0 Suggested Price: $89.95 / £57.99 October 2013, 6-1/8 x 9-1/4, 259 pp., Soft Cover Suggested Price: $69.95 / £45.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: September 2013, 7 x10,439pp.,SoftCover eBook ISBN:978-1-4665-5460-3 Print ISBN:978-1-4665-5457-3 be mosteasilydisrupted. al-Qaeda, andpotentialpointsoffailure interroristoperationswhereplotscan climate post-ArabSpring,detailsonthe newestattacktacticsandproceduresof include thenewestgeopoliticalchallenges toemergefromthegeopolitical studies andinformationonemerging terroristpracticesandtrends.Updates of prior editions with newcase edition contains the detailed analysis and history planning, financing,andoperationaltactics.Thisfullyrevisedupdated third terrorist methodology—revealingmotivation,organizationalstructure, only booksavailabletoprovidedetailedinformationon First publishedin2003,thisvolumeremainsoneofthe Terrorism andRadical-Ideologies, Hudson,NewYork, USA Executive Director, StottvilleCenterforUnderstanding Malcolm W. Nance Third Edition and IdentifyingTerrorist Activities, A Practitioner’s ManualforPredicting Terrorist RecognitionHandbook Suggested Price: May 2014,6-1/8x9-1/4,355pp. eBook ISBN:978-1-4665-9215-5 Print ISBN:978-1-4665-9214-8 integrity, and authentication. approach informationsecurityfromthebedrockprinciplesofconfidentiality, developing dozensofstandards,itprovidesanunderstandinghowto takes atop-downapproach.Providinginsightfromtheauthor’s experience basics. Ratherthanfocusingoncomplianceorpoliciesandprocedures,thisbook complex, novices and professionals need a reliable reference that outlines the is the third keystone.Asthe field hasbecome more availability; however theauthorassertsauthentication three cornerstones:confidentiality, integrity, and The traditionalviewofinformationsecurityincludes Arlington, Texas, USA J.J. Stapleton Authentication, andIntegrity A GuidetoConfidentiality, Security withoutObscurity Suggested Price: December 2013,6-1/8x9-1/4,202pp. eBook ISBN:978-1-4665-6178-6 Print ISBN:978-1-4665-6177-9 providing moreeffectivesecuritymanagement. functions by using a critical thinking approach to interpret data as a tool for organization. The book presents the most accurately balanced picture of security functions sotheycanbettertailorsecuritytoany a methodical process to look at the security management who wouldliketobecomesecuritymanagers.Itprovides to beamoreeffectivemanager, aswellforstudents This bookiswrittenforthesecuritymanagerwhowants Occupational Safety&HealthGuideSeries Michael Land,Truett Ricks,andBobbyRicks A CriticalThinkingApproach Security Management $59.95 /£39.99 $79.95 /£49.99 $94.95 /£59.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Suggested Price: April 2013,6-1/8x9-1/4,351pp. eBook ISBN:978-1-4665-5762-8 Print ISBN:978-1-4665-5761-1 criminal nexus. a thought-provokingnewlookatthecomplexityandphenomenaofterrorist- definitively thatsuchliaisonsexistdespitedifferingideologies,thebookprovides misunderstood, ordownplayednexusthreattotheUnitedStates.Proving new evidenceofthisgrowingthreat,volumerevealstheoftendisregarded, security strategists,lawenforcement andintelligenceagents,studentswith and threateningusinnewprovocativeways.Providingpolicymakers, well asdomesticgroupssuchtheSovereignCitizens—arenowjoiningforces FARC, drug cartels, and increasingly violent gangs—as Intelligence hasdiscoveredthatalQaeda,Hezbollah, Arlington, Virginia, USA Retired Colonel,USAF, SeniorAnalyst,TheMASYGroupe, Jennifer L.Hesterman and Terror Groups Drug Cartels,OrganizedCrime, An AllianceofInternational The Terrorist-Criminal Nexus Suggested Price: December 2013,7x10,320pp. eBook ISBN:978-1-4398-9939-7 Print ISBN:978-1-4398-9938-0 can practicetoprotectinformationandassets,bothathomeabroad. concludes byoutliningspecificmeasuresthatcorporationsandtheiremployees property, or whether it is stealing such property for its own use. The text prosper orsuffer, dependingonwhetherthat nationisprotectingitsintellectual an understandingofhowtheeconomyanationcan taken forChina’s growth and development. focusing onthemassscaleinwhichinformationisbeing practiced byarangeofnationsfromaroundtheworld— ofeconomicespionageas This bookprovidesanoverview Richmond, Virginia, USA Carl Roper Espionage, andtheChinaThreat Trade SecretTheft,Industrial Suggested Price: May 2011,6-1/8x9-1/4,495pp. eBook ISBN:978-1-4398-2149-7 Print ISBN:978-1-4398-2148-0 field. known tips,tricks,andtechniquesusedbysavvysecurityprofessionalsinthe agencies, includingtheCIA,NSA,andNATO, DouglasLandollunveilsthelittle- confidence. Trusted toassesssecurityforleadingorganizations andgovernment and reviewthescoperigorofriskassessmentproposalswithcompetence mitigation, andriskassessmentreporting,itprovidesthetoolsneededtosolicit assessment. Supplyingwide-rangingcoveragethatincludessecurityriskanalysis, second edition explains how to conduct an effective risk Picking upwherethebestsellingfirsteditionleftoff,this Lantego, LLC,Austin,Texas, USA Douglas Landoll Security RiskAssessments,SecondEdition A CompleteGuideforPerforming Handbook The SecurityRiskAssessment $69.95 /£45.99 $71.95 /£45.99 $87.95 /£55.99
It supplies Itsupplies
55 Security Management Web Security Andy & Me A WhiteHat Perspective Second Edition, Crisis & Transformation Security Management / Finance & Investing Lean Basics Hanqing Wu and Liz Zhao on the Lean Journey Academy of Mathematics and Systems Science, Pascal Dennis Chinese Academy of Sciences Lean Productivity Network This book presents a comprehensive guide to web security Based on the author’s personal experience with Toyota’s and explains how companies can build a highly effective master teachers and with companies in the midst of great and sustainable security system. It reveals how hackers change, Andy & Me is a business novel set in a failing work and explains why companies of different scale New Jersey auto plant focusing on the tribulations of Tom require different security methodologies. With in-depth analysis of the reasons Pappas, the plant manager. In a cool, readable style, Andy & Me follows Tom’s behind the choices, the book covers client script security, server applications relationship with Andy Saito, a reclusive Toyota guru whom Tom persuades to security, and Internet company security operations. It also includes coverage help save his plant through the teaching of the legendary Toyota Production of browser security, click jacking, injection attacks, web frame security, leaks, System (TPS). On this journey, the reader learns that TPS is more than just a transactions security, and security development lifecycle. collection of tools; it entails a new way of thinking and behaving. Print ISBN: 978-1-4665-9261-2 Print ISBN: 978-1-4398-2538-9 March 2015, 7 x 10, 544 pp., Soft Cover eBook ISBN: 978-1-4398-2540-2 Suggested Price: $79.95 / £49.99 December 2010, 5 1/4 x 8, 192 pp., Soft Cover Suggested Price: $37.95 / £23.99
Workplace Violence and The Basics of Achieving the Facility Manager Professional Certification Joseph F. Gustin Enhancing Your Credentials Consultant, Lilburn, Georgia, USA Willis H. Thomas This book contains practical, comprehensive, and effective Associate Director of Learning Management, guidance and advice on the issue of workplace violence. Pfizer/Wyeth Research, Montvale, New Jersey, USA It is written in plain language and in a non-theoretical, This easy-to-use guide can help anyone looking to achieve reader-friendly format for quick and easy reference. Topics professional certification make informed decisions about include the risk factors that contribute to workplace the many options available. It can also help avoid the violence, as well as the effects of violence. The book discusses procedures for pitfalls of making the wrong choice as a result of being incorrectly informed. assessing threat as well as strategies for preventing violence and handling the Examining the range of professional certifications offered by associations and consequences when necessary. It also examines situations such as domestic organizations, it explains how to select the right professional certification and violence and the workplace and racial and sexual harassment and explains the outlines best practices for completing the certification process. It includes a CD new OSHA directive on investigation workplace violence. that supplies permanent access to a suite of helpful training and development Print ISBN: 978-0-8493-8143-0 tools and software. May 2013, 6 x 9, 200 pp. Print ISBN: 978-1-4665-5456-6 Suggested Price: $99.95 / £63.99 eBook ISBN: 978-1-4665-5463-4 56 November 2013, 6-1/8 x 9-1/4, 216 pp., Soft Cover Suggested Price: $20.95 / £12.99
Strategic Finance for Identifying Waste Criminal Justice Organizations on the Shopfloor Daniel Adrian Doss, William H. Sumrall III, The Productivity Press Development Team and Don W. Jones Like all Shopfloor Series books, Identifying Waste on Capital investments of cash flow provide future benefits to the Shopfloorpresents concepts and tools in simple and all organizations. This volume explores capital budgeting accessible language. The author defines waste, explains techniques from a quantitative perspective that targets why it occurs, and then shows how to discover, remove, the strategic future of revenues within the criminal justice and prevent it with regards to the actions of people, the and law enforcement sectors. The book discusses human use of equipment and material, and the movement of decision-making, impediments to rendering objective decisions, and methods goods. He identifies and provides specific strategies geared towards countering for improving decision objectivity. It reviews the concept of discounting and the Seven Deadly Wastes: overproduction, inventory, conveyance, defects, decision rules for net present value, and explains how to make an internal rate processing waste, operation waste, idle time. This volume is the ideal compliment of return financial decision. It also provides the mathematical formula for the to 5S, TPM, and other tools for building a lean manufacturing operation. profitability ratio/index method and examines how to use it to make financial Print ISBN: 978-1-56327-287-5 decisions. June 2003, 7 x 10, 112 pp., Soft Cover Print ISBN: 978-1-4398-9223-7 Suggested Price: $37.95 / £23.99 eBook ISBN: 978-1-4398-9225-1 April 2012, 6-1/8 x 9-1/4, 292 pp., Soft Cover Suggested Price: $109.95 / £69.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2015,6-1/8x9-1/4,100pp.,Soft Cover Print ISBN:978-1-4665-6363-6 convey theknowledgeeffectively. Standardized Work. Numerous examples, charts and drawings are used to shows andillustratestherighttools therightprocesstotrainandsustain auditing shouldbeconductedinacertain waywithcertaintools.Thisbook common. In order to be successful training and training and auditingis very Standardized Work forms.UnfortunatelyStandardizedWork withouteffective allows to“check”thatoperatorsareactuallydoingtheworkasdefinedin the Work isapurewasteifitdoesnotincludeoperatortrainingandauditingthat auditing. The whole processof deploying Standardized Standardized Work, focusesonoperatortrainingand This book,whichisthefifthofseriesdedicatedto Alain Patchong Sustaining StandardizedWork Training Operatorsand Standardized Work Implementing Suggested Price: May 2013,6-1/8x9-1/4,111pp.,SoftCover eBook ISBN:978-1-4665-6355-1 Print ISBN:978-1-4665-6354-4 interaction betweenoperator, machine,andmaterial. waste. TheItusesnumerousexamples,charts,anddrawingstoillustratethe assessment—writing StandardizedWork formstohelpidentifyvariabilityand Thissecondbookintheseriesfocusesonnextstepofthis performance. plant’s situationthroughmeasurementofoperators’ plant manager in an industrial group, took to assess his the initial steps that Thomas, a young, high-potential The firstbookinOne-DayExpertseriesdetailed Alain Patchong Writing StandardizedWork Forms Standardized Work Implementing Suggested Price: June 2015,6-1/8x9-1/4,100pp.,SoftCover Print ISBN:978-1-4665-6343-8 deployment ofprocessanalysisandtoconveytheknowledgeeffectively. there. Thisbookusesnumerousexamples,chartsanddrawingstoexplainthe target pictureoftheprocessconditionandprioritizeneededactionstoget for improvementtheiramountandsource. Itisthereforepossibletoestablishthe production capacity of the process, shows all opportunities helps collectthe“factsanddata”thatgivesoverall initial situationbeforeanyimprovement.Processanalysis Process analysisisthefirsttoolneededtocapture Alain Patchong Process Analysis Standardized Work Implementing $19.95 /£13.99 $20.95 /£13.99 $19.95 /£13.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
The LeanAnthology Suggested Price: April 2014,6-1/8x9-1/4,101pp.,SoftCover eBook ISBN:978-1-4665-6359-9 Print ISBN:978-1-4665-6358-2 illustrations thatdemonstrateproperapplication. format,thebookincludesnumerousexamplesand using acompellingstory sustain motivationduringtheworkahead.Coveringessentialknowledge that canhelpreadersgeneratequickimprovementstokeepmoralehighand opportunities for process improvement. It also provides simple tools and forms The textexplainshowtouseStandardizedWork formstoidentifyimmediate both depend on each other to achieve true sustainability. explaining why standardization and process improvement Work, focusesonprocessimprovement.Itbeginsby This book,thethirdinaseriesdedicatedtoStandardized Alain Patchong Process Improvement Standardized Work Implementing Suggested Price: March 2007,7x10,192pp.,SoftCover Print ISBN:978-1-56327-356-8 Why method. Planning andExecutionTree diagram,andProblemSolvingbywayoftheFive Process; ProductionPhysicsandLittle’s Law;Value StreamThinking;theHoshin This edition isupdatedwithexpandedinformation ontheLeanImprovement that supportinvolvement,includingKaizencircles andsuggestionsystems. discusses practicalproblemsolvingforLeanproduction,anddetailsactivities manufacturing system, looks at the origins and underlying principles of Lean, view ofLeanmanufacturing.ItprovidesacomprehensiveToyota’s Lean Manufacturing Research, thisbookdeliversa practitioner’s A 2006ShingoPrizeWinner forExcellenceIn Lean ProductivityNetwork Pascal Dennis ProductionSystem Most Powerful A Plain-LanguageGuidetotheWorld’s Second Edition, Lean ProductionSimplified Suggested Price: November 2014,6-1/8x9-1/4,248pp.,SoftCover Print ISBN:978-1-4822-4679-7 opportunities involvedwithaLeanjourney. This collectionoffersarelevantandinterestingapproachtothechallenges Five Cs:Customer, Capability, Control,Coordination,andContext/Culture. organized into a framework for implementinga Lean transformation called The different approachtothestrategiceliminationofwaste.Thecasestudiesare journey. EachLeancasestudyhelpsthereadertounderstandandapplya scenariosforaLeanprocessimprovement case studiesthatillustrateeveryday This book features a series of operations management Charlottesville, USA University ofVirginia, DardenSchoolofBusiness, Elliott N.Weiss Goldberg Productions,Inc.,Richmond,Virginia. USA Rebecca Goldberg Continual Improvement A PracticalPrimerin $19.95 /£13.99 $47.95 /£29.99 $29.95 /£18.99
57 Lean Basics Popular Manufacturing Myths Standard Work for the Shopfloor Eliminating Widely Held Beliefs Productivity Press Development Team That Reduce Competitiveness Standard work is an agreed upon set of work procedures Douglas B. Relyea that effectively combines people, materials, and machines Quality Principle Associates, Norwich, Connecticut, USA to maintain quality, efficiency, safety, and predictability. Work is described in terms of cycle time, work in process, This book presents a number of case studies that examine sequence, layout, and the inventory needed to conduct widely held beliefs in the manufacturing industry that the activity. Standard work begins as an improvement have been proven to be groundless. Addressing these baseline and evolves into a reliable method. It establishes beliefs and attitudes that can actually be detrimental to the best activities and sequence to maximize performance and minimize waste. competitiveness, it uses real-world examples to outline simple solutions in each This volume discusses the characteristics, applications, and benefits of standards. case. Dispelling the myth in question, each chapter supplies specific examples It covers standard work concepts, calculations, and documentation, as well as the that readers can easily relate to. Among the myths dispelled are that increasing use of standard work manuals, charts, and worksheets. line speed always reduces quality and increases scrap; and that reducing the cost of raw materials will reduce the cost of manufacturing. Print ISBN: 978-1-56327-273-8 July 2002, 7 x 10, 112 pp., Soft Cover Print ISBN: 978-1-4665-6660-6
Lean Basics Suggested Price: $37.95 / £23.99 eBook ISBN: 978-1-4665-6689-7 April 2013, 6-1/8 x 9-1/4, 135 pp. Suggested Price: $41.95 / £26.99
Root Cause Analysis A Study of the Toyota A Step-By-Step Guide to Using Production System the Right Tool at the Right Time From an Industrial Engineering Viewpoint Matthew A. Barsalou Shigeo Shingo and Andrew P. Dillon This book covers root cause analysis, with an emphasis on The green book that started it all, this is first book on JIT using quality tools to empirically investigate issues. It starts in English from the engineer’s viewpoint. When Omark with the theoretical background and then provides step- Industries bought 500 copies and studied it company- by-step instructions for performing root cause analysis wide, Omark became the US pioneer in JIT. It provides Dr. using various quality tools. The book explains how to use Shingo’s classic industrial engineering rationale for implementing process-based PDCA together with scientific methods and quality tools when investigating rather than operational improvements in manufacturing. He explains the basic quality failures. The tools and concepts presented are appropriate for both the mechanisms of the Toyota production system, examines production as a functional manufacturing industry and service industry. network of processes and operations, and then discusses the organization-wide Print ISBN: 978-1-4822-5879-0 mechanism necessary to make JIT possible in any manufacturing plant. He December 2014, 6-1/8 x 9-1/4, 150 pp., Soft Cover demonstrates new ways to think about profit, inventory, waste, and productivity. Suggested Price: $29.95 / £19.99 Print ISBN: 978-0-915299-17-1 October 1989, 6 x 9, 296 pp. 58 Suggested Price: $74.95 / £47.99
RSM Simplified Toyota Production System Optimizing Processes Using Beyond Large-Scale Production Response Surface Methods for Taiichi Ohno Design of Experiments In this classic text, Taiichi Ohno--inventor of the Toyota Patrick J. Whitcomb and Mark J. Anderson Production System and Lean manufacturing--shares the Stat-Ease, Minneapolis, Minnesota, USA genius that sets him apart as one of the most disciplined A complete demystification of response surface and creative thinkers of our time. Combining his candid methods (RSM), this book takes a simple-and-fun insights with a rigorous analysis of Toyota’s attempts approach that provides knowledge on RSM in an easy to read, informal style. at Lean production, Ohno’s book explains how Lean Keeping formulas to a minimum and making liberal use of figures, charts, graphs, principles can improve any production endeavor. A historical and philosophical and checklists, the book offers relevant examples, amusing sidebars, and do- description of just-in-time and Lean manufacturing, this work is a must read for it-yourself exercises that lead readers to the peak potential for their product all students of human progress. On a more practical level, it continues to provide quality and process efficiency. The book includes Design-Expert, version 7, with inspiration and instruction for those seeking to improve efficiency through the a 180-day free trial, allowing readers to do the complex statistical computations, elimination of waste. generate the necessary graphics, and perform the numerical optimization. Print ISBN: 978-0-915299-14-0 Print ISBN: 978-1-56327-297-4 March 1988, 6 x 9, 176 pp. November 2004, 7 3/8 x 9 1/4, 304 pp., Soft Cover Suggested Price: $62.95 / £39.99 Suggested Price: $74.95 / £47.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: May 2005,6x9,352pp. Print ISBN:978-1-56327-307-0 particular needsofaspecificplant. so thatemployeesstayfocused,anddeveloprobusttrainingplanstomeetthe resources, solvepersonnel problemsinananalytical,non-emotionalmanner they are capable with minimal waste, improve theirprocesses using existing theirtasksasquickly He demonstrateshowtotrainemployeesperform The authorexploresacrucialpieceofLeaninitiativethatisoftenoverlooked. and applicationofthefourmodulesthatcompriseTWI. Manufacturing Research, this bookelucidatesthehistory for decades.Winner ofa2006ShingoPrizeforExcellentin by theUSduringWorld War II,hasbeenusedbyToyota The Training Within (TWI)program,developed Industry Round PondConsulting,Rochester, NewYork, USA Donald Dinero The FoundationofLean Training Within Industry Suggested Price: October 2011,6-1/8x9-1/4,566pp. eBook ISBN:978-1-4665-0454-7 Print ISBN:978-1-4398-2097-1 needed toestablishtheTPSholisticallyacrossyourorganization. Yasuhiro Mondenexplainshowtocultivatethecultureandwayofthinking Instrumental inintroducingtheJITproductionsystemtoUnitedStates, systems, andinnovativesolutionstocommonobstaclesinTPSimplementation. new materialone-kanban,mini-profitcenters,computer-basedinformation (TPS) framework,thiseditionupdatestheclassicwith latest developmentsintheToyota ProductionSystem coverage ofToyota’s productionpractices.Exploringthe A bestseller for three decades, this book suppliesin-depth Mejiro University, Tokyo, Japan Yasuhiro Monden Just-In-Time, 4thEdition An IntegratedApproachto Toyota ProductionSystem Suggested Price: 2006,8-1/2 x11,224pp.,SoftCover February Print ISBN:978-1-56327-315-5 complete theexercises andimplementationcasestudies. applied to readers’ownworksites.AcompanionCDprovidesforms neededto that preemptivelypreventproblems.Theauthorsincludeexercises thatcanbe with employeerelations materials; andshowshowtoimproveperformance quality productsinlesstimethroughthehandlingofworkforce, machines,and jobssafelyandconscientiously;looksatways toproducemore how toperform demonstrates efficientwaystoinstructemployeeson methodology thatwonWWIIinthefactories.It (TWI), the production plant within Industry Manufacturing Research, this text covers Training Winner of the2007 Shingo Prizefor Excellence in TWI Institute,Liverpool,NewYork, USA Patrick GrauppandRobertJ.Wrona Essential SkillsforSupervisors The TWIWorkbook $62.95 /£39.99 $79.95 /£50.99 $62.95 /£39.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Mistake-Proofing forOperators Suggested Price: September 2001,8-1/2x11,440pp. Print ISBN:978-1-56327-227-1 to rapidlyfindingoutstandingsolutionscurrentproblemsontheshopfloor. familiarity withprevioussolutions,Hinckley’s newclassificationsystemsisthekey prevention efforts.Becausemistake-proofingisaskillthatimprovesthrough documentation formshelpsreadersadaptthismethodologytotheirdefect than detecting defects. Even more importantly, Hinckley’s mistake-proofing mistake-proofing toolthatfocusesonpreventingrather causes ofdefects,thisbookelucidatesapowerful complexity, variation,confusion,andtheotherroot A compendiumofthebestmethodsforreducing Assured C. MartinHinckley to Mistake-Proofing An Outcome-BasedApproach Make NoMistake! Suggested Price: 1989,8-1/2 x11,304pp. February Print ISBN:978-0-915299-31-7 their ideas. processes. Heprovidessampleimprovementformsreaderscanusetosketch out to specificdevices,partsandproducts,categoriesofimprovementmethods, and implemented inJapaneseplants.Theauthorpinpointshowpoka-yokeapplied or problem they address, of poka-yoke improvements 240 examples,organizedaccordingtothebroadissue the conceptsandmainfeaturesofpoka-yoke.Itincludes and shop-floorworkers,thisbooksummarizesmanyof A completelyillustratedguidetopoka-yokeforsupervisors Nikkan KogyoShimbun by PreventingDefects Improving ProductQuality Poka-Yoke Suggested Price: 1997,7x10,96pp.,SoftCover January Print ISBN:978-1-56327-127-4 company’s entireworkforce. improvement tools such as ZQC and mistake-proofing in the hands of your andproven the signatureofShopfloorSeries.Thegoal:toplacepowerful strategy. Itincludestheinstructionalfeaturesthatare covers allaspectsofthismanufacturingimprovement Quality Control(ZQC)inaneasy-to-readformatthat and assemblyworkerstothebasicmethodologyofZero Mistake-Proofing forOperators introduces operators Winner of a Shingo Prize for Excellence in Manufacturing, Productivity PressDevelopmentTeam The ZQCSystem $109.95 /£69.99 $99.95 /£63.99 $37.95 /£23.99
59 Lean Basics / Mistake-Proofing - Poka-Yoke Mistake-Proofing - Poka-Yoke / Office & Administrative Processes Removing the Barriers to Beyond the Lean Office Efficient Manufacturing Progressing from Lean Tools Real-World Applications of to Operational Excellence Lean Productivity Kevin J. Duggan Founder, The Institute for Operational Excellence Daniel L. Ferguson This book teaches readers how to create flow and This book is a practical roadmap that shows managers how operational excellence in the office. It presents an easy- to eliminate the barriers that keep them from achieving to-follow story where the main character is followed high productivity levels while producing consistent quality through his initial attempts to correct late responses products. The underlying basis is Deming’s methodology for reducing variability to a primary customer and his evolution to an approach based on operational but presents it in a new way by moving from theoretical to real-life application. excellence. It also incorporates other common-sense approaches that have proven to be successful and which enhance some specific foundational principles. Print ISBN: 978-1-4987-1248-4 May 2015, 6-1/8 x 9-1/4, 144 pp., Soft Cover Print ISBN: 978-1-4665-5551-8 Suggested Price: $29.95 / £18.99 eBook ISBN: 978-1-4665-5552-5 January 2013, 7 x 10, 294 pp., Soft Cover Suggested Price: $41.95 / £26.99
The Complete Lean Enterprise Warranty Claims Reduction Value Stream Mapping for A Modern Approach with Continuous Administrative and Office Processes, Improvement Techniques Second Edition Ronald Blank Beau Keyte Senior Quality Engineer and Productivity Consultant Branson Inc., Dexter, Michigan, USA Avoiding complex math and accounting terms, this book Drew A. Locher explains how to boost profits through the reduction of Change Management Associates, warranty expenses. Outlining a multifunctional approach Mt. Laurel, New Jersey, USA for reducing claims, it begins by summarizing the The new edition of this bestselling reference offers a step-by-step approach to traditional and most common strategies for warranty cost reduction. Next, it applying Lean initiatives to the administrative and office environment. It is an explains how readers can reduce warranty costs even further by taking a more ideal resource for leaders looking to improve their production support activities complete approach. The comprehensive approach described arms readers within their order-to-cash value stream. This updated edition will help readers with less conventional, yet powerful, approaches for reducing warranty costs, apply value stream mapping to non-production areas, identifying office wastes, including improving warranty processing productivity, clarifying installation and establishing performance metrics, speeding up administrative workflow, and usage instructions, and streamlining supply chain management. improving office efficiency. New content has been added to broaden its appeal Print ISBN: 978-1-4822-0912-9 to service organizations. 60 eBook ISBN: 978-1-4822-0914-3 Print ISBN: 978-1-4822-0613-5 June 2014, 6-1/8 x 9-1/4, 181 pp. April 2015, 8-1/2 x 11, 160 pp., Soft Cover Suggested Price: $49.95 / £31.99 Suggested Price: $59.95 / £38.99
Zero Quality Control The Customer-Driven Source Inspection and Organization the Poka-Yoke System Employing the Kano Model Shigeo Shingo Lance B. Coleman, Sr. The Tech Group, Tempe, Arizona, USA A combination of source inspection and mistake-proofing devices is the only method to get you to zero defects. Which organizations provide customer satisfaction or Shigeo Shingo shows you how this proven system for inspire customer loyalty? Which is more important? This reducing errors turns out the highest quality products in book gives detailed examples of how to deploy the Kano the shortest period of time. Shingo provides 112 specific model of customer service excellence in a manufacturing setting, as opposed to examples of poka-yoke development devices on the shop floor, most of them a service environment, which is much more common. Readers will learn how costing less than $100 to implement. He also discusses inspection systems, quality to directly apply Kano principles in their own business environment, establish control circles, and the function of management with regard to inspection. priorities, increase efficiency, improve communication, and expand on business Print ISBN: 978-0-915299-07-2 relationships. April 1986, 6 x 9, 336 pp. Print ISBN: 978-1-4822-1710-0 Suggested Price: $109.95 / £69.99 December 2014, 7 x 10, 112 pp., Soft Cover Suggested Price: $39.95 / £25.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,7x10,216pp.,Soft Cover Print ISBN:978-1-4822-6084-7 millionsofclients. whichmustserve and electronicbankingindustry covers howtodeployLeanintheexceptional security, safetyofclient,bankdata, offices.” Thebookcovers“howtodothework”andnot“whatworkdo”. It how toimprovethenormaldailywork,typicallyexecutedinso-called“back and SixSigmaparadigmtobankoperations.Itshows This book describes the applicationof the Lean Thinking M-Bank Warsaw, Poland Marek Felbur University,Loyola Marymount Los Angeles,California,USA Bohdan W. Oppenheim and MoraleinFinancialOffices Improving Quality, Productivity, Lean forBanks Suggested Price: April 2015,8-1/2x11,152pp.,SoftCover Print ISBN:978-1-4987-1408-2 own, withoutmanagementintervention. the employeesthemselvesarecapableofidentifyingandfixingproblemsontheir methodology forleveragingtraditionalvaluestreamflowtocreateawhere and howitcanbeachieved.Specifically, thebookdescribeshowstep-by-step comprehensive understandingofwhycreatingflowintheofficeissoimportant guideline usingtext,illustrations,anddiagrams,providesthereaderwitha in any office environment. Each chapter describes one This book describes nine guidelines for creating flow Founder, TheInstituteforOperationalExcellence Kevin J.Duggan in BusinessProcesses A PracticalGuideforIntelligentFlow Excellence intheOffice From LeantoOperational Suggested Price: April 2015,8-1/2x11,350pp.,SoftCover Print ISBN:978-1-4822-5563-8 and providesrefinedpredictionsfortheLeanoffice. edition buildsonitspopularpredecessorwithupdatestothesoftwaresections tools haveemergedthatmorecloselymatchtheideasinbook.Thissecond Sincetheoriginalpublication,severalother in collaborativeandcloudservices. today’s economyandhighlightedseveralusefulsoftwaretoolstrends service Leanbodyofknowledgeinto They showedhowtoadaptthefactory-derived flow forknowledgeworkersinthemodernoffice. a methodtomeasureandimproveoninformation In thefirsteditionofthisbook,authorsintroduced Blue ConsultingGroup,Stockholm,Sweden Linus Larsson George Gonzalez-Rivas Second Edition Lean fortheInformationAge, Far fromtheFactory $39.95 /£25.99 $49.95 /£31.99 $59.95 /£38.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Lean HumanResources Suggested Price: April 2010,7x10,312pp.,SoftCover eBook ISBN:978-1-4398-1466-6 Print ISBN:978-1-4398-1465-9 satisfaction foremployeesandcustomersalike. stepoftheway,of qualityevery instillingprideandmaximizingvalue focuses oninvolvingstakeholdersandholdingthemaccountableforthedelivery as Value StreamMapping. ReflectingconceptsinherentinallLeanprocesses,it voice ofthecustomer(VOC)concepts,itintroduceseducatorstoLeantools,such the students. consumers it was designed to serve, running oftheirinstitutions.Itreturnseducationtothe how to apply Lean business principles to the successful This bookisdesignedtoteachacademicadministrators BGSU FirelandsCollege,Huron,Ohio,USA William K.Balzer of UniversityProcesses Increasing theValue andPerformance Lean HigherEducation Suggested Price: September 2010,6x9,370pp. eBook ISBN:978-1-4398-1757-5 Print ISBN:978-1-4398-1756-8 to yourorganization. continuous improvementtodeliverIT operationalexcellenceandbusinessvalue shares practical tips, examples, and casestudies to helpyouestablishacultureof Winner ofa2011ShingoResearch andProfessionalPublicationPrize,thisbook IT departmentiseitherleftoutorviewedasanobstacle.Whattobedone? enterprise beginsaLeantransformation,toooftenthe while steadily reducing operatingcosts.Yet when an manage change,andmaintainquality stability, all levels, andinnovation,improveservice performance Information Technology is supposed to enable business Steven C.BellandMichaelAOrzen Lean Transformation Enabling andSustainingYour Lean IT Suggested Price: September 2010,7x10,263pp.,SoftCover eBook ISBN:978-1-4398-1307-2 Print ISBN:978-1-4398-1306-5 to employees. should beseendifferently, asapartnerdeliveringexceptionalcustomerservice been especiallyeffectiveincombatingwaste,andwhytoday’s HRdepartment why somanycompaniesallowthiswastetoexist,howtraditionalHRhasnot the people-relatedapproachesneededtoalterculturaldynamics.Shelooksat who hasbeenimplementingLeaninitiativesoutofHRofficesfor20years,defines the improvementpoweroftheirHRdepartments.Jekiel, employee potential by first showing them howto increase gives managersandCEO’s themeanstomaximize Encouraging alongoverdueshiftinthinking,thisbook Flying FoodGroup,USA M.Jekiel Cheryl a CultureofContinuousImprovement Redesigning HRProcessesfor $59.95 /£37.99 $59.95 /£37.99 $47.95 /£29.99
Applying Applying 61 Office & Administrative Processes Lean Office Run Grow Transform and Service Simplified Integrating Business and Lean IT Office & Administrative Processes / Organizational Culture The Definitive How-To Guide Steven C. Bell Drew Locher Your customers want innovation and value, and they Change Management Associates, Mt. Laurel, New Jersey, USA want it now. How can you apply Lean principles and Demystifying the application of Lean methods, this practices throughout your enterprise to drive operational 2011 Shingo Prize winner details the key concepts of excellence, reduce costs while improving quality, Lean as they apply to office and service environments. enable efficient growth, and accelerate idea-to-value It discusses value stream management, standard work, flow, level pull, and innovation? Shingo Prize-winning author Steve Bell and visual management. The text breaks down Lean concepts into their elementary other thought leaders show you how—guiding you to more effectively align components, describes them in a nonmanufacturing context, and supplies people and purpose, promote enterprise agility, and leverage transformative IT specific how-to methodologies. It includes a toolbox of helpful forms, charts, capabilities to create market-differentiating value for your customers. checklists, templates, and worksheets to kick-start Lean implementation efforts. Print ISBN: 978-1-4665-0449-3 Print ISBN: 978-1-4398-2031-5 eBook ISBN: 978-1-4665-0450-9 eBook ISBN: 978-1-4398-7770-8 September 2012, 7 x 10, 372 pp., Soft Cover February 2011, 7 x 10, 194 pp., Soft Cover Suggested Price: $54.95 / £34.99 Suggested Price: $45.95 / £28.99
Value Stream Management Lean Waste Stream for the Lean Office Reducing Material Use and Eight Steps to Planning, Mapping, Garbage Using Lean Principles & Sustaining Lean Improvements Marc Jensen in Administrative Areas Although there are many books available on personal Don Tapping and Tom Shuker efforts to reduce garbage, none exist that focus on business Extending their eight-step process to the realization of a garbage. Filling this need, this book describes how to use lean office, Tapping and Shuker use a customer service garbage analysis as a tool to identify the problems in case studyto illustrate the effectiveness of the value stream storyboard.This process flow that produced the garbage. It also explains popular volume provides organizations with a proven system for implementing how to look downstream for options to reuse, repurpose, and recycle garbage lean principles in the office. In addition to providing a thorough overview of to minimize landfill impact and costs. The text includes practical exercises with basic lean concepts, this book details methods for identifying the administrative step-by-step instructions, as well as real-world examples that demonstrate how activities in need of attention. To address these, it applies the eight-step process specific wastes have been dealt with profitably by various organizations. for removing waste and reorganizing workflow. Accompanying the book is a CD Print ISBN: 978-1-4822-5317-7 containing a lean assessment tool, a storyboard template, charts, a team charter, September 2014, 6-1/8 x 9-1/4, 182 pp., Soft Cover and worksheets. Suggested Price: $29.95 / £18.99 Print ISBN: 978-1-56327-246-2 62 eBook ISBN: 978-1-4822-7817-0 February 2003, 8-1/2 x 11, 176 pp., Soft Cover Suggested Price: $62.95 / £39.99
Metrics-Based Process Mapping Achieving HR Excellence Identifying and Eliminating Waste through Six Sigma in Office and Service Processes Daniel Bloom Karen Martin Daniel Bloom & Associates, Inc., Largo, Florida, USA Karen Martin & Associates, San Diego, CA, USA From the history and evolution of the Total Quality Mike Osterling movement to initiatives for introducing a Six Sigma Osterling Consulting, La Mesa, California, USA continuous process improvement strategy in your HR Metrics-Based Process Mapping is a tactical-level, visual department, this book introduces a new way to envision mapping approach that enables improvement teams to your role within the organization. It explains how this make effective, data-based decisions regarding waste elimination and measure powerful methodology works and supplies a roadmap to help you find and ongoing process performance. The mapping technique integrates the functional eliminate waste in your HR processes. Describing exactly what HR excellence orientation of traditional swim lane process maps with time and quality metrics means, the book outlines dozens of proven approaches as well as a hierarchy of that are essential for designing improved processes. The Excel-based tool, the exact steps required to achieve it. included on the accompanying CD, provides a user-friendly way to electronically Print ISBN: 978-1-4665-8646-8 archive manually created maps in team settings for easier storage and distribution eBook ISBN: 978-1-4665-8648-2 across an organization. August 2013, 7 x 10, 215 pp., Soft Cover Print ISBN: 978-1-4398-8668-7 Suggested Price: $41.95 / £26.99 eBook ISBN: 978-1-4398-8669-4 October 2012, 7 x 10, 116 pp., Soft Cover Suggested Price: $109.95 / £69.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2007,8-1/2 x11,240pp.,SoftCover eBook ISBN:978-1-4398-2782-6 Print ISBN:978-1-56327-351-3 based tools. ease. AnaccompanyingCDprovides immediateaccess to anumber ofExcel- practitioners toventureintonon-manufacturing environmentswithcomfortand results..Their clear, concisepresentationallowsbeginnersandexperienced scope theactivity, engagetherightpeople, andfacilitateeventswithmeasureable foundation forcontinuousimprovement. Readerswilllearnhowtoeffectively provide methodsandtoolstohelpbuildamotivatedworkforce andlaya conducting post-eventfollow-uptosustainthechangesmade.Theauthors planning andexecutingKaizenEventsinnon-manufacturingsettings and A practicalhow-toguide,thisbooktakesreadersthroughtheinsandouts of Osterling Consulting,LaMesa,California,USA Mike Osterling Karen Martin&Associates,SanDiego,CA,USA Karen Martin Environments and Office, Service, Technical Achieving RapidImprovementin The KaizenEventPlanner Suggested Price: October 2014,7x10,264pp. eBook ISBN:978-1-4822-4528-8 Print ISBN:978-1-4822-4527-1 business intoamoreeffectivebusiness. illustrations, tables,andgraphics,thebookdetailsmethodsfortransformingany readily applytheformatwithlittleornodifficulty. With theaidofmanyexamples, business.Itpresentsaseriesofvisualframeworksthatallowreadersto for every and tablestoexplainthesethreeimportantcomponents This bookusesLeanprinciplesalongwithgraphics,charts, run effectively:strategy, effectivepeople,andbranding. Businesses requirethreeoptimizedcorecomponentsto Director ofR&D,UngerEnterprises Anthony Sgroi,Jr. Strategy toWin intheMarketplace Synchronizing People,Branding,and The InnovativeLeanMachine Suggested Price: October 2014,7x10,407pp.,SoftCover Print ISBN:978-1-4822-4323-9 cross-functional valuestreamprocessimprovementprojects. also includesexpandedcoverageofLeanmanagementapplicationsincomplex read foranyleaderundergoingorconsideringaLeantransformation,thisedition studies, andnewexamplesfromthehealthcareprocessindustries.Amust- edition providesexpandedcoverageofexecutiveresponsibilities,21newcase the topdownandbottomupatsametime.This works bydevelopingaculturethatbuildssuccessfrom explains howtoimplementaLeantransformationthat The neweditionofthisShingoPrize-winningbestseller Principal, DavidMannLeanConsulting,Michigan,USA David Mann Third Edition Tools toSustainLeanConversions, Creating aLeanCulture $68.95 /£43.99 $59.95 /£38.99 $49.95 /£31.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Organizational Performance and MethodstoEnhance Process Knowledge Discovery Suggested Price: 2002,7x10,112pp.,SoftCover February Print ISBN:978-1-56327-272-1 easily accessibleformatforthosefrontlineemployeeswhomakeleanpossible. the Shopfloordistillscomplexitiesofjumpstartingleanprocessesintoan As thenewestadditiontoShingoPrizeWinning ShopfloorSeries, kaizen event:onethatiswellplanned,implemented,anddocumented. Shopfloor make focusedchangesintheworkplace.Kaizenfor beyond costcutting.Kaizeneventsareopportunitiesto seeking toimplementleanimprovementsthatgo improvement, needstoadoptedbyanyorganization The philosophyofkaizen,whichsimplymeanscontinuous Productivity PressDevelopmentTeam with ProcessAutomation A Zero-Waste Environment Kaizen fortheShopFloor Suggested Price: March 2015,7x10,200pp.,SoftCover Print ISBN:978-1-4822-5716-8 practitioners experiencingshiftsbeyond theircontrol. into anewjob,boardmemberswhen searching foranewleader, andLean simple language,itoffersguidanceandadvicetoseniorexecutivescoming cultural and business shifts on the fragile nature of a Lean culture. Using clear, and sustainingthegainsinanever-changingworld.Itexploreseffects of of theauthorswhohavebeendeeplyinvolvedinleadingLeanTransformations This bookusestheoperatingexperienceandresearch KDR Associates,SanDiego,California,USA Kenneth Rolfes William H.Baker, Jr. Management Change Improvement CultureAftera Maintaining aContinuous Lean fortheLongTerm Suggested Price: March 2015,6-1/8x9-1/4, 352pp. Print ISBN:978-1-4822-1236-5 to helpreadersmakethemostoftheirorganizationaldata. this book considersimportanttrends,techniques,strategies,andbestpractices explanation ofhoworganizationscanimplementKDDM.Fillingthisneed, current publications focus on technical and mathematical jargon without clear countries orrelatablecaseswithrelevancetotheirspecificcontexts. Most society. Thereisa current paucity ofliteraturewithemphasisondeveloping their socio-economicandlegalimplicationstostakeholders,organizations, This bookoffers insightsintothescopeofdatamininginitiatives,including University ofTechnology, Jamaica Corlane Barclay Richmond, USA Virginia CommonwealthUniversitySchoolofBusiness, Kweku-Muata Osei-Bryson Edited by takes readers through the critical steps for conducting a very effective effective takes readersthroughthecriticalstepsforconductingavery $37.95 /£23.99 $39.95 /£25.99 $119.95 /£76.99
Kaizen for Kaizen for 63 Organizational Culture Lean Human Performance Learning with Lean Improvement Unleashing the Potential for Jerry L. Harbour Sustainable Competitive Advantage Vector Resources, Inc., Trinidad, Colorado, USA James Zurn and Perry Mulligan Organized in three sections, this book covers QLogic Corporation, Aliso Viejo, California, USA understanding human performance, analyzing and Examining the performance gap between good improving work productivity, and analyzing and organizations and great ones, Learning with Lean improving quality and safety. The author first develops explains how to use Lean as a learning vehicle for a fundamental and basic understanding of human achieving and sustaining a competitive advantage. performance, then couples that understanding with learning how to analyze Helping you better understand the current state of your organization, it outlines and improve human-related work productivity and quality and safety. He also a series of five simple phases for developing an architecture and implementation discusses how knowledge and skills transfer from one work setting to another. plan to transform your organization’s performance. These five phases fit neatly Organizational Culture Print ISBN: 978-1-4822-9881-9 into a closed-system model that has similarities to the Plan-Do-Check-Act quality December 2014, 7 x 10, 242 pp., Soft Cover model. Suggested Price: $39.95 / £25.99 Print ISBN: 978-1-4665-7294-2 eBook ISBN: 978-1-4665-7295-9 August 2013, 7 x 10, 294 pp., Soft Cover Suggested Price: $49.95 / £31.99
The Lean Leader People, Process, and Culture A Personal Journey of Transformation Lean Manufacturing in the Real World Robert B. Camp Jeffrey P. Wincel Burlington Medical Supplies Inc., Thomas J. Kull, PhD Newport News, Virginia, USA Arizona State University, Tempe, USA Like the author’s previous book, this is a novel. It is written This book examines the global cultural influences on about a highly talented Plant Manager, Donald Spears, the understanding and application of Lean production who has done things his own way for far too long. When systems within various geographic and cultural areas. he runs afoul of Jim, his VP of Operations, he is given an It identifies the cultural values as examined against ultimatum: change or be removed. Don chooses to transform and that decision Lean manufacturing disciplines to derive culturally based Lean manufacturing takes him on a new journey that forever alters his style of leadership; and not just values. The approach of people, process, and culture will help managers better his, but that of his entire organization. understand the potential limitations and performance shortfalls that result Print ISBN: 978-1-4987-0075-7 from varying interpretations and applications of Lean systems. This approach January 2015, 6-1/8 x 9-1/4, 160 pp., Soft Cover will help readers demystify the sometimes complex characteristics of a Lean Suggested Price: $29.95 / £18.99 transformation. Print ISBN: 978-1-4665-5789-5 eBook ISBN: 978-1-4665-5791-8 64 April 2013, 6-1/8 x 9-1/4, 153 pp. Suggested Price: $49.95 / £31.99
The Lean Practitioner’s The Process Mind Field Book New Thoughtware® for Designing Proven, Practical, Profitable Your Business on Purpose and Powerful Technigues Philip Kirby for Making Lean Really Work Organization Thoughtware International Inc., Canada Charles Protzman, Fred Whiton, Joyce Kerpchar, Business performance is rooted in your processes, and Christopher Lewandowski, Steve Stenberg, superior performance depends on the way you think and Patrick Grounds about and run these processes. To improve and sustain performance, you need a process mind. With game- This book outlines a true learning path for anyone seeking to understand essential changing thinking, thought-provoking principles, and eye-opening examples, Lean principles. It presents examples drawn from the experiences of its many this book brings to life the operating intelligence of a process mind. The author’s well-respected and award-winning contributors. These experts break down Lean track record is so exceptional that by following the proven concepts discussed in concepts to their simplest terms to make everything as clear as possible for Lean this book, you can expect a 50 percent improvement in performance. practitioners. A refresher for some at times, the text provides thought-provoking questions with examples that will stimulate learning opportunities. Introducing Print ISBN: 978-1-4822-2895-3 the Lean Practitioner concept, the book details the five Lean Practitioner levels October 2014, 6-1/8 x 9-1/4, 315 pp. and includes quizzes and criteria for each level. Suggested Price: $39.95 / £25.99 Print ISBN: 978-1-4398-7336-6 January 2015, 7 x 10, 1584 pp. Suggested Price: $99.95 / £63.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 of organizationsthatimplementprojectsandneedtoconductLessonsLearned. experts inthefieldofevaluation.Theconceptscoveredareapplicabletoalltypes on fouryearsofdoctoraldissertationresearch andissupportedbyrenowned to conductingLessonsLearnedonaproject.Theresearch inthisbookisfounded predecessor, thissecondeditionprovidesaneasy-to-follow, systematicapproach Award . Followinginthefootstepsofitspopular Suggested Price: 2014,6-1/8 x9-1/4,486pp. February eBook ISBN:978-1-4822-0494-0 Print ISBN:978-1-4822-0492-6 and management. proposes numerousimprovementsto currentengineeringpractices,education, effective implementationofLeanProductionandQualityprograms.Thebook major improvementsinalltheseproductdevelopmentgoals,whileenabling advanced productdevelopmentmodel,itshowshowtosimultaneouslymake stable production.Extendingtheconceptsofdesignformanufacturability toan the lowestcost,highestquality, andquickesttimeto to designproductsforallaspectsofmanufacturing This bookexplainshowtouseconcurrentengineering David M.Anderson Products forLeanProduction Rapidly DevelopLow-Cost,High-Quality How toUseConcurrentEngineering Design forManufacturability Suggested Price: August 2014,6-1/8x9-1/4,214pp.,SoftCover eBook ISBN:978-1-4822-0454-4 Print ISBN:978-1-4822-0453-7 (PMI The firsteditionwontheProjectManagement Institute’s Research, Montvale,NewJersey, USA Associate DirectorofLearningManagement,Pfizer/Wyeth Willis H.Thomas Second Edition and LessonsLearned The BasicsofProjectEvaluation Suggested Price: March 2013,6-1/8x9-1/4,183pp.,SoftCover eBook ISBN:978-1-4822-0153-6 Print ISBN:978-1-4665-7168-6 monitor success. good decisions.Hesuppliestoolsforleadershipandteacheshowto boundaries fordecisionsandteachesadata-drivenmethodologymaking tactical opportunitiesforimprovement.Theauthordescribesaprocessthatsets describes howtop-downmetricsevolveintotheidentificationofstrategicand addresses howtostayoncourseoverthelongterm.It creating asustainableLeantransformation,thisbook What’s hard,issustainingit.Detailingtheprocessfor Anybody canstartaLeantransformation.That’s easy. Virginia, USA Burlington MedicalSuppliesInc.,NewportNews, Robert B.Camp ofaCulturalTransformationThe Story Sustainable Lean ® ) David I. Cleland Project Management Literature David I.ClelandProjectManagementLiterature $59.95 /£38.99 $24.95 /£14.99 $31.95 /£19.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Lean BasicsforR&D Suggested Price: June 2015,6-1/8x9-1/4,175pp. Print ISBN:978-1-4822-1667-7 through anumberofdifferentlenses. entrepreneurial ventures,andnon-profits, thisbookexaminesinnovation successful fortune 500 companiesand big government to small but successful relationshipbetweeninnovationandquality.there isacomplimentary From the bestcompanies.However, theresearch providedinthisbookwillprovethat in thattheyaresporadicandunpredictable,even organizations. Bothinnovationandqualityarefragile leaders haveinunderstandingtheneedsoftheir in business.Typically overused,theyfill thevoid that Innovation andqualityaretwomisconceivedterms I&P ConsultingGroup David R.Arvonio of InnovationandQuality Discovering theIntersections Suggested Price: March 2006,6x9,400pp. Print ISBN:978-1-56327-282-0 integration, andknowledgemanagement. function workloadleveling,compound processvariation,effectivetechnology product development,suchassynchronizing multipledisciplines, techniques andprovenpracticesfor dealing withchallengesassociated improvement. Throughexamplesandcasestudies,thisbookillustratesspecific tool forcontinuous value streammappingasanextraordinarilypowerful They useextensiveexamplesfrombothofthecompetitorstodemonstrate class productdevelopmentprocessofToyota withthatofaU.S.competitor. Morgan andJeffreyLikercomparecontrasttheworld- Integrating People,Process,andTechnology , James In James MorganandJeffreyK.Liker and Technology Integrating People,Process, Development System The Toyota Product Suggested Price: June 2015,7x10,250pp.,SoftCover Print ISBN:978-1-4822-5968-1 all levelsofleadership. the implementationinitiallyfaltered.Thebookalsoprovidesaperspectivefrom start aninitiativeandimplementationplan.Thebooksharesexperienceswhere It coversthecompletesubjectandlayoutstepsto but donothaveastrongbackgroundonthesubject. those in R&Dwho must start a lean initiative in R&D for such significantimprovements,thisbookisperfect Detailing howtheGoodyearteamwasabletoachieve Norbert MajerusandGeorgeTaninecz Products withOperationalExcellence Developing InnovativeandProfitable The Toyota Product Development System: $39.95 /£25.99 $54.95 /£35.99 $49.95 /£31.99
65 Organizational Culture / Product Development A Factory of One Return On Process (ROP) Applying Lean Principles to Getting Real Performance Results Banish Waste and Improve from Process Improvement Your Personal Performance Michael West Daniel Markovitz Natural SPI Inc., Salt Lake City, Utah, USA Productivity Improvement / Tools & Methods President, TimeBack Management Many organizations spend hundreds of thousands or This book describes how to improve your performance millions of dollars on process improvement but never by applying Lean methods to your work. It translates realize business performance results. Executives and powerful Lean tools such as visual management, flow, pull, 5S, and kaizen to organizational leaders pursue only those improvement your daily work, revealing how they can help to improve efficiency, reduce waste, initiatives that can yield measurable performance gains. This book defines how to and link you ever more closely to customer value. Helping you develop better achieve real business performance results from process improvement, thus filling self-awareness, more disciplined problem-solving skills, and the ability to self- a major information void in the economy. It explains how to set performance correct errors, the book teaches you how to find the root causes underlying your and process improvement goals, shows how to measure process improvement inefficiencies so you can eliminate them permanently. results, and details how to lead a performance culture. It also presents metrics for business performance and defines the relationship between performance and Print ISBN: 978-1-4398-5993-3 process. eBook ISBN: 978-1-4398-5994-0 December 2011, 6 x 9, 177 pp., Soft Cover Print ISBN: 978-1-4398-8639-7 Suggested Price: $28.95 / £18.99 eBook ISBN: 978-1-4398-8641-0 March 2013, 6-1/8 x 9-1/4, 390 pp. Suggested Price: $71.95 / £45.99
Kamishibai Boards Strategy + Teamwork A Lean Visual Management System = Great Products That Supports Layered Audits Management Techniques for Joseph Niederstadt Manufacturing Companies Gates Corporation, Suzhou, China Frederick Parker Part of the Toyota Production System, Kamishibai boards Manufacturing companies succeed by using techniques are simple and flexible visual controls for performing that promote teamwork between engineering, marketing, audits within a manufacturing process. When used and manufacturing engineering. This book explains how properly, they are powerful tools for performing, to implement techniques of teamwork between those disciplines and how to managing, and auditing tasks of specific duties. This book explains how to use mold employees from various walks of life into a successful manufacturing team. this visual management system to identify normal conditions versus abnormal It details the best techniques currently available and includes examples on how conditions in your organization. The book includes a CD with master forms you to implement them. The book also describes how to avoid common pitfalls and can use to create your own daily, weekly, or monthly Kamishibai cards as well steer clear of useless fads that can be destructive to your organization. as electronic copies of all examples in the book. Print ISBN: 978-1-4822-6010-6 Print ISBN: 978-1-4822-0529-9 November 2014, 6-1/8 x 9-1/4, 144 pp. 66 September 2013, 7 x 10, 120 pp., Soft Cover Suggested Price: $39.95 / £25.99 Suggested Price: $49.95 / £31.99
Mastering Complexity 5 Pillars of the Adding Coherence Throughout Visual Workplace Your Business with Dependency Hiroyuki Hirano Structure Matrices JIT Management Laboratory Co. Stephen Denker Revered for his pioneering no nonsense approaches, Managing Partner, Business Process Architects, Inc. Hiroyuki Hirano introduces his 5S System: Sort, Set In Order, Shine, Standardize, and Sustain. These This book designed to help readers develop and steps are designed to improve efficiency, strengthen maintain logical, adaptable solutions to business maintenance, and provide continuous improvement problems. It demonstrates how to visualize these business dependencies in all facets of a company’s operations. Filled with case studies and training connections with a square spreadsheet called a Dependency Structure Matrix, or materials, including over forty 5S user forms, this guide is for organizations DSM. Once the links representing dependencies are visualized in a DSM, it can seeking to move forward through the realization of efficiency. Though simple be used to improve the business. sounding, the system will prove of great use in teaching a company to mobilize Print ISBN: 978-1-4987-0079-5 towards positive change. If they cannot implement 5S, there is little hope of March 2015, 6-1/8 x 9-1/4, 112 pp., Soft Cover integrating large-scale changes such as JIT or re-engineering. Suggested Price: $29.95 / £18.99 Print ISBN: 978-1-56327-047-5 January 1995, 8-1/2 x 11, 384 pp. Suggested Price: $121.95 / £77.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: May 1999,6x9,352pp. Print ISBN:978-1-56327-219-6 to manualworksuchasassembly, inspection, andmaterialhandling. for achievingzerobreakdowns,useful guidelines andcasestudiesinapplyingAM activities. He includes an implementation plan for TPM and five countermeasures losses, overallequipmenteffectiveness(OEE),causesofandsixmajorTPM author discussesTotal Productive Maintenance(TPM)basicssuchasthesixbig and checklistsforstepauditstocertifyteamachievementateachstep. The of AM features maintenance (AM). It providesan overview comprehensively coversallsevenstepsofautonomous Bridgestone, Hitachi,andothertopcompanies,thisbook Illustrated withexamplesfromToyota, AsaiGlass, Fumio GotohandMasajiTajiri Implementing TPMontheShopFloor in SevenSteps Autonomous Maintenance Suggested Price: August 1997,7x10,144pp.,SoftCover Print ISBN:978-1-56327-082-6 meetings, andone-pointlessonstopromoteTPMgoals. debris, andtipsforeffectivelubrication, as wellways to use activityboards, to inspectforproblemsduringroutinecleaning,ideascontainingdamaging runningsmoothly,equipment. Operatorswilllearnskillstokeepmachinery ways the development of informed, motivated operators who take ownership of their actual examples demonstrate the benefits that can be reaped from encouraging maintenance. Activity boards, photos, cartoons, and provides guidanceandcasestudiesonautonomous TPM coordinators, and equipmentoperators, this book in maintainingtheirownequipment.Forsupervisors, Productivity soarswhenoperatorsarepositivelyinvolved Japan InstituteofPlantMaintenance Edited by for Operators Autonomous Maintenance Suggested Price: March 1996,7x10,136pp.,SoftCover Print ISBN:978-1-56327-123-6 management andtotalproductive. like shorterequipmentchangeovers,just-in-timeinventory, andtotalquality essential forimplementingnotjust5S,butoverallmanufacturingimprovements summaries, diagramsandillustrations.Thisbookprovidesthefoundationthatis read andapply, eachsectionofthebookisloadedwithquestions,outlines, aspects incontinuousimprovementinitiatives.Easy-to- sustain arethemostfundamentalandoftenoverlooked visual workplace: sort, set in order, shine, standardize and in onecompanyafteranother. Hirano’s fivepillarsofthe continues tobehugelypopular, havingprovenitsworth Since itspublication,HiroyukiHirano’s, 5SforOperators Hiroyuki Hirano 5 PillarsoftheVisual Workplace 5S forOperators $68.95 /£43.99 $37.95 /£23.99 $37.95 /£23.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Systems Building QualityManagement Suggested Price: August 2013,8-1/2x11,408pp.,SoftCover eBook ISBN:978-1-4398-9383-8 Print ISBN:978-1-4398-9382-1 criteria, whichaddresseducationandhealthcare. each examinationitemandthesevenmajorcategories.Thiseditionreflectsnew visit, thisbookcoversallstagesintheprocess.Itoffersdetailedexplanationsof stakeholders. Fromunderstandingthescoringsystemtopreparingforasite and effectiveoperations, provides awayofengagingandrespondingto demonstratesefficient ofproductsand/orservices, improvement inthedelivery a role-modelorganizationalmanagementsystemthatensurescontinuous excellence that a U.S. organization can receive. An organization must have highest level ofnationalrecognition for performance The MalcolmBaldrigeNationalQualityAward isthe Manhattan Beach,California,USA Mark GrahamBrown Excellence Criteria forPerformance How toInterprettheBaldrige Quality Baldrige Award Winning Suggested Price: September 2013,6-1/8x9-1/4,169 pp. eBook ISBN:978-1-4665-9645-0 Print ISBN:978-1-4665-9643-6 achievement ofsuccessandlifesatisfactions. practical languageandtoolstoaddresstheparadoxesthatseemblock the provides deepinsightintotherootcausesofworkplaceissuesand most troublesometopeopleandtheorganizationstheyworkfor. Theauthor financial dataalone.Itaddressestheissuesthatare and sustainabilityinthelongtermthanthosewhouse balance severalkeyparadoxesachievegreatergrowth This bookdemonstrateshoworganizationleaderswho Principal -TheLeader’s Toolbox, Inc. Ralph Jacobson to ExecutewithConfidence Using LeadershipParadox Getting Unstuck Suggested Price: June 2013,7x10,202pp.,SoftCover eBook ISBN:978-1-4665-6500-5 Print ISBN:978-1-4665-6499-2 and organizationstosucceedinbecomingaworld-classorganization. the basisforcreatingaqualitymanagement-culture,andcanhelpprofessionals With and a process management, it provides a clear focus on business performance (QMS) basedontwoimportantorganizationalelements:needsandresources. management projects. It discusses building theQualityManagementSystems core operational and support processes to set a strategic agenda for quality including howtodevelopabilitiesinorderidentify models, methods, and tools to foster quality management, This bookdiscussesthemostwell-knownexcellence and Vikas Kumar Luis Rocha-Lona,JoseArturoGarza-Reyes, Selecting theRightMethodsandTools — 18thEdition $62.95 /£39.99 $41.95 /£26.99 $49.95 /£31.99
67 Tools & Methods Made-to-Order Lean The Pocket Guide to the Excelling in a High-Mix, Baldrige Award Criteria Low-Volume Environment (5-Pack), 17th Edition Greg Lane Mark Graham Brown Low Volume Lean, Stockton, California, USA Manhattan Beach, California, USA
Toyota’s methods have rendered remarkable results Updated yearly to match changing requirements, this in high-volume plants, but they have not been fully guide is designed to help you understand the criteria understood and correctly applied in high-mix, low- for the Malcolm Baldrige National Quality Award. The volume environments. While lean principles apply in Baldrige criteria are being used by thousands of organizations around the world such an environment, implementation methods and tools must be adapted and to evaluate their progress toward becoming the best in their fields. This 17th alternate methods embraced. Written by Greg Lane, one of the few individuals edition of The Pocket Guide to the Baldrige Criteria begins with commonly certified as a Toyota Production System Key Person, this book is specifically geared asked questions about the Award criteria. It then breaks down the 19 items under for manufacturers that have hundreds to thousands of active part numbers with the seven category headings of the Baldrige criteria with concise explanation and
Tools & Methods few or no ongoing forecasted volumes, and for shops that build to order. It quick tips of what excellent companies do in each area. focuses on eliminating non-value-added activities and instituting improvements on repetitive jobs. Print ISBN: 978-1-4822-0527-5 eBook ISBN: 978-1-4822-1565-6 Print ISBN: 978-1-56327-362-9 June 2013, 3 1/2 x 5, 64 pp., Soft Cover August 2007, 8-1/2 x 11, 192 pp., Soft Cover Suggested Price: $41.95 / £26.99 Suggested Price: $68.95 / £43.99
Quick Changeover New JIT, New Management Concepts Applied Technology Principle Dramatically Reduce Set-Up Time Kakuro Amasaka and Increase Production Flexibility Aoyama Gakuin University, Tokyo, Japan with SMED This book contains the previously published, updated, and Karsten Herr new works of renowned scientist, scholar, and consultant Kakuro Amasaka. This book advances the Just-in-Time Quick Changeover Concepts Applied provides a quality management strategy, bringing global readers comprehensive overview of changeovers from a strategic, into the cutting edge of a new management technology tactical, and operational perspective. It outlines strategies that can help readers principle that surpasses what traditional JIT has accomplished. The new JIT shorten internal set-up steps through the physical analysis of machine elements. principle contains hardware and software systems, and next generation technical The method presented is the result of a synthesis of the classic Shingo SMED principles for transforming management technology into management strategy. methodology along with modern engineering techniques. The book redefines This comprehensive work covers traditional JIT, innovation and evolution, the full set-up and set-up time and details a step-by-step method for developing quick new JIT and its applications along with case studies. changeover methods in a manner where changes can be realized with minimal spending. Print ISBN: 978-1-4665-7502-8 November 2014, 6-1/8 x 9-1/4, 490 pp. Print ISBN: 978-1-4665-9631-3 68 Suggested Price: $79.95 / £49.99 eBook ISBN: 978-1-4665-9632-0 December 2013, 6-1/8 x 9-1/4, 168 pp. Suggested Price: $49.95 / £31.99
P-M Analysis Quick Changeover for Operators An Advanced Step in TPM Implementation The SMED System Shirose Kunio, Mitsugu Kaneda, and Yoshifumi Kimura Shigeo Shingo This illustrated implementation manual provides a thorough step-by-step SMED (Single-Minute Exchange of Die) is a method that procedure for implementing P-M Analysis, along with practice exercises facilitates equipment or product changeovers in record and graded examples. It is an unparalleled resource for anyone with a basic time--often less than 10 minutes. Developed from, A knowledge of TPM who is ready to fine-tune their loss-reduction activities. Here, Revolution in Manufacturing: The SMED System (cat no. finally, is a root-cause analysis method that will help teams achieve the ultimate PP9903), written for managers, this book is intended for goal of zero losses. frontline production and assembly associates. It explains why SMED is important and examines the basic stages of SMED. The authors Print ISBN: 978-1-56327-312-4 organized the material into chunks of information that can be covered in a series eBook ISBN: 978-1-4822-5333-7 of short sessions. Each chapter includes reflection questions to stimulate group September 2004, 8-1/2 x 11, 200 pp., Soft Cover discussion. A Learning Package is also available (catalog no. PP7126). Suggested Price: $68.95 / £43.99 Print ISBN: 978-1-56327-125-0 June 1996, 7 x 10, 96 pp., Soft Cover Suggested Price: $37.95 / £23.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: May 1994,8-1/2x11,416pp. Print ISBN:978-1-56327-036-9 or implementingextensiveimprovement, thistextisaninvaluableresource. organizations managinglargeequipment,facinglowoperator/machineratios, equipment andprocessimprovement,qualitymaintenance.For all including processlossstructureandcalculation,autonomousmaintenance, they demonstratehowtoanalyzeprocessenvironmentsandequipmentissues original Japan InstituteofPlantMaintenancetomodifythe lndustries bringstogethertopconsultantsfromthe toward theirspecificneeds.TPMinProcess but untilnowhavelackedforprogramsdirected for collaborativeequipmentmanagementsystems, Process industries have a particularly urgent need Tokutaro Suzuki TPM inProcessIndustries Suggested Price: April 1996,7x10,137pp.,SoftCover Print ISBN:978-1-56327-080-2 Workshop Leaders. extensive TPMtrainingprogram,especiallywhenpairedwiththeGuidefor often raisesforoperators.Conciseandaccessible,itcanbeusedaspartofan Based onactualimplementations,thisbookaddressesthechallengeswhichTPM that canhelpextendmachinelifeandpreventstoppages. to participateinandeveninitiateroutinemaintenance important manufacturingstrategythatencouragesthem aspects of TPM, introducing frontline workers to this a company-wideTPMinitiative.Itcoversthemain needs tobecommunicatedoperatorswhenfacilitating Operator covers the information that TPM for Every Japan InstituteofPlantMaintenance Operator TPM forEvery Suggested Price: April 1985,6x9,384pp. Print ISBN:978-0-915299-03-4 studies. hundreds ofillustrationsandphotographs,aswelltwelvechapter-lengthcase techniques forapplyingSMED.Thecriticallyacclaimedtextissupportedwith andpracticeoftheSMEDsystem,explainingfundamentalsaswell the theory production andmakesmalllotinventoriesfeasible.Theauthordelvesintoboth a manufacturingenvironmentinwaysthatwillspeedup detailed instructionsavailableanywherefortransforming just intimeproductiontool.Itoffersthemostcompleteand ofthispowerful in Manufacturingprovidesafulloverview (single-minute exchangeofdie)forToyota, ARevolution Written bytheindustrialengineerwhodevelopedSMED Andrew P. DillonandShigeoShingo The SMEDSystem A RevolutioninManufacturing . In this volume, TPM DevelopmentProgram.Inthisvolume, $121.95 /£77.99 $37.95 /£23.99 $109.95 /£69.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Value Streams Creating MixedModel Suggested Price: May 2015,6-1/8x9-1/4,375pp. Print ISBN:978-1-4822-5237-8 with thewrongskills. skills intheworkforce asbabyboomersretireandgenerationYshowsupforwork edition emphasizes activities readers can use to make up for the gradual loss of compliance with emerging international standards forassetmanagement. This cloud computing,tosupportmaintenancedepartmentsandsetthestagefor increasingly complextechnologies,suchasmobileand This third edition of a bestseller reveals how to deal with lower costs,andimprovedenvironmentalperformance. deliver fewer breakdowns, more productive capacity, Uptime, describesthecombinationofactivitiesthat John D.CampbellandJamesV. Reyes-Picknell Management, ThirdEdition Strategies forExcellenceinMaintenance Uptime Suggested Price: May 2015,8-1/2x11,160pp.,Soft Cover Print ISBN:978-1-4822-4768-8 all ofthecalculationsrequired. required for process VSM data boxes and uses the example process to illustrate and usesittodescribeindetailhowcreatetheVSM.Itdefinesallofterms adjustments to traditional VSMs, unique featuresofprocessoperationsandwhytheyrequireadditions and Value manufacturing operation. Describing Stream Map for a process industry This bookdescribesindetailhowtocreateacomplete Jennifer S.King Lean DynamicsLLC,Newark,Delaware,USA Peter L.King Value StreamMaps Optimizing ProcessFlowUsing the ProcessIndustries Lean Mappingfor Suggested Price: July 2012,8-1/2x11,258pp.,SoftCover eBook ISBN:978-1-4398-6844-7 Print ISBN:978-1-4398-6843-0 resource. Thebook includesaCDwithspreadsheets,samples,andcasestudies. lanes. He discussestheconceptofaguaranteedturnaroundtimeforshared concepts onsequencingwork,suchasoffsetschedulingandsequencedFIFO advanced techniquestocreateflowthroughsharedresources andprovidesnew resources tosupportmixed modelproduction.Theauthordemonstrates concept oftaktinmixedmodel.It includesanewsectiononhandlingshared new informationonconstructingproductfamilymatricesandexpandsthe sections onmixedmodelvaluestreams.Itintroduces This secondeditionofabestsellerprovides updatesto Duggan Associates,NorthKingstown,RhodeIsland,USA Kevin J.Duggan Building toDemand,SecondEdition Practical LeanTechniques for $49.95 /£31.99 $59.95 /£38.99 $65.95 /£41.99
the book describes an actual process operation
the the 69 Tools & Methods / Value Stream Management Mapping the Textbook Value Stream Mgt. / Facility Management & Plant Engineering Total Value Stream Bodyspace A Comprehensive Guide Anthropometry, Ergonomics and the for Production and Design of Work, Third Edition Transactional Processes Stephen Pheasant Mark A. Nash University of Surrey, Guildford, UK Pelco Products, Edmond, Oklahoma, USA Christine M. Haslegrave Sheila R. Poling University of Nottingham, UK Pinnacle Partners, Inc., Oak Ridge, Tennessee, USA This third edition maintains the same content and structure as previous editions, While other books focus on either production process Value Stream Mapping but updates the material and references to account for recent developments in (VSM) or transactional process mapping, this work meets the needs of the field, including new research findings and anthropometric surveys. Chapters manufacturers and service sector organizations by detailing both. It teaches on Health and Safety and Ergonomics in the Office are substantially revised to readers what techniques are commonly applicable, and also explains areas of include new research, techniques, and changes in legislation that have taken difference, so that mappers will be able to adapt to whatever situations arise. place in recent years. The book includes information on new and revised Extending the lessons originally put forward in Value Stream Management for the international standards and regulations; introduces new approaches to risk Lean Office, this work goes beyond theory. Among other practical considerations, management and new assessment tools; and offers information on a variety of it expands the concept of availability, discussing employees as well as equipment computer input devices, “hot desking,” and children’s use of computers. availability in transactional processes. Print ISBN: 978-0-415-28520-9 Print ISBN: 978-1-56327-359-9 July 2005, 6-1/8 x 9-1/4, 352 pp. June 2008, 8-1/2 x 11, 296 pp., Soft Cover Suggested Price: $87.95 / £55.99 Suggested Price: $59.95 / £37.99
Value Stream Management Boiler Operator’s Handbook Eight Steps to Planning, Mapping, Second Edition and Sustaining Lean Improvements Edited by Don Tapping, Tom Luyster, and Tom Shuker Kenneth E. Heselton, PE KEH Energy Engineering, Joppa, Maryland, USA Value stream management simplifies planning for lean implementation. It links the metrics and reporting This book was written specifically for boiler plan required by management with the tools needed on the operators and supervisors who want to learn how to manufacturing floor. In this volume, the authors stress lower plant operating costs, as well as how to operate the importance of reaching beyond single-point kaizens plants of all types and sizes more wisely. It is newly to ensure a sustainable lean implementation process. The central feature of this revised with guidelines for HRSGs, combined cycle systems, and environmental work is the value stream management storyboard, a tool representing an eight- effects of boiler operation. Also included is a new chapter on refrigeration step process for lean implementation. The storyboard brings together people, systems that addresses the environmental effects of inadvertent and intentional tools, metrics, and reporting into one visual document. The book is packaged discharges of refrigerants. with a CD containing a lean assessment tool and a storyboard template, as well Print ISBN: 978-1-4822-5389-4 as charts, forms, and worksheets. May 2014, 8-1/2 x 11, 488 pp. 70 Print ISBN: 978-1-56327-245-5 Suggested Price: $179.95 / £114.00 May 2002, 8-1/2 x 11, 176 pp., Soft Cover Suggested Price: $62.95 / £39.99
Automated Diagnostics and Boiler Plant and Distribution Analytics for Buildings System Optimization Manual Edited by Third Edition Barney L. Capehart, Ph.D., C.E.M. Harry R. Taplin, Jr., P.E. University of Florida, Gainesville, USA Retired, Thousand Oaks, California, USA Michael R. Brambley, Ph.D. The Third Edition of the Boiler Plant and Distribution The purpose of this book is to share information with System Optimization Manual has been upgraded a broad audience on the state of automated fault with ten new checklists with over 100 ways to improve detection and diagnostics for buildings applications, performance with 50 additional illustrations to communicate specific information the benefits of those applications, emerging diagnostic technology, examples of about applying these technologies. The new checklists serve as a handy reference field deployments, the relationship to codes and standards, automated diagnostic for designing an energy plan for your plants. Understanding that funds for energy tools presently available, guidance on how to use automated diagnostics, and come directly from your bottom line, this book has been designed for those related issues. tasked with increasing profits by reducing fuel costs while also reducing pollution Print ISBN: 978-1-4987-0611-7 and carbon footprints with attention to plant safety. The author presents many September 2014, 8-1/2 x 11 complex boiler-related topics in a simple and understandable way to simplify the Suggested Price: $179.95 / £114.00 decision-making process. Print ISBN: 978-1-4822-6078-6 July 2014, 8-1/2 x 11, 345 pp. Suggested Price: $99.95 / £63.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: November 2012,8-1/2x11,950pp. Print ISBN:978-1-4665-7828-9 working aidsareprovidedthroughout. natural gaspurchasing. Detailedillustrations,tables,graphs,and otherhelpful contracting,and alternative energysystems,building envelope, performance buildings. Revisedchapterscovermotorsanddrives,HVAC systems,lighting, green commissioning, measurementandverification,highperformance edition includessignificantupdatestoenergymanagementcontrolssystems, professionals throughout the industry. Newly revised and edited, this eighth reference, usedbythousandsofenergymanagement as thedefinitivestand-aloneenergymanager’s desk This comprehensivehandbookhasbecomerecognized Professor Emeritus,OklahomaStateUniversity, Stillwater, USA Wayne C.Turner Energy Engineer, ColoradoSpringsUtilities,Colorado,USA Steve Doty Eighth Edition Energy ManagementHandbook Suggested Price: March 2014,6x9,225 pp. Print ISBN:978-1-4822-2884-7 Investment andlifecyclereplacementofequipmentarealsocovered. already funded.Capitalimprovementopportunities,andevaluatingReturnon gained byimplementingnocostchangesoralternatemaintenanceactivities be energy efficiencyanddescribestheoperationalefficienciesthatcan discusses thedifferentbuildingcomponentsandsystemshowtheyaffect the findings and documenting the plan. The book conditions, analyzing the opportunities, and reporting and cost-basedopportunities,assessingthecurrent energy consumption.Itexplainstheoperational for auditing building operation to identify and reduce This bookoutlinesasimpleandeasy-to-followprocess Scott Offermann,CEM,CFM,MBIFM Reduction Plan Creating aStrategicEnergy Suggested Price: May 2013,7x10,253pp.,SoftCover eBook ISBN:978-1-4665-7113-6 Print ISBN:978-1-4665-7112-9 business systemmodel. successful andenvironmentallysustainablebyadoptingtheleangreen while generatinggreenvalue,thebookexplainshowtobecomeeconomically the wholecompany. Outliningasystematicwaytoeliminateharmfulwaste exist intheirintegration,highlightingtheimportanceofaculturalshiftacross green –discussingtheirevolutionindependentlyaswelltheopportunitiesthat and enhanceglobalprosperity. Itexploreslessunderstoodaspectsof lean and simultaneously reducedependenceonnaturalresources This bookoffersopportunitiesforinnovationthatcan and PeterHines Keivan Zokaei,HunterLovins,AndyWood, and Sustainability Techniques forImprovingProfits Green BusinessSystem Creating aLeanand $259.95 /£165.00 $129.95 /£82.00 $31.95 /£19.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Handbook ofEnergyAudits Suggested Price: June 2008,7x10,624pp. eBook ISBN:978-1-4398-9016-5 Print ISBN:978-1-4200-6626-5 chapter includesasetofreviewquestionsforself-study. offers queuingandmodelsalongwithsimulationexamples.Each and teststhemusingsoftwareavailablefordownloadontheweb.Anappendix exercise evaluationmodels problems.Thetextpresentsanalyticalperformance of a bestseller, it features updated multimedia tools, new software, and additional development throughanalyticalmodels.Thethirdedition design practical aspectsofimplementingpreliminary andpractice.Itprovidesanunderstandingofthe theory facilities, thisbookstrikesahealthybalancebetween Delineating theproperdesign,layout,andlocationof Sunderesh S.Heragu Third Edition Facilities Design Textbook Suggested Price: 2013,6x 9, 486pp. February Print ISBN:978-1-4665-6161-8 sample problems. projects. Thetextisthoroughlyillustrated withtables,graphs,diagramsand HVAC, utility, processandbuildingsystemsforbothnewdesignretrofit the principles of energy engineering and management to the design of electrical, financing energyprojects.Thisreference willguideyoustepbyinapplying control systems,energymanagement,compressedairsystemoptimization and auditing, wasteheatrecovery, utilitysystemoptimization,HVAC, cogeneration, the energy industry. Itincludeschapters on energyeconomic analysis, energy ISO 50001,thiseditioncoversthelatestupdatestocodesandstandards in With newchaptersonelectricalsystemoptimizationand Bradley University, Peoria,Illinois,USA D. PaulMehta Association ofEnergyEngineers,Atlanta,Georgia,USA Albert Thumann Seventh Edition Engineering Handbook ofEnergy Suggested Price: November 2012,6x9,495pp. Print ISBN:978-1-4665-6162-5 responsible forconductingoroverseeingafacilityenergyaudit. forms, checklistsandhandyworkingaids,bookisrequiredreadingforanyone your utilitybillandusingthatknowledgetotrimenergycosts.Loadedwith of return and life cycle cost analysis. Also covered isinformation on understanding Clear, easy-to-followinstructionsguideyouthroughaccountingprocedures,rate any typeoffacility, includingelectrical,mechanicalandbuildingsystemsanalysis. out a thorough and accurate energy audit of and carrying and computersoftwarewhichwillguideyouinplanning buildings and industry. Topics include energy assessment and practicalreferenceavailableonenergyauditingin This best-sellinghandbookisthemostcomprehensive and William J.Younger Albert Thumann,Terry Niehus, Ninth Edition $159.95 /£102.00 $129.95 /£82.00 $129.95 /£82.00
71 Facility Management & Plant Engineering High-Performance Buildings Mechanical Tolerance Stackup A Guide for Owners & Managers and Analysis Anthony Robinson, MS Second Edition This book provides a blueprint for action for readers Bryan R. Fischer making decisions about how to improve the energy Advanced Dimensional Management, Sherwood, Oregon, USA efficiency and performance of new or existing buildings. Facility Management & Plant Engineering Suitable for both seasoned veterans and new managers, it Series: Mechanical Engineering takes an objective and orderly approach to what is often Written by one of the foremost authorities in the field, a complex, costly, and time-consuming process. The this newly revised reference presents the necessary book presents fundamental principles illustrated with case studies. It thoroughly background and proven step-by-step procedures for solving both simple and covers the topics in a concise, technically accurate way. The book is designed for complex tolerance analysis problems. Using the techniques described in this architects, engineers, and construction managers. text, design engineers can ensure that parts and assemblies will satisfy their Print ISBN: 978-1-4398-5199-9 intended functions. In addition, manufacturing, inspection, assembly, and November 2013, 6 x 9 service personnel can use the methods discussed to troubleshoot designs, verify Suggested Price: $149.95 / £95.00 in-process steps will meet objectives, and find ways to improve performance and reduce costs. This new edition includes many updates and improvements to provide a clearer, easy-to-understand, comprehensive volume. Print ISBN: 978-1-4398-1572-4 eBook ISBN: 978-1-4398-1573-1 April 2011, 6 x 9, 508 pp. Suggested Price: $154.95 / £99.00 Textbook Instrumentation for Process MOST Work Measurement Measurement and Control Systems Third Editon Third Edition Norman A. Anderson K. B. Zandin The perennially bestselling third edition of Norman A. H. B. Maynard and Company, Inc., Anderson’s Instrumentation for Process Measurement Pittsburgh, Pennsylvania, USA and Control provides an outstanding and practical Industrial Engineering: A Series of Reference Books and Textbook reference for both students and practitioners. It introduces the fields of This book is an essential guide for those in training for process measurement and feedback control and bridges the gap between their MOST® certification and a great value to anyone basic technology and more sophisticated systems. Keeping mathematics to a looking to enhance their marketability to prospective employers. Revised minimum, the material meets the needs of the instrumentation engineer or to accommodate the evolving needs of current and emerging industries, the technician who must learn how equipment operates. It covers pneumatic and third edition clarifies the working rules and data card format for BasicMOST®, electronic control systems, actuators and valves, control loop adjustment, MiniMOST®, and MaxiMOST®; presents a thorough description of the application combination control systems, and process computers and simulation. of AdminMOST™, a version of BasicMOST® for measuring administrative tasks in Print ISBN: 978-0-8493-9871-1 retail, banking, and service environments; and contains new photographs and October 1997, 6-1/8 x 9-1/4, 512 pp. illustrations. It is an excellent resource for practicing professionals and newcomers 72 Suggested Price: $115.95 / £73.99 in the fields of industrial engineering and management. Print ISBN: 978-0-8247-0953-2 December 2002, 6 x 9, 552 pp. Suggested Price: $121.95 / £77.99
Lighting & Controls OEE for Operators Transitioning to the Future Overall Equipment Effectiveness Productivity Press Development Team Stan Walerczyk, CLEP, HCLP, LC Consultant Overall Equipment Effectiveness (OEE) is a crucial This book helps you make good lighting decisions and measure in TPM that reports on how well equipment is will be a very useful hands-on tool for anyone involved running. It factors three elements ---the time the machine with engineering, maintenance, purchasing, specification, is actually running, the quantity of products the machine retrofits, remodels, and new construction for interior or is turning out, and the quantity of good output – into a exterior lighting applications. It gives very practical ways single combined score. Directly addressing those who are to maintain and update existing lighting systems and how to plan for the future. best positioned to track and improve the effectiveness of equipment, OEE for Key points include LED lighting, maintenance costs, achieving low power density, Operatorsdefines basic concepts and then provides a systematic explanation of disadvantages of LED T8s, and human centric lighting. how OEE should be applied to maximize a piece of equipment’s productivity and recognize when its efficiency is being compromised. Print ISBN: 978-1-4822-3683-5 March 2014, 6 x 9, 250 pp. Print ISBN: 978-1-56327-221-9 Suggested Price: $119.95 / £76.99 August 1999, 7 x 10, 96 pp., Soft Cover Suggested Price: $37.95 / £23.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,73/8x91/4,400 pp. Print ISBN:978-1-4200-7048-4 advanced managementconcepts,makingitaone-stop,essentialresource. medium-, andshort-termproductionactivitiesaswellsupportfunctions and planning andcontrolmaterialsrequirements. Thebookillustrateslong-, plant location,layoutplanning,andmaterialsplanning.Italsocoversproduction design,facilitiesand through productionactivities,suchasprocessandservice with thenatureandscopeofproductionmanagement,guidingstep-by-step production andoperationsmanagementactivities,thisreferenceworkbegins As anauthoritativepresentationofactivities,functions,andconcepts of Rukukmani DeviInstituteofAdvancedStudies,Delhi,India Vijay KumarKhurana Edited by Production andOperationsManagement Suggested Price: August 2006,7x10,288pp. eBook ISBN:978-1-4200-2000-7 Print ISBN:978-0-8493-3376-7 and rollerbearings,fastenerfailures,V-belts, andsynchronousbelts. ductile andbrittleoverloadfailures,high-low-cyclefatigue,lubrication,ball includes physicalfailureanalysis,basicmaterialsproperties,differencesbetween offers chartsthatillustratehowtoidentifyspecificfailure.Additionalcoverage examines manyofthecriticaloperatingdetailsinanaccessiblemannerand mechanisms appearincomponentssuchasshafts,bearings,andgears,it mechanisms, wear, corrosion,overload,andfatigue.Showinghowthefailure mechanisms andhowtoidentifythem,PracticalPlantFailureAnalysisdescribes Providing aclearexplanationofthemajorfailure Series: MechanicalEngineering Sachs, Salvaterra&AssociatesInc.,Syracuse,NewYork, USA Neville W. Sachs Equipment Reliability Deterioration andImproving A GuidetoUnderstandingMachinery Practical PlantFailureAnalysis Available forsaleinNorthAmericaonly Suggested Price: September 2013,6x9,288pp.,SoftCover Print ISBN:978-1-4665-9004-5 organizations. becoming amethodologyforaffectingandinfluencingtheprofitabilityofmost of enablingthecorebusinessacompanytofunctioneffectivelyandisfast recognizes thatitisbecomingmorevitalinitsrole and constantlymovingrequirementsofFM management. Itshowstheformalbasisforcomplex guide totheincreasinglyimportantsubjectoffacilities This bookprovidesareadilyaccessibleandpractical Blackburn College,Lancashire,UK Ian C.Barker Facilities Management A PracticalGuideto $99.95 /£60.99 $132.95 /£85.00 $89.95
For more informationand acompletelistof titles,visitusat www.crcpress.com
Suggested Price: 2014,6-1/8x9-1/4,603pp. February eBook ISBN:978-1-4665-9049-6 Print ISBN:978-1-4665-9048-9 Organization Building aGlobalLearning Suggested Price: October 2013,8-1/2x11,556pp. Print ISBN:978-1-4822-2864-9 andlowlifecyclecost. how toaccomplishbest-of-classperformance and allconceivablefacetsofpumpingtechnology, thistextdescribesindetail component upgrading,maintenancecostreduction,operation,troubleshooting marked byinvolvementinpumpspecification,installation,reliabilityassessment, safety andreliability. Written bypracticingengineers whoseworkingcareerwas lengths, lowmaintenanceexpendituresandunexcelled pump usersareconsistentlyachievingsuperiorrun This textexplainsjusthowandwhythebest-of-class Consultant, Geneva,NewYork, USA Allan R.Budris Consultant, West DesMoines,Iowa,USA Heinz P. Bloch Life Extension,FourthEdition Pump User’s Handbook incentive structures. incentive structures. make-up, technologicaldevelopment, public-policyconcerns,andinstitutional studies illustratethedifferencesineach country’s naturalendowments,cultural studies providereaderswithpolicy, business, andsocietalperspectives.Thecase best practicesofvariouscountrieson this topicofcriticalimportance.The case green powerproductionanddissemination,itdescribestheexperiences and energy productionaroundtheworld.Presentingeightin-depthcasestudies of ofthecurrentstategreen power andrenewableelectrical systematic overview Green Power:PerspectivesonSustainableElectricityGenerationprovidesa The WhartonSchool,UniversityofPennsylvania,USA Mauro F. Guillén Saint Joseph’s University, Philadelphia,Pennsylvania,USA Joao NeivadeFigueiredo Edited by Electricity Generation Perspectives onSustainable Green Power Suggested Price: June 2014,7x10,237pp.,SoftCover eBook ISBN:978-1-4987-0064-1 Print ISBN:978-1-4822-1363-8 the stumblingblocksencounteredandhowtheywereovercome. describes thecriticalelementsthatmadeimplementationasuccessaswell organization andimplementationmodelsusedbytheLEGOGroup,thisbook implementation ofLEGO’s worldwideLearningOrganization.Completewiththe the planning and Graupp collaborates with two practitioners who performed multiple languageandculturalplatforms.ShingoPrize-winningauthorPatrick the TWIprograminordertocreateandsustainstandardizedworkacross developed aglobalstructureforlearningaround This bookdescribeshowamultinationalcompany Patrick Graupp,GitteJakobsen,andJohnVellema LEGO Group Workforce Expansioninthe Using TWItoSucceedwithStrategic $69.95 /£44.99 $179.95 /£114.00 $49.95 /£31.99
73 Facility Management & Plant Eng. / Implementation - Case Studies Grow Your Factory, Lean Safety Gemba Walks Grow Your Profits A Methodology for Workforce Lean for Small and Medium-Sized Engagement and Culture Change Manufacturing Enterprises Robert B. Hafey RBH Consulting LLC, Homer Glen, Illinois, USA Timothy McLean TXM Lean Solutions Pty. Ltd., Australia This book is a follow-up to the author’s bestselling book, Lean Safety, published in 2010. It is a natural progression Around 90 percent of manufacturing businesses are from the philosophical overview provided by Lean Safety classed as SME’s yet almost all the literature about Lean to the reality of the application of those principles in is targeted at big businesses. The few books aimed at SMEs focus on Lean Implementation - Case Studies facilities around the world. Throughout the book, the author takes readers on a tools and techniques and how these can be adapted to smaller businesses. Tim journey of discovery using gemba walk case studies. Readers will learn about the Mclean’s book takes a different approach. Tim calls on his 25 years of experience importance of employee engagement and culture change. managing and improving over 100 SME manufacturing businesses. Tim focuses on the problems he sees over and again in SME manufacturers and presents Print ISBN: 978-1-4822-5898-1 practical solutions, backed up by case studies showing how these problems can December 2014, 7 x 10, 175 pp., Soft Cover be overcome using Lean principles. Suggested Price: $39.95 / £25.99 Print ISBN: 978-1-4822-5585-0 December 2014, 7 x 10, 184 pp., Soft Cover Suggested Price: $39.95 / £25.99
Lean Today, Rich Tomorrow Succeeding in Today’s Implementing TWI Globalization Chaos Creating and Managing Joe Bichai a Skills-Based Culture This book tells the story of an actual Lean transformation that took place in a 100-year-old North American Patrick Graupp and Robert J. Wrona TWI Institute, Liverpool, New York, USA manufacturer’s factory. Lean Today, Rich Tomorrow: Succeeding in Today’s Globalization Chaos describes Featuring modern implementation strategies employed how an obsolete factory destined for closure was in Lean initiatives, this volume describes the experiences transformed into the most productive North American manufacturer in its field. of a variety of companies using TWI (Training Within It describes how the company eliminated the bad habits associated with its Industry). Based on their experience implementing TWI in antiquated push system and transformed its factory into a JIT/Lean philosophy- companies across the world, Graupp and Wrona highlight critical elements and driven plant with one-piece flow, U-shaped production lines, and productivity point out key stumbling blocks to successful TWI implementation. This hands-on sharing. manual includes case studies as well as a variety of updated tools and templates. Print ISBN: 978-1-4822-3564-7 Print ISBN: 978-1-4398-2596-9 September 2014, 6-1/8 x 9-1/4, 219 pp. November 2010, 7 x 10, 500 pp., Soft Cover Suggested Price: $49.95 / £31.99 74 Suggested Price: $59.95 / £37.99
Lean Safety Manufacturing Transforming your Safety Culture Technology Transfer with Lean Management A Japanese Monozukuri View Robert Hafey of Needs and Strategies RBH Consulting LLC, Homer Glen, Illinois, USA Yasuo Yamane Written by a leader in Lean implementation with more Hiroshima University, Japan than 30 years of experience, this book provides the Tom Childs knowledge necessary to both assess and improve safety University of Leeds, West Yorkshire, UK programs by using Lean tools and techniques. The Based on first-hand experience transferring technology between Japan and text focuses on cultural change, leadership, improvement methodologies, other countries, this book offers information, advice, and methods for successful investigations designed to get at root causes, and the standards and metrics transfer of technology and the skills to use it. It covers skill transfer, production required to maintain and track a fluid approach to safety. The author takes management, and manufacturing company classification with new surveys of lessons learned from Lean and applies them to the building of a world-class changing Japanese company views on benefits and needs of transfer. It also safety-first organization. includes case studies of transfers in the ship building and food equipment Print ISBN: 978-1-4398-1642-4 industries. The authors provide readers with a sound understanding of the eBook ISBN: 978-1-4398-1643-1 breadth of issues involved to arm manufacturing engineers with the skills needed December 2009, 7 x 10, 186 pp., Soft Cover for successful skills and technology transfers. Suggested Price: $47.95 / £29.99 Print ISBN: 978-1-4665-6763-4 eBook ISBN: 978-1-4665-6765-8 March 2013, 6-1/8 x 9-1/4, 236 pp. Suggested Price: $62.95 / £39.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2013,7x10,1476pp. eBook ISBN:978-1-4665-1505-5 Print ISBN:978-1-4665-1504-8 queuing systems,reliabilitysystemsand tools,andsixsigmatechniques. manufacturing systems, material handling systems, process view of work, systems, humansystemsintegration, leansystems,logisticstransportation, control charts,engineeringeconomy, health operationalefficiency, healthcare new systemsengineeringtools,techniques,andmodels.Newcoverageincludes a conciseformat.Itexpandsthebreadthanddepthofcoverage,emphasizing easy accesstoawiderangeofindustrialengineeringtoolsandtechniques in engineering text,thisbookprovidesstudents,researchers, andpractitionerswith A new editionof the bestselling industrial and systems Industrial InnovationSeries Air Force InstituteofTechnology, Dayton,Ohio,USA Adedeji B.Badiru Edited by Second Edition and SystemsEngineering Handbook ofIndustrial Suggested Price: April 2015,7x10,672pp. Print ISBN:978-1-4665-0433-2 ofthearea. an overview applications, it is accessibleto graduate students and new researchers needing and designsforthelatestapplications.Balancingcoverageofmethodology designs, optimalcomputerexperiments,issuesthatspanvariousfields, andgeneralprinciples,designsforlinearmodels,fractionalfactorial history experiments andtheiranalyses.Dividedintosevenparts,thebookcovers andapplicationsofdesigned of theartintheory edited collectionofchaptersthatexplorethestate This handbookpresentsacomprehensive,carefully Methods Series: Chapman&Hall/CRCHandbooksofModernStatistical and JohnStufken Derek Bingham,DrAngelaDean,MaxMorris, Analysis ofExperiments Handbook ofDesignand Suggested Price: March 2014,6-1/8x9-1/4,444pp. eBook ISBN:978-1-4665-9608-5 Print ISBN:978-1-4665-9607-8 procurement ofresources. identification, teambuilding,projectandprogramqualitymanagement, methods andtechniquesforcriticalbusinessfunctions,includingstakeholder can usethebooktolookupexamplesthatdescribevariouswaysagile author’s companyhelpedclientsreachimportantbusinessobjectives.Readers with theirstrategicinitiatives.Itillustrateswide-rangingsituationswherethe the author’s organization over the last 25 years helping their clients succeed expected byallstakeholders.Itpresentsinsightsgained implement, andgovernastrategythatdeliversthebenefits This bookdetails ESI InternationalProjectManagementSeries Lyngso Informatique Soren Lyngso and Improvement Techniques forContinuousAlignment Agile StrategyManagement $177.95 /£113.00 $119.95 /£76.99 $79.95 /£49.99 what ittakesto
For more informationand acompletelistof titles,visitusat www.crcpress.com initiate, develop, initiate, develop,
Key EngineeringMaterials Suggested Price: 2014,6x9,584pp. February eBook ISBN:978-1-4822-2422-1 Print ISBN:978-1-926895-73-4 manufacturing industry. which thesenovelmaterialsandprocessesareintegratedintotoday’s functioning presenting specificmaterials,thenprogressesintoadiscussionofthewaysin emphasizing the rapidlygrowing technologies. It takes a unique approachby chain. Itintroducesstate-of-the-arttechnologyinkeyengineeringmaterials, book summarizingallaspectsinvolvedinthefunctionalmaterialsproduction materials, thisbookprovidesasingle,comprehensive With coverageofabroadrangekeyengineering Devrim Balköse,DanielHorak,andLadislavŠoltés Edited by Novel Materials Current State-of-the-Arton Volume 1, Key EngineeringMaterials Suggested Price: December 2014,6-1/8x9-1/4,516 pp. Print ISBN:978-1-4665-7145-7 redefining practicesfromscratch. and adaptthesepracticestosuittheir specific applicationdomain,thusavoiding in diversedomains.Readerscanalso identifytheirsystemsengineeringneeds reference bookprovidestheM&Spractices forsupportingsystemsengineering is notavailableinthesystemsengineeringcommunity. Thismulti-contributed representation. To date,a handbookthatincludesestablishedM&Spractices manage systemscomplexityandinvestigatesystembehaviorsthroughvirtual systems becauseitenablesdesignersandresearchers to a centralactivityinthedevelopmentofnewandexisting Modeling and simulation (M&S)is increasingly becoming Series: EngineeringManagement and AndreasTolk Daniele Gianni,AndreaD’Ambrogio, Edited by Systems EngineeringHandbook Modeling andSimulation-Based Suggested Price: 2014,6x9,430pp. February eBook ISBN:978-1-4822-2427-6 Print ISBN:978-1-926895-74-1 efficient algorithmsforchemicalsoftwareandpolymerengineering. chemical databases and the development of new computational methods and industrial polymersandbiotechnologyaswellincludesthelatestcoverageof methodologies andimportantapplicationsinthefieldsofindustrialchemistry, the industry. Itpresentssignificantresearch andreviewsreportingnew a mediumformutualcommunicationbetweeninternationalacademiaand among chemists,biologists, and polymer andchemicalengineersprovides educational, scientific,andindustrialresearch activities This bookprovidesinnovativechaptersonthegrowthof and OmariV. Mukbaniani François Kajzar, EliM.Pearce, NikolaiA.Turovskij, Edited by ConceptsandResearchInterdisciplinary Volume 2, $149.95 /£95.00 $129.95 /£82.00 $149.95 /£95.00
75 Manufacturing & Industrial Engineering Textbook Systems Engineering Simplified Manufacturing & Industrial Eng. / Processing Production and Operations Robert Cloutier, Clifton Baldwin, Management Systems and Mary Alice Bone Sushil Gupta Although there are many facets of systems engineering, Florida International University, Miami, USA it basically can be explained as focusing on addressing Martin Starr “why” a system is needed, “what” the system must do, Rollins College, Winter Park, Florida, USA and then “how” the system will accomplish the task over the entire life of the system - from conception to disposal. The evolving field of production and operations Designed for student systems engineers, this book management (P/OM) is reflected in this P/OM text. provides a holistic understanding of systems engineering while they consider Proper management of the supply chain beginning with acquisition and ending their applications of fluid power into broader systems. with distribution involves coordination with finance and marketing. We must, therefore, emphasize the systems approach and apply it to the full-scope of Print ISBN: 978-1-4987-0668-1 services as well as manufacturing. With this goal, the book, Production and February 2015, 6-1/8 x 9-1/4, 90 pp., Soft Cover Operations Management Systems covers the major spectrum of decision-making Suggested Price: $39.95 / £25.99 functions from product development to the final delivery of the product to the customer. The book, based on analytical models, makes extensive use of Excel software. International aspects of P/OM are integrated throughout the text. Print ISBN: 978-1-4665-0733-3 eBook ISBN: 978-1-4665-0735-7 Vanishing Boundaries February 2014, 6-1/8 x 9-1/4, 520 pp. How Integrating Manufacturing and Suggested Price: $89.95 / £57.99 Services Creates Customer Value, Second Edition Richard E. Crandall Appalachian State University, Boone, North Carolina, USA Safety Management in William R. Crandall a Competitive Business University of North Carolina, Pembroke, USA Series: Resource Management Environment Presenting the innovative thesis that global competition and supply chain Juraj Sinay complexity are increasing so rapidly that managers must reach across the Technical University of Kosice, Slovak Republic manufacturing and service boundary to gather more universally applicable The book provides information necessary for systematic ideas, this groundbreaking work addresses the unprecedented array of new or management of traditional as well as emerging risks in the aggravated conditions that today’s business managers must face. Businesses man-machine-environment system, especially in industrial need to become more consumer-centric, efficient, and quality conscious. This technologies. It is intended for managerial staff of various book addresses problems, solutions, and implementation strategies as well as risk levels of management as well as product distribution workers, and for education and crisis management, sourcing, healthcare, alternative energy infrastructure, of professionals in the fields of occupational safety and health (OSH), safety of integration of supply chain services, advances in IT, social media, and customer technological systems and partially also civil security. building. Print ISBN: 978-1-4822-0385-1 Print ISBN: 978-1-4665-0590-2 eBook ISBN: 978-1-4822-0386-8 eBook ISBN: 978-1-4665-0591-9 76 March 2014, 6-1/8 x 9-1/4, 204 pp. October 2013, 6-1/8 x 9-1/4, 540 pp. Suggested Price: $99.95 / £63.99 Suggested Price: $94.95 / £59.99
Textbook 7 Fundamentals of an Systems Engineering Operationally Excellent Design Principles and Models Management System Dahai Liu Chitram Lutchman, Douglas Evans, Embry Riddle Aeronautical University, FL, USA Waddah Ghanem, and Rohanie Maharaj
Organized in three parts, this textbook covers systems This book details the seven fundamentals required for and systems engineering concepts, systems methods, exceptional business performance. It provides an easy to models and analytical techniques, systems management follow road map, used by many leading organizations, and control methods. Traditional engineering books are for generating operational discipline and excellence. Demonstrating a either too technical or not technical at all. This book will not only give students sustainable process for continuous improvements in all elements of PSM and exposure to the concepts of systems and systems engineering, but will also an organization’s Management System, the book leverages the principles provide enough technical expertise for them to use and apply what they learn in adopted by leading organizations such as Exxon Mobil, BP, Suncor, and DuPont. their careers right away. It also provides readers with access to workshop slides and graphics for each fundamental concept discussed in the text. Print ISBN: 978-1-4665-0683-1 June 2015, 6-1/8 x 9-1/4, 416 pp. Print ISBN: 978-1-4822-0576-3 Suggested Price: $99.95 / £63.99 January 2015, 6-1/8 x 9-1/4, 448 pp. Suggested Price: $99.95 / £63.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 manual isavailableforqualifyinginstructors. Suggested Price: 2012,6-1/8 x9-1/4,643pp. February eBook ISBN:978-1-4398-9762-1 Print ISBN:978-1-4398-5486-0 MATLAB 50 percent moreexercises andmanyapplicationexamplesofcontrolproblems. this second edition updates and expands the content of its predecessor with information systems.Addressingissuesintoday’s teachingofprocesscontrol, with abroaderperspectiveofmoreintegratedprocessoperation,control, and process controlandthecurrent,expandedrolebyblendingconventionaltopics This classroom-testedtextprovidesabridgebetweenthetraditionalview of Series: ChemicalIndustries University ofCalifornia,Davis,USA Ahmet Palazoglu Louisiana StateUniversity, BatonRouge,USA Jose A.Romagnoli Second Edition Introduction toProcessControl Textbook Suggested Price: June 2013,6-3/4x9-3/4,704pp. eBook ISBN:978-1-315-87948-2 Print ISBN:978-1-138-00046-9 smart materials,sustainablebusinessmodelsandconstruction. renewable energytechnologies,reuseandrecyclingtechniques,smartdesign, green andsmartmanufacturing,transportation,life-cycleengineering, such asecodesignandinnovation,energyefficiency, of thesefields.Thevolumecoverswiderangetopics making asignificantcontributiontofurtherdevelopment sustainable intelligentmanufacturingandrelatedtopics, This bookincludesessentialresearch inthefieldof Helena Bartoloetal. Edited by Manufacturing Processes Green Design,Materialsand Suggested Price: 1996,334pp.,SoftCover February Print ISBN:978-1-85728-338-9 asafoundationformoreadvancedstudy.serve principles ofmanufacturingprocesses,whichshould and stimulatingreadforthoseonfirstcoursesinthe A clearandpracticaltextbookprovidinganauthoritative Fred Waters For Engineers Fundamentals ofManufacturing ® toolboxes can be accessed from the authors’ websites. A solutions toolboxescanbeaccessedfromthe authors’websites.Asolutions $167.95 /£107.00 $294.00 /£187.00 $79.95 /£50.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Materials Engineering High-Performance Process Techniques for Suggested Price: July 2013,6-1/8x9-1/4,244pp. eBook ISBN:978-1-4665-5363-7 Print ISBN:978-1-4665-5361-3 practices, proceduresandbusinessperformance. organizations togeneratecontinuousandsustainedimprovementinwork the benefitsofNetworksandtoproactivelyestablishsupportthemwithin fororganizationstorecognize business. Thisbookprovidesasimplepathforward communities ofpracticesensuresustainedandcontinuousimprovementsin Networksand drives stakeholderconfidenceandcorporateperformance. scarce resources, operationaldisciplineandexcellence In athinmarginsbusinessenvironmentcharacterizedby Rohanie Maharaj,andRameshSharma Chitram Lutchman,DouglasEvans, Continuous Improvement Communities ofPracticefor Leveraging Networksand Process SafetyManagement Suggested Price: December 2010,7x10,709pp. eBook ISBN:978-1-4398-8118-7 Print ISBN:978-1-4200-8927-1 updated costinformationonmaterials, labor, andmachineoperations. mountdevices.Eachchapteralsoincludes power injectionmoldingandsurface changes, andemphasisoncurrenttrendssuchasdesignfor important industry of theapplicationdesignformanufactureandassembly(DFMA)techniques, Chapters havebeenupdatedfrompreviouseditionswithrecentcasestudies more suitableforuseinproductdesignandmanufacturecourses. sets andstudentassignments,makingthisrespectedreferenceworkeven Now initsthirdedition,thisvolumefeaturesnewproblem Series: ManufacturingEngineeringandMaterialsProcessing and Winston A.Knight Geoffrey Boothroyd,PeterDewhurst, Third Edition Manufacture andAssembly Product Designfor Textbook Suggested Price: June 2013,6-1/8x9-1/4,493pp.,SoftCover eBook ISBN:978-1-4665-8189-0 Print ISBN:978-1-4665-8188-3 successes andfailuresinmaterialsdevelopment. solutions tocustomerproblems.Hundredsofreal-worldexamplesillustrate the mostoutofexpensivetrialworkinaplantenvironment,andfindsystems advice on how to foster creativity, avoid the inevitable scale-up problems, get properties arehighlydependentonprocessingvariables.Italsoofferspractical explores R&D strategies for developing products when the individual batches,forbetterorworse.Thisbook of production process can affectthe performance With processedmaterials,subtlevariationsinthe Sealed AirCorporation,SaddleBrook,NewJersey, USA Tim Oberle $104.95 /£65.99 $159.95 /£102.00 $94.95 /£59.99
77 Manufacturing & Processing Roll Forming Handbook Textbook Edited by Business Process Modeling, George T. Halmos Simulation and Design Delta Engineering Inc., Toronto, Ontario, Canada Manufacturing & Processing / Operations Research Series: Manufacturing Engineering and Materials Processing Second Edition
Over 35 percent of all light gauge steel produced in North Manuel Laguna University of Colorado, Boulder, USA America is processed through roll forming lines, and nearly all ductile sheet metals with a thickness between Johan Marklund .004” and .75” can also be roll formed. The Roll Forming Lund University, Sweden Handbook is the first comprehensive guide to all aspects of the roll forming Developed from the authors’ many years of teaching process design and process, from conception to practical know-how. Under the guidance of George simulation courses, this text provides students with a thorough understanding of Halmos, expert contributors share insights based on many years of experience numerous analytical tools that can be used to model, analyze, design, manage, and provide information on roll forming mills, uncoilers, presses, die accelerators, and improve business processes. It presents the tools to design effective business and other equipment. Supplementing this information are discussions on roll processes and the management techniques to operate them efficiently. This design, setup, troubleshooting, materials to be formed, and lubrication. edition includes an introduction to simulation, a new chapter on business process Print ISBN: 978-0-8247-9563-4 analytics, and three completely revised chapters that incorporate ExtendSim 8. eBook ISBN: 978-1-4200-3069-3 Print ISBN: 978-1-4398-8525-3 November 2005, 7 x 10, 584 pp. eBook ISBN: 978-1-4665-8440-2 Suggested Price: $253.00 / £161.00 April 2013, 7 x 10, 523 pp. Suggested Price: $104.95 / £66.99
Sustainable Manufacturing Discrete and Arun N. Nambiar and Adnar H. Sabuwala Continuous Simulation California State University, Fresno, USA Series: Nano and Energy Theory and Practice Susmita Bandyopadhyay and Ranjan Bhattacharya A resource for students and practitioners, this book covers a wide range of topics, including product This text provides a detailed discussion of simulation theory design, supply chain management, performance and its applications. It covers current simulation trends, indicators, implementation framework, information related literature, and the direction of future technologies system, requirements, and mathematical models. as well as input modeling, optimization with simulation, The text features case studies, end-of-chapter review questions, an instructor’s continuous simulation, discrete simulation, hybrid simulation, simulation in manual, as well as online supplemental materials such as PowerPoint slides and supply chains and manufacturing, and simulation for multiple disciplines. It sample exam questions with solutions. It provides practitioners in the industry also describes various probability distributions required for simulation, random with valuable insights into the sustainable manufacturing principles that enable number generation techniques, and explains how to put Microsoft® Excel™, them to effectively use these practices to their maximum benefits. MATLAB®, and Simulink® to practical use in the simulation process. Print ISBN: 978-1-4398-4519-6 Print ISBN: 978-1-4665-9639-9 June 2016, 6-1/8 x 9-1/4, 300 pp. eBook ISBN: 978-1-4665-9640-5 78 Suggested Price: $99.95 / £63.99 June 2014, 6-1/8 x 9-1/4, 375 pp. Suggested Price: $179.95 / £114.00
Applying Analytics Textbook A Practical Introduction Manufacturing Facilities E. S. Levine Location, Planning, and Design, Analytics Professional, New York, New York, USA Third Edition Covering the technical and professional skills needed Dileep R. Sule by analysts in the academic, private, and public sectors, Louisiana Tech University, Ruston, USA this text systematically teaches novices how to apply From plant layout and materials handling to quality algorithms to real data and how to recognize potential function deployment and design considerations, this pitfalls. It concentrates on the interpretation, strengths, book explores topics crucial to the efficiency of a well-planned facility. This and weaknesses of analytical techniques, along with challenges encountered third edition of a classic provides the information and analytical tools necessary by analysts in their daily work. The author also shares various lessons learned to move from product designs to production plans and then details planning from applying analytics in the real world. Example data sets used in the text are techniques needed to build a manufacturing facility where safety, efficiency, and available for download online so that readers can test their own analytic routines. profit are interdependent. It covers Lean manufacturing, supply chain effects, Print ISBN: 978-1-4665-5718-5 aggregate planning, scheduling, resource planning, machine layout models, eBook ISBN: 978-1-4665-5719-2 economic evaluation of processes, and information technology and includes June 2013, 6-1/8 x 9-1/4, 290 pp. mathematical methods and problems. Suggested Price: $71.95 / £45.99 Print ISBN: 978-1-4200-4422-5 eBook ISBN: 978-1-4200-4423-2 December 2008, 6-1/8 x 9-1/4, 824 pp. Suggested Price: $159.95 / £102.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: August 2008,6-1/8 x9-1/4,224pp. eBook ISBN:978-1-4200-5490-3 Print ISBN:978-1-4200-5489-7 for thosewhouseprobabilitytomodel systembehaviors. time Markovchains,andqueueingtheory. asapracticalreference Thetextserves discrete-time Markovchains,Poisson processes, renewalcontinuous- random variables analysis, multiplerandomvariables analysis, Bernoulli processes, offers coverageofallbasicmodelforms, probabilitymodelingfundamentals, With aconcisereviewofthekeycomponentsprobabilitytheory, thisbook models thathaveapplicationsinindustrialengineeringandoperationsresearch. Operations Research provides anintroductiontothe use ofprobabilitytodefine Balancing applicationswithmathematicalrigor, ProbabilityModelsin Operations Research Series Virginia PolytechnicInstituteandStateUniversity, Blacksburg,USA Joel A.Nachlas University ofArkansas,Fayetteville,USA C. RichardCassady Operations Research Probability Modelsin Textbook Suggested Price: May 2012,6-1/8x9-1/4,184pp. eBook ISBN:978-1-4665-1126-2 Print ISBN:978-1-4665-0299-4 familiar toengineeringstudents. physicalphenomena coins, dice and cardsbutmostarebased on observable presented intermsof“ballsurns”.Manyexamplesdorelatetogamblingwith approximations. Animportantaspectofthetextisfactthatexamplesarenot probability anditsaxioms.Itcoversconditionalprobability, independence,and andthenintroduces ofsettheory applications. Thebookbeginswithasummary numerous practicalexamplesbasedonengineering inanaccessiblemannerandincludes covers theory Suitable for a first course in probability theory, this textbook Blacksburg, USA Virginia PolytechnicInstituteandStateUniversity, Joel A.Nachlas for Engineers Probability Foundations Textbook Suggested Price: September 2014,6-1/8x9-1/4,218pp. eBook ISBN:978-1-4822-3991-1 Print ISBN:978-1-4822-3990-4 led toeffectivealgorithmicsolutionapproachesforeachproblemclass. explores specialstructuralresultsandpropertiesofoptimalsolutionsthathave examples oftheproblem’s applicationinoperationsplanningcontexts.Thebook classical models beginswith the motivation for studying the problem as well as widespread applicationinoperationsplanning.Thediscussionofeachthese the KnapsackProblem,itpresentsasetofclassicaloptimizationmodelswith to practical operations planning problems. Startingwith approaches andpowerful book blendsessentialtheory operations planningandoptimizationmodeling,this of A referenceforthoseworkingattheinterface Operations Research Series University ofFlorida,Gainesville,USA Joseph Geunes Mixed IntegerOptimizationModels Operations Planning $125.95 /£79.99 $132.95 /£85.00 $99.95 /£63.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Suggested Price: October 2011,7x10,578pp. eBook ISBN:978-1-4200-7576-2 Print ISBN:978-1-4200-7572-4 other materialareavailableonthebook’s website. life,publicpolicy,situations fromeveryday andindustry. Softwaretutorialsand management, andethicaldilemmas.Numerousexampleshighlightreal-world adding valueandreducingrisk.Theyalsodiscussbias,negotiations,project/risk best alternatives,enablingdecisionmakerstoimproveonthesealternativesby to rationaldecisionmaking.Theauthorsanalyzestrengthsandweaknessesofthe interaction betweendecisionsandmanagementactionclarifiesthebarriers decision andriskanalysis,thistextexplorestheimportant Developed from the authors’ longstanding course on Abbott Laboratories,Park,Illinois,USA Yavuz BurakCanbolat Wayne StateUniversity, Detroit,Michigan,USA Kenneth Chelst for Managers Value-Added DecisionMaking Textbook Suggested Price: December 2005,6-1/8x9-1/4,408 pp. eBook ISBN:978-1-4822-2000-1 Print ISBN:978-0-415-28248-2 lays torestthecommonmythsandmisconceptions thatsurroundergonomics. Drawing ontheauthor’s experienceinbothteachingandindustry, thebook of cognitive as well as physical ergonomics. this one gives a broad overview Unlike mostergonomicsandhumanfactorsbooksthatemphasizethephysical, of coverage and applicability ofthetechniquesfoundinthis second edition. Guide to Ergonomics of Manufacturing , thenewtitlereflectsexpandedrange complete understanding.Buildingonthefoundationoffirstedition, titled approach tohumanfactorsandergonomicsthatleads to HumanFactorsandErgonomicspresentsasystems Written inanaccessiblestyle,thislatesteditionofAGuide Martin Helander Second Edition and Ergonomics A GuidetoHumanFactors Textbook Suggested Price: June 2015,7x10,300pp.,SoftCover Print ISBN:978-1-4822-1894-7 for designingandexecutingexperimentswithconsiderationstatisticalpower. sidebars andamusinganecdotes.Thebookincludesafour-stepplanningprocess complexitieswithinteresting fundamentals. Theylightenuptheinherentlydry authors incorporatealivelyapproachtothelearningof means toanalyzehownumerousvariablesinteract.The effect, thisworkprovidesresearchers withthestatistical Offering aplannedapproachfordeterminingcauseand Stat-Ease Inc,Minneapolis,Minnesota,USA Mark J.AndersonandPatrickWhitcomb Experimentation, ThirdEdition Practical Tools forEffective DOE Simplified $154.95 /£99.00 $104.95 /£66.99 $59.95 /£38.99
79 Operations Research / Product Development Human Factors of Managing Emotion a Global Society in Design Innovation A System of Systems Perspective Amitoj Singh Samsung India Electronics Pvt. Ltd Edited by Tadeusz Marek, Waldemar Karwowski, This book presents an emotion centered research Marek Frankowicz, Jussi Kantola, and Pavel Zgaga framework titled “emoha” for design innovation. It defines emoha and underlines the importance of the developed This book explores the human factors issues in framework in culturalization of technology and thereby contemporary global society, with a focus on design innovation. The book explains the detailed research engineering, technology, business, science, and education from a system of on product styling which leads to the creation of “Emoha” and how to use it in systems viewpoint. It examines the human aspects related to contemporary product design. societal developments in science, engineering, and higher education in the Print ISBN: 978-1-4665-6750-4
Product Development context of unprecedented progress in those areas. The book also discusses new paradigms for higher education, including education delivery, and administration eBook ISBN: 978-1-4665-6751-1 in the coming of the Conceptual Age. August 2013, 6-1/8 x 9-1/4, 228 pp. Suggested Price: $125.95 / £79.99 Print ISBN: 978-1-4665-7286-7 eBook ISBN: 978-1-4665-7287-4 June 2014, 7 x 10, 1177 pp. Suggested Price: $149.95 / £95.00
The Innovative Lean Enterprise Methods in Product Design Using the Principles of Lean to Create New Strategies in Reengineering and Deliver Innovation to Customers Edited by Anthony Sgroi, Jr. Ali K. Kamrani, Maryam Azimi, Director of R&D, Unger Enterprises and Abdulrahman M. Al-Ahmari This book explains how to use Lean principles to drive Customer-focused product design strives to meet changing innovation and strategic portfolio planning. It outlines customer requirements with new product features. This simple yet powerful visual Lean tools that can enhance book discusses ways to assess changing demands and idea generation and product development. It discusses sources, and delves into what is needed to successfully customer value in the form of the benefits customers desire and walks readers manufacture goods in a demanding market. It reviews proven methods for through the processes of using Lean techniques to effectively evaluate the quality assessing customer need. Then, after showing how changing needs impact the of any prospective marketing opportunity. Filled with examples that readers reengineering of products, it explains how needed change can be efficiently can easily relate to, it includes examples from a variety of industries including achieved. It details how IT advances and technology support customer-focused healthcare. product development, discusses cutting-edge mass customization principles that maximize cost-effective production, and illustrates how to implement a web- Print ISBN: 978-1-4822-0390-5 based product design environment. eBook ISBN: 978-1-4822-0391-2 August 2013, 7 x 10, 315 pp. Print ISBN: 978-1-4398-0832-0 80 Suggested Price: $62.95 / £39.99 eBook ISBN: 978-1-4398-0833-7 May 2013, 6-1/8 x 9-1/4, 340 pp. Suggested Price: $94.95 / £59.99
Kansei Innovation The Science of Footwear Practical Design Applications for Edited by Product and Service Development Ravindra S. Goonetilleke Series: Human Factors and Ergonomics Mitsuo Nagamachi Anitawati Mohd Lokman Covering every aspect of the process, this book introduces Universiti Teknologi Mara Malaysia the design, development, manufacturing, and marketing Industrial Innovation Series of footwear. It also presents a comprehensive discussion of how the footwear industry attempts to cater to the Thanks to Apple and smart phone phenomenon, almost wide needs of sophisticated and demanding customers. everyone has realized the emerging trend of user experience in design. Kansei The text provides a basic understanding of the technology and techniques engineering is the method to achieve that. This book defines Kansei and Kansei involved in the design and development of a popular and demanding consumer Engineering, then describes in detail the application and development process. product. Topics include the measurement and testing process, foot and footwear It provides 30 case studies than underscore the concepts and demonstrate their interaction, mass customization, the manufacturing process, and the marketing practical application. Also included are examples of manufacturing, implication process. The author also addresses the latest trends in footwear technology. of worker-oriented philosophy, improvement of working postures, and one-man assembly systems. Print ISBN: 978-1-4398-3568-5 eBook ISBN: 978-1-4398-3569-2 Print ISBN: 978-1-4987-0682-7 November 2012, 6-1/8 x 9-1/4, 726 pp. February 2015, 6-1/8 x 9-1/4, 128 pp., Soft Cover Suggested Price: $157.95 / £99.00 Suggested Price: $79.95 / £49.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: March 1999,7x10,88pp.,SoftCover Print ISBN:978-1-56327-213-4 improvement topics cost-effective approachforbuildingbasicknowledgeaboutkeymanufacturing This volumeispartofProductivityPress’ShopfloorSeries,whichoffersasimple, as wellreflectionquestions,whichcanbeusedtoencouragegroupdiscussions. toreinforce andasummary concepts, wastes. Eachchapterincludesanoverview time, work-in-processinventory, andotherprofit-draining onboardtoreducelead Use thisbooktogeteveryone for participatinginthedesignofanewproductioncell. manufacturing andteamworkconceptsorientsthem Workteams Cellular Manufacturing: One-Piece Flow for Productivity PressDevelopmentTeam One-Piece FlowforWorkteams Cellular Manufacturing Suggested Price: 2015,6-1/8x9-1/4,208pp. January Print ISBN:978-1-4665-7755-8 cellular manufacturingsystemdesign. the handlingofbottleneckmachinesandpartsproblembyimplementing book presentsaconcisereferenceofexistingmethodsthatcanbestbeusedin mitigate riskanduncertaintyassociatedwiththeirbusinessbottom-line.This across thecountyarestrivingtoCellularManufacturingpracticeshelp objectives. Engineeringprofessionalsandbusinessleaders efficiency is constantlyat the forefront ofsuch companies’ and business. The drive toward maximum edge in industry In today’s businessworld,competitivenessdefinesleading Industrial InnovationSeries Lean SixSigmaInstituteofTechnology, Marion,Iowa,USA John X.Wang Mitigating RiskandUncertainty Cellular Manufacturing Suggested Price: December 2005,6-1/8x9-1/4,368pp. eBook ISBN:978-0-203-29995-1 Print ISBN:978-0-415-32220-1 technology-centered traditionindesign. and evaluativetechniquesthatradicallydepartfromthefunctionalist presents aseriesofmeaning-sensitivedesignmethods,illustratedbyexamples, meaning, theauthordevelopsfournewtheoriesofhowartifactsmakesenseand artifacts. Clarifyinghowthesemanticturndiffersfromotherapproachesto andhuman-centeredconceptionsofcontemporary communication theory use, thebookbuildsanbridgebetweenlanguage/ and distinguishedscholarofcommunicationlanguage validate theirdesigns.Written byarecognizeddesigner designers afoundationonwhichtostatetheirclaimsand An indispensableguide,TheSemanticTurn offers University ofPennsylvania,Philadelphia,USA Klaus Krippendorff A NewFoundationforDesign The SemanticTurn introduces production teams to basic cellular introduces productionteamstobasiccellular $37.95 /£23.99 $99.95 /£63.99 $115.95 /£73.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Global ProductionNetworks Suggested Price: December 2013,6-1/8x9-1/4,179pp. eBook ISBN:978-1-4822-0924-2 Print ISBN:978-1-4822-0923-5 organic culturesandtheleveloftrustintechnology-basedorganizations. an empiricalstudythatinvestigatedtherelationshipbetweenmechanisticand culture andtrust.Thisbookintroducesareviewoftheliteratureresult to demonstrateaconnectionbetweenorganizational technology organizations.Therehasbeenlittleresearch that cultureandtrustcanplayinthesuccessofhigh- This bookprovidesinsightintotheimportantrole Industrial InnovationSeries Lawrence LivermoreNationalLaboratory, California,USA Frances Alston Driven Organizations Culture andTrust inTechnology- Suggested Price: August 2013,6-1/8x9-1/4,253pp. eBook ISBN:978-1-4398-7415-8 Print ISBN:978-1-4398-7414-1 and schemesofoptimizationforincorporation inpractice. and theirimpactonproductivity. Itdiscusses modelsintegratingthesefactors sustained productivity. Thisbookexplores theseaspectsasindependentfactors competiveness. Allcomponentsmustbeconsideredasanintegratedwhole for most important components of industrialeconomy and the factor that determines establish newandadjustedapproaches.Humanworkproductivityisoneof the issues havetobeexaminedinnewcontextobjectively disturbed thehomeostasisofindustrialorder. Many shifting inindustrialandmanufacturingactivitieshave The currentglobaleconomicdownturnandconsiderable and ArunkumarPennathur Shrawan Kumar, AnilMital, Edited by A GlobalPerspective Human Work Productivity Suggested Price: 2013,6-1/8x9-1/4,355pp. January eBook ISBN:978-1-4665-6294-3 Print ISBN:978-1-4665-6292-9 warehouses andsuppliernetworksinthenewinternationalcontexts. networks with productive multilocationas well as thedesign of plantsand The authoroffersamethodologicalanswerfortheanalysisanddesignofglobal focuses onSMEs,withcasestudiesthatshowbestpracticesandrecenttrends. companies thathavebeguntheInternationalizationProcessinrecentyearsand Global ManufacturingandLogisticsNetworks.Itpresentsaguidelineforthose practitioners totacklethedesignandmanagementofa of the Internationalization Process to help managers and This bookprovidestheprinciples,tools,andtechniques Tecnun UniversityofNavarra,SanSebastian,Spain Ander Errasti Edited by Second Edition Operations DesignandManagement, $104.95 /£65.99 $94.95 /£59.99 $125.95 /£79.99
81 Product Development / Production Systems Liquid Lean Six Sigma Case Studies Developing Lean Culture with Minitab® in the Process Industries Kishore K. Pochampally Raymond C. Floyd Southern New Hampshire University, Manchester, USA Production Systems / Quality Control & Reliability Suncor, Calgary, Alberta, Canada Surendra M. Gupta Northeastern University, Boston, Massachusetts, USA Liquid industries, including reactive chemical manufacturing, petroleum and metal refining, and food Six Sigma is one of the most widely used quality and bio-pharma production, can make great use of the improvement methodologies today, both in manufacturing concepts of Lean. However, largely because they are and service industries. Minitab® is a statistical software naturally conservative and more financially stable than most, these industries package that is often used in conjunction with Six Sigma projects. This book do not generally make use of Lean manufacturing, and great case stories of illustrates the application of Minitab® for Six Sigma projects, using case studies successful Lean implementation are rare. This book is the first to offer details in a variety of sectors, such as healthcare, manufacturing, airline, and fast food. and examples of adapting Lean manufacturing to liquid industries. It is based Detailed steps and screenshots are provided to explain how to use a number of on more than twenty years of industry experience from the legendary Raymond quality analysis and improvement tools in Minitab®. Figures will include Minitab® Floyd, one of the first to successfully practice Lean in the chemical industry. screenshots and Minitab® worksheets for the case studies will be available for download. Print ISBN: 978-1-4200-8862-5 eBook ISBN: 978-1-4200-8863-2 Print ISBN: 978-1-4822-0557-2 February 2010, 6-1/8 x 9-1/4, 346 pp. eBook ISBN: 978-1-4822-0559-6 Suggested Price: $59.95 / £37.99 February 2014, 6-1/8 x 9-1/4, 318 pp. Suggested Price: $89.95 / £57.99
Manufacturing Operations Above Ground Storage Tanks Management Practical Guide to Construction, Sanjay Sharma Inspection, and Testing This book includes broad coverage of production and Sunil Pullarcot associated services. Since the success of manufacturing Kuwait Oil Company operations depends on the demand information and costs There has long been a need for a book that deals and revenue, qualitative and quantitative techniques of with all aspects subsequent to the design of storage demand forecasting and also financial analysis are covered tanks, explaining construction methodology to meet in this book. Topics such as facilities layout, inventory, international standards. This book deals with every aspect project management, production, planning and management are explained in that needs to be known upon receipt of an order to construct a storage tank detail. Additional topics include quality control and work study. at a site, in line with the requirements spelled out in international standards. It Print ISBN: 978-1-4822-5788-5 describes all activities that are to be carried out in a sequential manner, to ensure August 2014, 6 x 9, 212 pp. adequate quality for the constructed storage tank. Suggested Price: $99.95 / £63.99 Print ISBN: 978-1-4822-2202-9 December 2014, 6-1/8 x 9-1/4, 312 pp. 82 Suggested Price: $199.95 / £127.00
Modern Construction Affordable Reliability Lincoln H. Forbes and Syed M. Ahmed Engineering Industrial Innovation Series William R. Wessels and Daniel Sillivant Written by experts highly regarded for leadership UAH Research Institute and innovation, this book offers lean tools and other This book applies reliability-centered maintenance, productive strategies for the management of people and engineering economic analysis and Monte Carlo processes in the construction industry. The authors focus simulation to enable engineering and management mainly on lean construction methodologies, such as The professionals to achieve optimum life cycle affordability. ® Last Planner System, The Lean Project Delivery System™, It presents reliability-centered maintenance from the and Integrated Project Delivery™. They then present process improvement perspective of design and field sustainment. This text explains the process taken approaches such as TQM and Six Sigma, demonstrating how these methods can to ensure a design will meet specifications and minimize costs in the process. It improve projects in a traditional environment. gives engineers the knowledge to compare options for minimizing costs while Print ISBN: 978-1-4200-6312-7 keeping reliability above specifications. eBook ISBN: 978-1-4200-6313-4 Print ISBN: 978-1-4822-1964-7 October 2010, 7 x 10, 524 pp. March 2015, 6-1/8 x 9-1/4, 312 pp. Suggested Price: $154.95 / £99.00 Suggested Price: $149.95 / £95.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2013,6-1/8x9-1/4,349pp. eBook ISBN:978-1-4665-7363-5 Print ISBN:978-1-4665-7362-8 implementation. of correspondingconceptualapproaches andmethodsforitssystematic andthedevelopment emphasis onproactivehumanfactors-driven intervention driven byaretroactivestudyoferrors, incidents,andadverseevents,toan patient safetyarecontingentonamajorshiftfromeffortsandinvestments how significantimprovementsinthequalityofcareandenhancement of focus onerrorinvestigationandcareproviders’accountability. Itdemonstrates dominant alternative to the contemporary delineates a moredirectand powerful improvement ofhealthcareworkandpatientsafety. Theproposedapproach This book presents a systematic human factors-based proactive approach to the Israel InstituteofTechnology, Haifa Daniel Gopher Hadassah HebrewUniversityMedicalCenter, Jerusalem,Israel Yoel Donchin Edited by Safety inHealthCare Human Factorsand Around thePatientBed Suggested Price: August 2011,7x10,600pp. eBook ISBN:978-1-4398-9724-9 Print ISBN:978-1-58488-466-8 Software andotherfilesareavailableonline. implementation throughoutusingseveralwidelyavailablesoftwarepackages. to reliabilityanalysis,the book provides detailedillustrationsofsoftware repairable systemmodeling.Taking apracticalandexample-orientedapproach new chapteronBayesianreliabilityanalysisandexpanded,updatedcoverageof data analysis and systems models, and much more. The third editionincludes a distribution. Italsocoversreliabilitydataplotting,accelerationmodels,lifetest reliability concepts,exponentialdistribution,Weibull distribution,andlognormal This easy-to-useguideaddressesbasicdescriptivestatistics, Bloom Energy David Trindade Retired, Austin,Texas, USA Paul A.Tobias Third Edition Applied Reliability Textbook Suggested Price: October 2014,6-1/8x9-1/4,374pp. Print ISBN:978-1-4665-6572-2 conclude withvariantsandextensionsofthemethods. inR.Thechapters then illustratestepbyhowtheanalysesareperformed obtained, andthestatisticalanalysesrequired.Usingrealexamples,authors evaluation,detailsaboutthedataset particularitiesrelatedtothesensory sensory evaluation and its objectives,the nature of thesensory data.Eachchapterpresentsthe to analyzetheirsensory This book helpsreaderschoose the right statistical method Chapman &Hall/CRCTheRSeries Qi Statistics,Ruscombe,UK WorchThierry Agrocampus Quest,Rennes,France Sebastien Le DatawithR Analyzing Sensory $104.95 /£65.99 $99.95 /£66.99 $89.95 /£57.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
of AnimalOrigin Authenticity ofFoods Suggested Price: 2015,6-1/8x9-1/4,551pp. January Print ISBN:978-1-4665-8405-1 handbook. CM, thisbookcompiles all AI tools used inCMgtostructure them in a reference maintenance ofalltypesindustrialmachinery. DuetothesuccessofAIin trouble shootinginmaintenanceofindustrialmachinery. AItoolsareusedin prevalent applicationofAIhasbeenfaultdiagnosisand through itsuseinconditionmonitoring(CM).Themost still evolvingforeffectivemaintenancemanagement approach andmethodologythathasevolvedis Artificial intelligence(AI)representsaprogramming Diego GalarPascual Condition MonitoringandDIagnosis Decision SupportSystemsin Artificial Intelligence Tools Suggested Price: April 2015,7x10,512pp. Print ISBN:978-1-4665-6883-9 following asimilarformatforconsistentpresentationofinformation. sections coverindividualfoodborneprotistsandhelminthes,witheachchapter vaccine development,amongothercurrentconcerns.Thesecondandthird use ofrelatedsoftware),wholegenomesequencing,metagenomicanalysis, and molecular detection,andpopulationgeneticstophylogeneticanalysis(including research. Topics rangefromgeneticmanipulation, have beenappliedtofoodborneparasiticpathogens outlines keymolecularbiologicaltechniquesthat of foodborneparasiticpathogens.Thefirstsection This bookisdevotedtothestudyofmolecularbiology Series: FoodMicrobiology Lihua Xiao,UnaRyan,andYaoyu Feng Edited by Biology ofFoodborneParasites Suggested Price: 2015,6x9,504pp. February Print ISBN:978-1-4987-0641-4 for improvingfoodauthenticityandtraceability. final sectionoffersconclusions,discussesfuturetrends,andprovidessuggestions regarding traceability, authenticity, andthegeneticmodificationoffoods.The The bookaddressescurrentlegislationintheUnitedStates,Canada,andEurope chapters includemeats,poultry, fishandseafood,milkdairy, andhoney. their applicationtofoodsofanimalorigin.Dedicated for assessingfoodauthenticityandtraceability foods, thisvolumefocusesontechniquesandmethods The first in a two-volume set on the authenticity of Food BiologySeries University ofThessalia,Volos, Greece Ioannis SotiriosArvanitoyannis $179.95 /£112.00 $199.95 /£127.00 $159.95 /£99.00
83 Quality Control & Reliability Competitive Innovation Engineering Textiles and Improvement Research Methodologies, Concepts, Statistical Design and Control and Modern Applications Kieron Dey Edited by Nobigroup Inc, Knoxville, Tennessee, USA Alexandr A. Berlin, Roman Joswik, and Vatin Nikolai Ivanovich This book explains how to combine two widely known statistical methods—statistical design and statistical This volume provides the textile science community with control—in a manner that can help any business, a forum for critical, authoritative evaluations of advances government, or research organization solve problems quickly, with sustained in the discipline of textile engineering. Reporting on recent advances with results. Because the problem-solving strategy employed is based on pure significant applications in textile engineering, the chapters are written by Quality Control & Reliability scientific method, it makes integration into any existing problem-solving internationally recognized researchers. or research method quite simple. Organizations can immediately apply the Print ISBN: 978-1-77188-078-7 concepts discussed with existing staff, releasing latent energy rather than adding March 2015, 6 x 9, 450 pp. to their workload. Suggested Price: $149.95 / £95.00 Print ISBN: 978-1-4822-3343-8 eBook ISBN: 978-1-4822-3344-5 October 2014, 6-1/8 x 9-1/4, 231 pp. Suggested Price: $59.95 / £38.99
Equivalence and Noninferiority Tests for Quality, Manufacturing and Test Engineers Computer System Reliability Scott Pardo Safety and Usability Bayer Healthcare, Whippany, New Jersey, USA B.S. Dhillon This book presents methods for using validation and University of Ottawa, Ontario, Canada verification test data to demonstrate equivalence and noninferiority in engineering and applied science. It covers This book combines computer system reliability, safety, numerous tests drawn from the author’s more than 30 usability, and other related topics into a single volume years of work in a range of industrial settings. The book provides computational and to eliminate the need to consult many different and formulas for the tests, methods to determine or justify sample sizes, and diverse sources in obtaining desired information. The formulas to calculate power and operating characteristic curves. The methods topics covered are treated in such a manner that readers are accessible using standard statistical software and do not require complicated require no previous knowledge to understand the contents. The book contains programming. examples along with their solutions and numerous problems at the end of each chapter to test reader comprehension. The sources of most of the material Print ISBN: 978-1-4665-8688-8 presented will be given in the reference section at the end of each chapter. eBook ISBN: 978-1-4665-8689-5 September 2013, 6-1/8 x 9-1/4, 232 pp. Print ISBN: 978-1-4665-7312-3 Suggested Price: $132.95 / £85.00 eBook ISBN: 978-1-4665-7313-0 84 May 2013, 6-1/8 x 9-1/4, 249 pp. Suggested Price: $104.95 / £65.99
Textbook A First Course in Designing Complex Products Quality Engineering with Systems Engineering Integrating Statistical and Management Methods of Quality, Second Edition Processes and Techniques K.S. Krishnamoorthi Vivek D. Bhise Bradley University, Peoria, Illinois, USA University of Michigan - Dearborn, USA V. Ram Krishnamoorthi This book looks at how to design complex products that Loyola University Chicago, Stritch School of Medicine, Illinois, USA have many components with intricate relationships and Helping students become effective quality engineers, this text covers both requirements. It also discusses how to manage processes management and statistical methods of quality engineering in an integrative involved in their lifecycles, from concept generation to manner. Suitable for candidates preparing for the certified quality engineer disposal, with the objectives of increasing customer satisfaction, quality, safety, (CQE) exam, this edition reflects the changes in the latest revision of the ISO and usability and meeting program timings and budgets. Part I covers systems 9000 Standards and the Baldrige Award criteria. Along with new mini-projects engineering concepts and methods in product design. Part II examines quality, and examples, it incorporates lean methods for reducing cycle time, increasing human factors, and safety engineering approaches. Part III describes tools and throughput, and reducing waste. Reorganized and more accessible, this edition methods, and Part IV includes applications and case studies. also includes more coverage of strategic planning. Print ISBN: 978-1-4665-0703-6 Print ISBN: 978-1-4398-4034-4 eBook ISBN: 978-1-4665-0704-3 eBook ISBN: 978-1-4398-4035-1 August 2013, 6-1/8 x 9-1/4, 490 pp. August 2011, 6-1/8 x 9-1/4, 634 pp. Suggested Price: $125.95 / £79.99 Suggested Price: $145.95 / £93.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2015,6-1/8x9-1/4,480pp. Print ISBN:978-1-4822-0884-9 equipment. foodprocessingfacilitiesand design, construction,andmaintenance ofsanitary book discussestheneedforsanitation andmethodsforachievingitthroughthe is requiredtofollowtheFDA’s foodGoodManufacturingPractices(GMP).The importance offoodsafety, includingwhyandhowthefoodprocessingindustry Interpreting andApplyingtheVarious AgencyRegulationsdemonstratesthe packaging, andholdingofproduce.FoodSafety: based standardsforthesafegrowing,harvesting, them aftertheyoccur. TheFDAmustestablishscience- preventing foodsafetyproblemsratherthanreactingto Recent legislationnowallowstheFDAtofocuson William J.Mead the Various AgencyRegulations Interpreting andApplying Food Safety Suggested Price: May 2013,6-1/8x9-1/4,306pp. eBook ISBN:978-1-4665-1174-3 Print ISBN:978-1-4665-1173-6 examples ofprocedures,forms,anddocuments. microbiological, physical,andchemicalhazards.Theauthorhasalsoincluded issues. Itoffersreadersthetoolstoestablishafoodsafetysystemhelpcontrol advice onallaspectsoffoodplantsanitationandsanitation-relatedsafety for suchasystem.Thesecondeditionprovidescompletelyupdatedpractical Beginning with thatpremise, this bookpresentssomeofthekeycomponents is thefoundationforaneffectivefoodsafetysystem. Understanding thatsanitationisintegraltofoodsafety Yorba Linda,California,USA Food Safety&QualityAssurance,SpecialtyBrands,Inc., Michael M.Cramer Second Edition Good ManufacturingPractices, Design, Maintenance,and Food PlantSanitation Suggested Price: November 2012,7x10,1078pp. eBook ISBN:978-1-4398-3085-7 Print ISBN:978-1-4398-3084-0 various substances. trends in HPLC, separation techniques,and HPLC determinationsof residues of all majortopicsoffoodcomponentsanalyzablebyHPLC.Itexaminesrecent revised, thisvolumeofferspracticalandimmediatelyapplicableinformationon miniaturization, automatization,andgreenchemistry. Thoroughlyupdatedand been madeinHPLCanalysistechniques—withparticularattentiongivento quality. Sincethelasteditionofthisvolumewaspublished,greatstrideshave toolforproductcompositiontestingandassuring (HPLC) isapowerful liquidchromatography For foodscientists,high-performance Valencia, Spain Instituto deAgroquímicayTecnología deAlimentos, Fidel Toldra University CollegeGhent,Belgium Leo M.L.Nollet Edited by Third Edition Food AnalysisbyHPLC $159.95 /£99.00 $145.95 /£93.00 $262.00 /£167.00
For more informationand acompletelistof titles,visitusat www.crcpress.com
Food SafetyinChina Suggested Price: October 2014,6-1/8x9-1/4,344pp. Print ISBN:978-1-4665-9794-5 book usefulforfoodscientistsandnutritionists. willmakethe of commonlyusedanalyticaltechniquesinfoodsafetychemistry the factorsinfluencingtheirlevelsinfoodswillbediscussed.Inaddition,alisting mechanisms behindtheirtoxicity. Theirabsorptionanddistributionprofiles chemical contaminantwillbediscussedfortoxiceffectsandthebiological formulation, andstorageoffood.Eachmajorfood offoodtoxicantsproducedduringprocessing, chemistry This editedbookisacomprehensiveguidetothe Liangli (Lucy)Yu, ShuoWang, andBao-GuoSun Edited by and Mitigation Toxicant Occurrence,Analysis Food SafetyChemistry Suggested Price: December 2013,6-1/8x9-1/4,389 pp. eBook ISBN:978-1-4398-2680-5 Print ISBN:978-1-4398-2679-9 experts. choice. Theauthorincludescasestudies fromprofessionalsandsubjectmatter Applications areprovidedinamanner thatcanbeappliedtothestandardof system foranorganizationandhowtoidentifythegapsintegrateresources. based systeminthefoodindustry. Itprovidesguidancefor choosing thebest to thedevelopment,implementation,andmaintenanceofamanagement- established foodsafetystandards,thistextprovidestoolsthatcanbeapplied safety managementsystemispriceless.Basedonthe The valueofaneffective,well-defined,sustainablefood D. L.NewslowandAssociates,Inc.,Orlando,Florida,USA Debby Newslow and Compliance Applications, BestPractices, Programs Food SafetyManagement Suggested Price: July 2014,6-1/8x9-1/4,384pp. eBook ISBN:978-1-4822-1834-3 Print ISBN:978-1-4822-1833-6 the keyaspectsofproduction,circulation, andconsumptionfrom2006to2011. the changingtrackoffoodsafety(includingimportedandexportedproducts)in of view. Itbeginswiththeproductionofagriculturalproductsandinvestigates complete systemofthefoodsupplychainfrommulti-scientificsystematicpoints and governmentagenciesaspartofanorganicsystem,thebookexamines Looking atfoodproducersandoperators,consumers, put forthbyChinatopreventfoodsafetyconcerns. This bookprovidesacomprehensivereviewoftheefforts Dian Zhu Jiangnan University Jiangsu ProvinceResearch BaseofFoodSafety, Linhai Wu A ComprehensiveReview $169.95 /£108.00 $145.95 /£93.00 $79.95 /£49.99
85 Quality Control & Reliability Foodborne Viral Pathogens Handbook of Human Factors Grant Hansman and Peter White and Ergonomics in Health Series: Food Microbiology Care and Patient Safety Unlike foodborne pathogenic bacteria, little is published on food viruses and their research. This book is devoted Second Edition to the study of molecular biology of foodborne viral Edited by pathogens and is divided into two sections. The first Pascale Carayon section outlines key molecular biological techniques University of Wisconsin-Madison, USA that have been applied to foodborne viral pathogens Series: Human Factors and Ergonomics research. The second section covers individual foodborne viral pathogens in relation to their classification, morphology, genome structures, biology, Written for students and professionals, this book is a complete reference on Quality Control & Reliability epidemiology, clinical features, pathogenesis, diagnosis, treatment, and human factors and ergonomics research, concepts, theories, models, methods, prevention, among others. and interventions that have been or can be applied in health care. Topics such as medical technology and telemedicine are covered, and special emphasis is Print ISBN: 978-1-4665-7950-7 put on the contributions of human factors and ergonomics to the improvement May 2015, 7 x 10, 800 pp. of patient safety and quality of care. Nine chapters from the original edition Suggested Price: $169.95 / £108.00 were deleted, and information from them was incorporated into other chapters. Furthermore, this second edition offers 17 new chapters. Print ISBN: 978-1-4398-3033-8 eBook ISBN: 978-1-4398-3034-5 November 2011, 8-1/2 x 11, 876 pp. Textbook Suggested Price: $166.95 / £106.00 Fundamental Food Microbiology, Fifth Edition Improving Food Quality Bibek Ray with Novel Food Processing University of Wyoming, Plymouth, USA Arun Bhunia Technologies Purdue University, West Lafayette, Indiana, USA Edited by Maintaining the high standard set by the previous Özlem Tokus¸og˘lu bestselling editions, this book presents the most up-to- Celal Bayer University, Department of Food Engineering, Manisa, Turkey date information in this rapidly growing and highly dynamic field. Revised and expanded to reflect recent advances, this edition broadens coverage of foodborne Barry G. Swanson Washington State University, Pullman, USA diseases to include many new and emerging pathogens, as well as descriptions of the mechanism of pathogenesis. With the inclusion of many more easy-to- Improving food quality, specifically properties such as rheological, follow figures and illustrations, this text provides a comprehensive introductory physicochemical, and sensorial aspects, is always a goal of food and beverage source for undergraduates, as well as a valuable reference for graduate level and manufacturers. During the past decade, novel processing technologies including working professionals in food microbiology or food safety. high hydrostatic pressure (HHP), ultrasound, pulse electric field (PEF), and advanced heating technologies containing microwave, ohmic heating, and Print ISBN: 978-1-4665-6443-5 radio frequency have frequently been applied in the processing of foods and eBook ISBN: 978-1-4822-0866-5 beverages. This book addresses maintaining and improving food quality through November 2013, 7 x 10, 663 pp. the use of these novel food processing technologies. 86 Suggested Price: $87.95 / £55.99 Print ISBN: 978-1-4665-0724-1 November 2014, 6-1/8 x 9-1/4, 486 pp. Suggested Price: $169.95 / £108.00
Handbook of Food Analysis Integrated Reliability Third Edition - Two Volume Set Condition Monitoring and Edited by Maintenance of Equipment Leo M.L. Nollet John Osarenren University College Ghent, Belgium This text highlights the solutions to the common Fidel Toldra failures and reliability of equipment in major industries, Instituto de Agroquímica y Tecnología de Alimentos, Valencia, Spain through an integrated reliability condition monitoring, and maintenance with a technological inheritance The Handbook of Food Analysis, Third Edition, model-based program. It relates all operating conditions presents an exhaustive compilation of analytical methods essential to every of a critical cylindrical equipment part (shaft) throughout its life cycle, starting food chemist. This outstanding two-volume reference delineates the physical from design through manufacturing to actual equipment service application. and chemical properties of nutrients and other food components. It provides The mathematical relationship of a desired operating manufacturing process and step-by-step descriptions of preparation, detection, separation, derivatization, work-piece conditions is developed as a system multivariate quality model that and clean-up techniques; it also assesses the relative advantage, accuracy, and relates with its part failure mechanism. reliability of each procedure. Sixteen new chapters have been added to this two- volume reference. They discuss hand analysis techniques of rheological, thermal, Print ISBN: 978-1-4822-4940-8 and flavor properties of food as well as various methods and techniques in food February 2015, 6-1/8 x 9-1/4, 496 pp. analysis. Chapters on amines, flavorings, and food traceability are also included. Suggested Price: $159.95 / £99.00 Print ISBN: 978-1-4665-5654-6 June 2015, 8-1/2 x 11, 1568 pp. Suggested Price: $690.00 / £439.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2015,6-1/8 x9-1/4,232pp. February Print ISBN:978-1-4822-4352-9 performance. statistical tools,improvebusinessand financial results,andcontrolpeakbusiness resultsusing analyzeperformance measure currentbusinessperformance, LSS system. This book discusses the LSS process to define improvement needs, examplestoaidreadersinunderstandingand implementingthe and industry organizations. Thebookprovidesadetailedroadmap and managersinterestedinimplementingLSSattheir This bookintroducesLeanSixSigma(LSS)toengineers University ofToledo, Ohio,USA Matthew JohnFranchetti With AppliedCaseStudies Engineers andManagers Lean SixSigmafor Suggested Price: October 2013,6-1/8x9-1/4,520pp. eBook ISBN:978-1-4398-4802-9 Print ISBN:978-1-4398-4799-2 author’s website. for importantmethodsandallRfunctionsdatasetsareavailableonthe how these methods can handle new applications. Pseudo codes are presented more establishedtechniques.Theauthor—aleadingresearcher onSPC—shows methods, thisbookdescribesmanyrecentSPCmethodsthatimproveuponthe ensure thattheyworkstablyandsatisfactorily. Alongwithcoveringtraditional processes, such as production lines and Internet traffic, to statistical processcontrol(SPC)monitorssequential A majortoolforqualitycontrolandmanagement, Series: Chapman&Hall/CRCTexts inStatisticalScience University ofFlorida,Gainesville,USA Peihua Qiu Statistical ProcessControl Introduction to Textbook Suggested Price: May 2014,6-1/8x9-1/4,274pp. eBook ISBN:978-1-4822-3480-0 Print ISBN:978-1-4822-3479-4 or catastrophicproblems. using a riskmethodology in a given organization for evaluating major safety and the processandimplementationaswellunderstandingfundamentalsof they relatetomajorcatastrophicevents,safety, andrisk.Specificallyitaddresses events, andtheirconsequences.ThisnewbookfocusesonriskHAZOPas processes, it is missing methods for considering safety issues, catastrophic tool to forecast failures for both While design FMEA and is indeed a powerful failure modeandeffectsanalysis(FMEA)techniques. minimize it.Thisbookexpandstheconversationbeyond tounderstandthis“risk”andifpossible we allmusttry wedo.Realizingthisfact, ineverything Risk iseverywhere, Southgate, Michigan,USA Consultants, President ofContemporary D. H.Stamatis Tools andMethodologies Introduction toRiskandFailures $89.95 /£57.99 $94.95 /£59.99 $99.95 /£63.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
and Reliability Maintenance, Replacement, Textbook Suggested Price: October 2013,6-1/8x9-1/4,533pp. eBook ISBN:978-1-4665-5681-2 Print ISBN:978-1-4665-5680-5 to applythevariousLeantechniques. Lean instructionbyprovidinginteractivecasestudieswhichwillenablereaders processes,demonstratinghowtoapplytheLeanphilosophy.service Itfacilitates real-world Leanprojectsfromawidevarietyofmanufacturing,healthcare,and provides an in-depth description of the various Lean techniques and numerous processes.Thisbook on howtoapplyLeandevelophealthcareandservice detailed casestudieswithstep-by-stepanalysis,nordotheyprovideguidance describe eachLeantool,particularlythoseincluding There arefewbooksonLeanthatcomprehensively and DavidDietrich Elizabeth A.Cudney, SandraFurterer, Edited by andHealthcare Manufacturing, Service, Applications andCaseStudiesin Lean Systems Suggested Price: October 2013,6-1/8x9-1/4,230pp. eBook ISBN:978-1-4665-0951-1 Print ISBN:978-1-4665-0950-4 strategies. safety risks,challenges,andintervention catch. Under each sector, the book addresses the existing and emerging food livestock, andaquacultureproducts—along withachapterongameandwildfish production sectors—crops, terrestrial occurring. The book covers three primary agri-foodindustriesandwaystomanage,reduce, or preventthemfrom primary on informingreadersofexistingandemergingrisksinthe livestock, andaquaticorganisms.Thus,thisbookfocuses can allowmicroorganismcontaminationofcrops, The complex supply chain in modern farming practices Richard Baines Universiti MalaysiaKelantan Jan MeiSoon in theAgri-FoodIndustries Managing FoodSafetyRisks Suggested Price: May 2013,6-1/8x9-1/4,364pp. eBook ISBN:978-1-4665-5489-4 Print ISBN:978-1-4665-5485-6 bank withover100examinationquestions,fromtheCRCwebsite. been developedandcanbedownloaded,alongwithPowerPointSlidesatest that implementsmanyoftheproceduresandmodelsfeaturedinthistextbookhas management, including applications of the models presented in the text. Software The book is solidlybasedon the resultsofreal-worldresearch inphysical asset the toolsneededformakingdata-drivenphysicalassetmanagementdecisions. Completely revisedandupdated,thissecondeditionofabestsellerprovides Series: MechanicalEngineering The HongKongPolytechnicUniversity Albert H.C.Tsang University ofToronto, Ontario,Canada Andrew K.S.Jardine Second Edition andApplications, Theory $94.95 /£59.99 $145.95 /£93.00 $157.95 /£99.00
87 Quality Control & Reliability Meat Quality Microbiological Examination Genetic and Environmental Factors Methods of Food and Water Edited by A Laboratory Manual Wieslaw Przybylski, PhD Neusely da Silva, Marta Hirotomi Taniwaki, Warsaw University of Life Science, Poland Valéria Christina Junqueira, Neliane Silveira, David Hopkins, PhD Maristela da Silva do Nascimento, and New South Wales University, Australia Renato Abeilar Romeiro Gomes Series: Chemical & Functional Properties of Food Components Illustrated laboratory manual that provides an This book covers factors affecting meat quality from overview of current standard microbiological culture methods for the examination the growth of animals to the final product. It discusses specific aspects of meat of food and water, adhered to by renowned international organizations, such as Quality Control & Reliability quality for beef, pigs and sheep. This comprehensive book addresses the whole ISO, AOAC, APHA, FDA and FSIS/USDA. The didactic setup and the visualization range of factors related to the welfare, animal nutrition, pre-slaughter marketing, of procedures in step-by-step schemes allows student and practitioner to quickly slaughter technology, slaughter and carcass dressing as well as the impact perceive and execute the procedure intended. Each chapter provides numerous of currently known genetic factors on the quality of meat. It also covers the methods for a certain examination, and also provides simple or quick alternatives. influence of genetic factors such as species, race, gender or genes in breeding programs to improve meat quality. Print ISBN: 978-0-415-69086-7 eBook ISBN: 978-0-203-16839-4 Print ISBN: 978-1-4822-2031-5 December 2012, 8-1/2 x 11, 484 pp., Soft Cover May 2015, 6-1/8 x 9-1/4, 680 pp. Suggested Price: $139.95 / £89.00 Suggested Price: $169.95 / £108.00
Methods in Food Analysis Molecular Biology of Food and Edited by Water Borne Mycotoxigenic Rui M. S. Cruz, Igor Khmelinskii, and Mycotic Fungi and Margarida Vieira Edited by This book reviews methods of analysis and detection in the Robert Russell Monteith Paterson area of food science and technology. Each chapter deals with Food Microbiology Series determination/quantification analyses of quality parameters in food, covering topics such as lipids, color, texture, and This comprehensive book summarizes the general rheological properties in different food products. The book knowledge about toxigenic fungi and describes key focuses on the most common methods of analysis, presenting methodologies molecular techniques that have been applied to foodborne fungal pathogens. for specific work conditions. It provides a reference for food engineers and The book deals specifically with foodborne mycotoxigenic fungi, from the researchers working in the area of food science and technology as well as standpoint of mycoses. It covers the 20 genera that contain human pathogenic undergraduate and postgraduate students. and foodborne species, of which approximately 10 merit a separate chapter. The book contains separate chapter sections on10 genera that contain mycotoxin Print ISBN: 978-1-4822-3195-3 producing species. It also examines yeast genera, which contain species that are eBook ISBN: 978-1-4822-3196-0 pathogenic to humans and also contain food associated species. June 2014, 6-1/8 x 9-1/4, 250 pp. Suggested Price: $129.95 / £82.00 Print ISBN: 978-1-4665-5986-8 88 June 2015, 7 x 10, 760 pp. Suggested Price: $199.95 / £127.00
Microbial Food Safety and Nonlinear Systems Preservation Techniques Stability Analysis Edited by Lyapunov-Based Approach V Ravishankar Rai and Jamuna A. Bai Seyed Kamaleddin Yadavar Nikravesh University of Mysore, Manasagangotri, India Using a Lyapunov-based approach, this book introduces The book explores the advances in food safety and advanced tools for the stability analysis of nonlinear food quality control. It covers the hazards posed by systems. It first discusses standard stability techniques the food-borne pathogens, their detection using and their shortcomings and then introduces recent advanced molecular techniques and nanotechnology, developments in stability analysis that can improve the applicability of standard microbiological risk assessment of raw, fresh produce, ready to eat (RTE), techniques. Finally, the book proposes the stability analysis of special classes of minimally processed and processed foods. It includes the role of regulatory nonlinear systems. Coverage includes the stability of ordinary time-invariant agencies and authorities in developing strategies to improve the quality and differential equations and time-invariant systems as well as the stability analysis safety of food. It emphasizes the various food preservative techniques that are of time-delayed systems and fuzzy linguistic systems models. used to ensure high quality and safe foods. Print ISBN: 978-1-4665-6928-7 Print ISBN: 978-1-4665-9306-0 eBook ISBN: 978-1-4665-6929-4 eBook ISBN: 978-1-4665-9307-7 January 2013, 6-1/8 x 9-1/4, 319 pp. October 2014, 7 x 10, 542 pp. Suggested Price: $177.95 / £113.00 Suggested Price: $189.95 / £121.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: April 2013,6-1/8x9-1/4,400pp. eBook ISBN:978-1-4665-7300-0 Print ISBN:978-1-4665-7299-7 such asenvironmentalprotection,the sustainability, andsocialresponsibility. but alsoontheworldofqualityasitspillsoverintoothermanagementsystems, the stakes and the role of quality in life and policies of an organization or company, statistical tools typically mastered in management systems. The emphasis is on of standards,andinformationontheimplementation and comprehensiveapproach,withdetailedknowledge this oneintendstofillthegapbyprovidingasynthetic ofqualityanditstools, Few booksofferanoverview Ecole polytechniquefédéraledeLausanne(EPFL) Michel Jaccard Sustainability ManagementSystems and An IntroductiontoPerformance The ObjectiveisQuality Suggested Price: April 2014,6-1/8x9-1/4,416pp. eBook ISBN:978-1-4665-6630-9 Print ISBN:978-1-4665-6629-3 with complexstatisticalsoftware. in thestatisticalfreesoftwareR,makingbookaccessibleforpeopleunfamiliar studies. Theimplementationofthemajoritymethodologiesisperformed information forimplementation,discussionofexamplesapplications,andcase description ofthemethodologiesisprovided,accompaniedbydetailed ofclassicalandnovelalternativemethodologies.Acomplete an overview characterizationoffoodandnon-foodproducts,providing focuses onsensory science.Thisbook sophisticated, andextensivelyappliedtoolsinsensory characterizationisoneofthemostpowerful, Sensory Universidad delaRepública,Montevideo,Uruguay Gastón Ares Paula Varela Edited by and ConsumerProfiling Characterization Sensory Novel Techniques in Suggested Price: April 2014,6-1/8x9-1/4,468pp. eBook ISBN:978-1-4665-8076-3 Print ISBN:978-1-4665-8075-6 (FT-IR andRaman),molecularelectronicnoses,DNA-basedmethods. methods usedtomonitormicrobialactivity, includingspectroscopicmethods ofthesenovelfoodprocessingtechniques.Italsocoversnew presents asummary methods, suchashigh-pressuresonication,ozone,andUVtreatment.Thisbook development ofinnovative,non-thermalfoodpreservation Demand forminimallyprocessedfoodshasresultedinthe University ofThessaly, NeaIonia,Greece Ioannis S.Boziaris Edited by Techniques and MicrobialAssessment Novel FoodPreservation $109.95 /£69.99 $169.95 /£108.00 $159.95 /£99.00
For more informationand acompletelistof titles,visitusat www.crcpress.com
Environmental Pollutants Food Toxicants and Portable Biosensingof Suggested Price: December 2014,7x10,1408pp. Print ISBN:978-1-4665-7769-5 transportation andsanitationoffreshproduceinretailestablishments. contains 14newchapters.Amongothers,topicsincludesanitationinfood this secondeditiondiscussesnineadditionalfoodprocessingindustriesand of theindustry’s mostrecentdevelopments.FormerlytitledFoodPlantSanitation, information on the daily operations in a food processing plantand reviews some safety.essential forfoodproductionandservice Itprovidesbasic,practical fundamental principlesandapplicationsthatare Comprehensive andaccessible,thisbookpresents Science Technology System,West Sacramento,California, USA Y. H.Hui Edited by Second Edition Processing andFoodService Plant SanitationforFood Suggested Price: September 2011,6-1/8x9-1/4,583 pp. eBook ISBN:978-1-4398-5750-2 Print ISBN:978-1-4398-5749-6 practice ofriskanalysisforprofessionals fromallwalksoflife. book provides a foundation for the decades of experience,thisstraightforward and methodologies to helpreadersapplytheprinciples.Basedonauthor’s models, and concepts of risk analysis, and then supplies the tools, techniques, making inanuncertainenvironment.Thebookintroducesthelanguage, of riskanalysisintoaframeworkthatsupportsdecision integrated fashion.Theauthorcombinesthethreetasks risk assessment,andcommunication—inan book treatsthewholeofriskanalysis—riskmanagement, Most booksonriskanalysisfocusassessment.This University,Notre DameofMaryland Baltimore,USA Charles Yoe Decision MakingUnderUncertainty Principles ofRiskAnalysis Suggested Price: October 2013,6-1/8x9-1/4,830pp. eBook ISBN:978-1-4665-7633-9 Print ISBN:978-1-4665-7632-2 sensor technologyforresearchers. technology atapostgraduatelevelandexploresthelatestadvancesinchemical in food and the environment, this book presents basic knowledge on biosensor used byunskilledpersonnel.Coveringnumerousapplicationsofbiosensors handling, real-timedetection,rapiddetectionofanalytes,andtheabilitytobe over standardanalytical methods, includingminimal sample preparationand environmental, food,andbiomedicalapplications,astheyclearlyofferadvantages Biosensors arepoisedtomakealargeimpactin Series: SeriesinSensors Arzum Erdem,andGeorgia-ParaskeviNikoleli Dimitrios P. Nikolelis,TheodorosVarzakas, Edited by $189.95 /£121.00 $188.95 /£120.00 $209.95 /£134.00
89 Quality Control & Reliability Textbook Quality Management for Principles of Total Quality Organizations Using Third Edition Lean Six Sigma Techniques Vincent K. Omachonu Erick Jones University of Miami, Coral Gables, Florida, USA University of Texas, Arlington, USA
Joel E. Ross A reference on the workings of Modern Lean Six Sigma Florida Atlantic University, Boca Raton, USA techniques, this book presents the background on quality An exceptionally thorough treatment of quality, this and lean six sigma techniques and tools. It reviews the bestselling text provides practical instruction for students as well as for those previous history of lean six sigma in manufacturing, responsible for quality implementation and management. The authors address current applications of lean six sigma in operations, which projects should be Quality Control & Reliability reliability against the backdrop of increasing litigation in the area of product selected and prioritized, and what to do with non-lean six sigma projects. It also performance. Complete chapters provide a historical perspective for Six Sigma describes the different six sigma certitications, and closes with future directions. and discuss the concepts of service excellence within healthcare organizations. Print ISBN: 978-1-4398-9782-9 The authors also provide an expanded analysis of process quality management eBook ISBN: 978-1-4822-4699-5 and quality function deployment, parameters for customer satisfaction, ways to February 2014, 7 x 10, 627 pp. organize for TQM, and the use of control charts to account for variables. Suggested Price: $149.95 / £95.00 Print ISBN: 978-1-57444-326-4 eBook ISBN: 978-0-203-50710-0 May 2004, 6-1/8 x 9-1/4, 512 pp. Suggested Price: $94.95 / £59.99
Textbook Quality Tools for Managing Quality by Construction Projects Experimental Design Abdul Razzak Rumane Director, Construction Quality Management, Dar Alkuwait Fourth Edition Alkhaleejia for Consultation and Training, Kuwait Andrija Milivojevich Industrial Innovation Series Knowledge Management Group, Mississauga, Ontario, Canada Quality tools and techniques are very important in developing a comprehensive project quality management Thomas B. Barker Professor Emeritus, Rochester Institute of Technology, system. Application of tools and techniques in construction New York, USA projects have a great influence on cost effectiveness, results of construction projects, and achieving successful project performance. This book has been A practical guide to designed experiments, this book helps technicians, developed to provide significant information about usage and applications of engineers, and Six Sigma professionals resolve technological problems, advance various quality tools and techniques for managing a construction project as it technology, and improve productivity. It can be used in an applied educational moves through the different phases of the project life cycle. program at the undergraduate and graduate levels for engineers having little or no exposure to fundamental statistics. The book is also suitable for continuing Print ISBN: 978-1-4665-5214-2 education program in quality engineering. This fourth edition include four new eBook ISBN: 978-1-4665-5215-9 chapters on mixture experiments. April 2013, 6-1/8 x 9-1/4, 413 pp. 90 Suggested Price: $104.95 / £65.99 Print ISBN: 978-1-4822-4966-8 May 2015, 7 1/2 x 10, 850 pp. Suggested Price: $129.95 / £82.00
Textbook Textbook Quality Engineering Reliability Engineering Off-Line Methods and Applications and Risk Analysis Chao-Ton Su A Practical Guide, Second Edition National Tsing Hua University, Hsinchu, Taiwan Mohammad Modarres, Mark Kaminskiy, Quality is an essential determinant for achieving overall and Vasiliy Krivtsov business success. Quality Engineering: Off-Line Methods Only a handful of books cover both Reliability Engineering and Applications discusses the use of quality engineering and Probabilistic Risk Assessment (PRA) together. With methods and other modern techniques to ensure design a focus on reliability analysis, this text provides a practical and comprehensive optimization in the product and process design stages for a company. Starting overview of reliability and risk analysis techniques. This second edition features with the basics, this book presents an overall picture of quality engineering. It additional topics including generalized renewal with applications, more helps readers understand quality engineering methods such as DOE, Taguchi, detailed Bayesian estimation methods, and estimation of bounds of repairable RSM, and computational intelligence approaches. It also provides extensive unit reliability and availability. With numerous illustrative examples, this book examples and case studies, without extensive mathematical treatments, making also expands discussions on the models for physics of failure type probabilistic it accessible to a broad audience. life estimation and uncertainty analysis and presents elementary risk analysis Print ISBN: 978-1-4665-6947-8 techniques. eBook ISBN: 978-1-4665-6949-2 Print ISBN: 978-0-8493-9247-4 February 2013, 7 x 10, 394 pp. eBook ISBN: 978-1-4200-0894-4 Suggested Price: $104.95 / £66.99 September 2009, 7 x 10, 471 pp. Suggested Price: $125.95 / £79.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2011,6-1/8x9-1/4,279pp. eBook ISBN:978-1-4398-5127-2 Print ISBN:978-1-4398-5092-3 case studiesillustratingRCA. PROACTOnDemand, theadvantages of SaaS,RCAtemplates,aswellvarious making andunderstandingthehumanelement.Newtopicscoveredinclude andhumanfactors topoordecision the contributionofhumanperformance Analysis, thisneweditionemphasizesevidencecollectionandstrategy and on FailureModesandEffectsAnalysisOpportunity to makesuretheydo.Whilepasteditionshavefocused to explorewhythingsdon’t workoutasplannedandhow Now initsfourthedition,this bestsellingresource continues and MarkA.Latino Robert J.Latino,KennethC. Bottom-Line Results,FourthEdition for Improving Performance Root CauseAnalysis Suggested Price: May 2014,7x10,336pp. eBook ISBN:978-1-4665-0680-0 Print ISBN:978-1-4665-0677-0 examples oflifetimeresponses,resistivity, replicatedmeasures,andmore. and optimality. Theauthorillustratestheconceptsandmethodswithreal problems of RRS designs, such as rotatability, slope-rotatability, weak rotatability, to useRRSMinexperimentaldesignsandregressionanalysisaddresses and positivedataanalysistechniques.Itexplainshow presents RRSdesigns,alongwiththerelevantregression (RRSM) canovercome the limitationsofRSM,thisbook methodology Showing howrobustresponsesurface The UniversityofBurdwan,India Rabindra NathDas Data Analyses Regression, andPositive Robust ResponseSurfaces, Suggested Price: 2006,7x10,424pp. January Print ISBN:978-1-57444-794-1 the authorpaysspecialattentiontoexplaininguncertaintycharacterization. techniques werefirstdeveloped.SincePRAprovidesabest-estimateapproach, not limited to, examples from the nuclear industry, because that is where PRA mathematical andengineeringfoundations.Thetextreliesheavilyon,butis book requiresnopriorknowledgeofriskanalysisandprovidesthenecessary comprehensive PRAstudies,includingtechniquesforriskmanagement.The to probabilisticriskanalysis(PRA).Itparticularlyemphasizesmethodsfor in Engineeringpresentsanengineeringapproach for upper-levelcoursesinriskanalysis,RiskAnalysis Developed asaguideforpractitionersandtextbook Engineering, CollegePark,USA DepartmentofMechanical University ofMaryland, Mohammad Modarres Techniques, Tools, andTrends Risk AnalysisinEngineering Textbook $99.95 /£63.99 $89.95 /£57.99 $167.95 /£107.00
For more informationand acompletelistof titles,visitusat www.crcpress.com
Sensory EvaluationTechniquesSensory Suggested Price: April 2010,6-1/8x9-1/4,230pp. eBook ISBN:978-1-4398-2948-6 Print ISBN:978-1-4398-2947-9 a competentandreproduciblefashion. allows managers or safety/environmental officers to undertake in-house audits in process, itemphasizesaccurateauditingthatisrepresentativeandrepeatable.It auditing techniquesdesignedtoovercome commonproblemsintheaudit gives accessibleuser-friendlyadviceinastep-by-stepmanner. Buildingonnovel to theoverlyacademicanduninspiringtoneofmostauditingbooks,thistext retain theknowledgeandlearningin-house.Incontrast and businesstoavoidexpensiveexternalauditors occupational healthaudits,thisbookallowsorganizations A practicalguidetoenvironmental,safety, and Simon Watson Pain A PracticalGuide Environmental Auditing Safety, Health,and Suggested Price: March 2014,6-1/8x9-1/4,700pp. eBook ISBN:978-1-4665-1675-5 Print ISBN:978-1-4665-1674-8 range ofissuesand industries. government policies.Thebook includesnumerous case studiesthatspanawide risk strategies,financials,directtradingversesauction,andnavigatingrelevant managing perishables,infrastructure, retailing, quality, information technology, processed or farm fresh, inputandoutputchallenges,processors, challenges of facility, inventory, andtransportationmanagement,sourcing decisionssuchas agricultural products.Topics includemajordrivers, supply chainmanagementwithinbusinesseshandling This bookintroducesthecomplexityandimportanceof Indian InstituteofManagement,Ahmedabad,Gujarat,India G. Raghuram Take Solutions,Ltd., ChennaiTamilnadu, India N. Chandrasekaran Management Agribusiness SupplyChain Suggested Price: May 2015,7x10,480pp. Print ISBN:978-1-4822-1690-5 Multi-Evaluation) havebeenaddedtothedescriptiveanalysischapters. time intensitytestingmethods(TDS,TOS,progressiveprofiling, Time Intensity the materialisrearrangedtoreflectadvancesofinternettesting,andnew intuitive, statisticalmethodsareadaptedtoamorebasicconsumermethodology, comprehensive reorganization,revision,andupdating.Theorganizationismore to presenting advancedstatistical methods. The new edition hasundergone a evaluationproject listing thestepsinvolvedinasensory evaluationstudies,from sensory phases ofperforming The fiftheditionofabestseller, thisbookcoversall B. ThomasCarr New Providence,Jersey, USA SpectrumIncorporated, Sensory Gail Vance Civille Fifth Edition $109.95 /£69.99 $99.95 /£63.99 $149.95 /£95.00
91 Quality Control & Reliability / Supply Chain Management/Logistics Air Cargo Management City Logistics Yoon Seok Chang Mapping The Future Korea Aerospace University, Goyang-City Edited by Air transportation is a key component of the global Eiichi Taniguchi economy. Airport authorities are struggling to meet Department of Urban Management, Kyoto University, Japan the increasing demand due to facility limitations, cost Russell G. Thompson concerns, training and education, and the complexities The University of Melbourne, Parkville, Australia of elasticity in demand. This book discusses next
Supply Chain Management/Logistics generation cargo management based on recent Examining recent advances, this book covers city logistic multi-million dollar research and development cases. It includes discussions and associated implementation issues, methodologies, of conventional cargo management, cargo process software and hardware/ and policy measures. It details the experiences of cities that have implemented facilities, key performance indicators (KPI), the latest state of the art technologies city logistics and the methods they have used for solving complex issues relating (including advanced facilities) and process innovation. to urban freight transport. Experts from major cities around the world discuss regional developments and success stories, describe personal experiences, and Print ISBN: 978-1-4665-8680-2 evaluate emerging trends as they relate to the future of urban logistics. Topics June 2015, 6-1/8 x 9-1/4, 232 pp. include public policy, integrating logistics in urban planning designs, modeling Suggested Price: $89.95 / £57.99 approaches, evaluating successful programs, urban distribution centers, and intelligence transportation. Print ISBN: 978-1-4822-0889-4 November 2014, 6-1/8 x 9-1/4, 234 pp. Suggested Price: $79.95 / £49.99
Best Practices for Transportation Agency Use of Social Media Designing Food Safety and Edited by Equipment Reliability Through Susan Bregman and Kari Edison Watkins Maintenance Engineering Best Practices for Transportation Agency Use of Sauro Riccetti Social Media offers real-world advice for planning and Tetra Pak, Italy implementing social media from leading government This book identifies a way to ensure food product practitioners, academic researchers, and industry experts. safety through maintenance engineering. Maintenance It provides an overview of the various social media engineering normally starts with equipment reliability, but platforms and tools, with examples of how transportation organizations use this book starts from product safety to identify equipment each platform. Filled with examples from transportation organizations, the text criticalities and then maintenance solutions. With its ability to integrate food provides ideas that can apply to all modes of transportation including mass safety techniques with reliability and maintenance engineering techniques, this transit, highways, aviation, ferries, bicycling, and walking. book will help readers identify a maintenance design and implementation process Print ISBN: 978-1-4665-6860-0 that can control food safety and equipment reliability in their organization. eBook ISBN: 978-1-4665-6861-7 Print ISBN: 978-1-4665-8987-2 October 2013, 6-1/8 x 9-1/4, 331 pp. eBook ISBN: 978-1-4665-8988-9 92 Suggested Price: $71.95 / £45.99 September 2013, 6-1/8 x 9-1/4, 413 pp. Suggested Price: $62.95 / £39.99
Capitalizing on Lean Driving Risk and Spend Out of Production Systems to the Global Supply Chain Win New Business Thomas A. Cook American River International, Melville, New York, USA Creating a Lean and Profitable The Global Warrior Series New Product Portfolio This book is among the first to detail all the risks a Chris Harris and Rick Harris multinational firm faces when operating overseas and Harris Lean Systems, Murrells Inlet, South Carolina, USA engaging in foreign purchasing and sales, import and Providing a fundamental understanding of the Lean export trade, and global logistics. It provides step-by-step enterprise production system, this book can help an organization translate its guidance on how to develop a global risk strategy as well as a blueprint for current Lean knowledge into a step-by-step methodology to win and launch implementation. The book outlines all the areas where spend can be reduced new business. By developing the New Product Acquisition and Launch Portfolio along with a specific strategy on how to reduce spend without compromising presented in this book, readers can dramatically improve their ability to acquire values. new business and deliver products on time. Detailing how to achieve a successful Print ISBN: 978-1-4822-2608-9 new product launch through upfront planning, this book provides readers with September 2014, 6-1/8 x 9-1/4, 366 pp. the understanding to enhance efficiencies throughout the supply chain. Suggested Price: $89.95 / £57.99 Print ISBN: 978-1-4665-8633-8 eBook ISBN: 978-1-4665-8634-5 December 2013, 8-1/2 x 11, 189 pp., Soft Cover Suggested Price: $49.95 / £31.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: November 2014, 6-1/8 x9-1/4,432pp. Print ISBN:978-1-4398-1554-0 future purchasing behaviors. perception ofanorganization’s corporatesociallegitimacyandconsumers’ the waysinwhichalternativeproduct recallstrategiesinfluenceconsumers’ a conceptualmodelthatsynthesizesthe literatureandcasestudies,describes include theperspectivesofU.S.andChinese executives.Thebookthenpresents studies coverU.S.companieswithsupply chains thatextend into China and supply chainsinthreeindustries:toys,food,andpharmaceuticals.These case disciplines and presents detailed research case studies of six extendedglobal This bookdrawstogetherkeyinsightsfromtherelevantliteratureacrossdiverse Series: SupplyChainIntegrationModeling,OptimizationandApplication University ofTechnology (China) China EuropeInternationalBusinessSchoolandSouth Xiande Zhao Indiana University, KelleySchoolofBusiness Barbara B.Flynn Edited by Product RecallsandTheirImpact Management Global SupplyChainQuality Suggested Price: December 2014,6-1/8x9-1/4,328pp. Print ISBN:978-1-4822-2694-2 industrial engineeringdisciplineandhowtousethem. classical applications.Ithighlightstherichnessoflogisticsapplicationsin in manydifferentapplicationareas,andprovidesthestate-of-the-artonsome the globallogistics,thisbookclearlyillustrateslogisticproblemsencountered on thetopic.Anoutletforrecentdevelopment the years,solidifyingneedaconsolidatedresource Industrial Engineering--hadincreasedrapidlythroughout Academic interestinresearch onlogistics–akeyconceptof Series: IndustrialEngineering and BopayaBidanda Bahar Y. Kara,IhsanSabuncuoglu, Edited by Global LogisticsManagement Suggested Price: December 2011,8-1/2x11,1528pp.,Online/Web Print ISBN:978-1-4398-6152-3 Lean andSixSigmamovements. change, globalizationandsupplychains,thedesignof of supplychainchange,projectmanagementapproachesfor ofbothfundamentaltopicsandrecentadvances.Itcoversdrivers clear overview that spantheentireareaofsupplychainmanagement.Thebookoffersabroad, contains approximately 300accessibleentriesonarangeofcutting-edgetopics With contributionsfromexpertsinthefield,thiscomprehensiveencyclopedia CGR ManagementConsultants,PlayadelRey, California,USA James B.Ayers Edited by (Online Version) Encyclopedia ofSupplyChainManagement $79.95 /£49.99 $89.95 /£57.99 $895.00 /£560.00
For more informationand acompletelistof titles,visitusat www.crcpress.com
Emerging Countries Applications in Industrial Engineering Suggested Price: 2015,6-1/8x9-1/4,848pp. January Print ISBN:978-1-4822-2685-0 best practicesandalsotostudythegrowthofdisciplineinternationally. that are set internationally, and allow students and practitioners to learn from sponsored by the IIE. The books showcase real-life case studies and applications Institute ofIndustrialEngineering(IIIE)ConferenceheldinIstanbulJune2013, the booksrepresentbestpapersfromInternational that are drawn from multiple countries. The chapters in The booksprovideinnovationapplicationsandcasestudies Series: IndustrialEngineering and BaharY. Kara Bopaya Bidanda,IhsanSabuncuoglu, Edited by Management, Tools, andApplications Industrial Engineering Suggested Price: November 2014,6-1/8x9-1/4,214 pp. Print ISBN:978-1-4822-2687-4 applied toadiversityofenvironments, manyofwhichcanbefoundinthisbook. environments. Itclearly illustrates howIEbasedtools and techniqueshave been industrial engineeringdiscipline– non-traditional settings andinternational the appropriatearchival outlets.Thisbookfocusesontwokeyaspectsofthe knowledge beingdeveloped,butthisbodyofoftendoesnot find departments outsidetheUnitedStateshasledtoasignificantbody of IE The rapid growth of the IE profession and academic Series: IndustrialEngineering and BaharY. Kara Bopaya Bidanda,IhsanSabuncuoglu, Edited by in InternationalSettings Non-Traditional Applications Industrial Engineering Suggested Price: 2015,6-1/8x9-1/4,304pp. January Print ISBN:978-1-4822-2689-8 case studiesanddiscussestheapplicationofIEtools. empirical datafrompharmaceuticalmanufacturingsectorinPakistan.Itprovides using quality managementpracticesthatimpactsupplychainperformance in pharmaceuticalsupplychainstoriskanalysisofmaritimeportsandidentifies in emerging countries.The book covers topicsranging from quality management implementations ofoperationsresearch techniquesonselectedlogisticproblems logistics management,thisbookfocusesonrecentdevelopmentsand The secondvolumeofathree-volumeseriesonglobal Series: IndustrialEngineering and BopayaBidanda Ihsan Sabuncuoglu,BaharY. Kara, Edited by $209.95 /£134.00 $89.95 /£57.99 $89.95 /£57.99
93 Supply Chain Management/Logistics Introduction to Supply Chain Lean Logistics Management Technologies The Nuts and Bolts of Delivering Second Edition Materials and Goods David Frederick Ross Michel Baudin APICS National, Chicago, Illinois, USA MMTI, Palo Alto, California, USA Series: Resource Management Defining best post production processes for finished The second edition of this popular resource reflects new goods, respected consultant Michel Baudin teaches
Supply Chain Management/Logistics technology in supply chain management (SCM). Providing business operators how to maintain supply that meets a comprehensive review of business computing, it features new chapters on the demand, as well as the ability to organize and deliver that fundamentals of computing and their enabling power as well as the basics of supply. Applying his well known nuts and bolts approach, Baudin addresses the contemporary ERP/supply chain business solutions. This book remains a critical physical infrastructure of lean logistics and the flow of information that serves as resource on the enabling power of today’s technologies and their impact on its nervous system. He demonstrates how to avoid shortages while maintaining SCM. Focusing on the impact of the Internet on strategic elements of SCM, low inventories, and explains how to take advantage of the increased flexibility the author highlights integrative software tools that allow for new levels of generated through lean manufacturing. He also offers innovative approaches to collaboration, flexibility, and performance. supplier relations and efficient ways to deliver parts to assemblers. Print ISBN: 978-1-4398-3752-8 Print ISBN: 978-1-56327-296-7 eBook ISBN: 978-1-4398-3753-5 February 2005, 6 x 9, 400 pp. October 2010, 6-1/8 x 9-1/4, 424 pp. Suggested Price: $74.95 / £47.99 Suggested Price: $94.95 / £59.99
Lean RFS (Repetitive Flexible Supply) Kanban for the Shopfloor Putting the Pieces Together Productivity Press Development Team Ian Fraser Glenday and Rick Sather Kanban is the name given to the inventory control card Using proven examples and quantifiable evidence, used in a pull system. The primary benefit of kanban is Lean RFS (Repetitive Flexible Supply) demonstrates to reduce overproduction, the worst of the seven deadly that repetitive flexible supply (RfS) is not only possible, wastes. A true kanban system produces exactly what is but that its implementation can help you reach a new ordered, when it is ordered, and in the quantities ordered. level of improved performance in manufacturing and across your entire supply Kanban for the Shopfloor provides a working manual for chain. This book is unique in that it clearly spells out the theory and practice those seeking to implement this method of production originally published in the Shingo Prize winner, Breaking Through to Flow, with control in any operation. It defines the various terms and methods employed actual stories of Kimberly-Clark’s experience in using them over the years with in kanbans, and illustrates how when adhered to, kanban is an element of great success. continuous improvement that ultimately leads to the ideal of one-piece flow.” Print ISBN: 978-1-4665-7819-7 Print ISBN: 978-1-56327-269-1 eBook ISBN: 978-1-4665-7820-3 February 2002, 7 x 10, 120 pp., Soft Cover May 2013, 8-1/2 x 11, 152 pp., Soft Cover Suggested Price: $37.95 / £23.99 94 Suggested Price: $62.95 / £39.99
Kanban for the Supply Chain Lean Supply Chain Fundamental Practices for Management Essentials Manufacturing Management, A Framework for Materials Managers Second Edition Bill Kerber Stephen Cimorelli High Mix Lean, Medford, New Jersey, USA Cummins Filtration, Nashville, Tennessee, USA Brian J. Dreckshage Supply Chain Management Consultant, Providing actionable steps for each stage in the Ballwin, Missouri, USA manufacturing and supply chain management process, this book presents a detailed roadmap for implementing Kanban. This updated This book explains why the traditional materials second edition focuses on creating an environment for success. Addressing both planning environment, typically embodied by an Enterprise Resource Planning internal and external elements, it considers statistical data cleansing techniques (ERP) system, is an ineffective support system for a company that wants to to remove irrelevant data, correlation analysis using Excel-based techniques to adopt Lean practices. It offers an alternative methodology for implementing guide decisions, the analysis of supplier performance against lead time and lot Lean into the supply chain that allows for ongoing experimentation, learning, size expectations, and risk mitigation strategies for poor performing suppliers. and improvement. After defining supply chain management and Lean basics, it explores the conflicts between Lean and the traditional framework. It includes Print ISBN: 978-1-4398-9549-8 a chart that matches Lean tools with the planning and control charts that have eBook ISBN: 978-1-4398-9550-4 served as the model for ERP systems. January 2013, 8-1/2 x 11, 137 pp., Soft Cover Suggested Price: $62.95 / £39.99 Print ISBN: 978-1-4398-4082-5 eBook ISBN: 978-1-4398-4085-6 March 2011, 7 x 10, 274 pp., Soft Cover Suggested Price: $68.95 / £43.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2014,6-1/8x9-1/4,405pp. February eBook ISBN:978-1-4665-9579-8 Print ISBN:978-1-4665-9578-1 overall riskexposure. can easilyfollowtoengageinmoredeals andincreasereturns,whilereducing delays. The book establishes a simple, yet comprehensive, roadmap that readers practices tohelpreaderssteerclearof complianceissuesthatcanleadtocostly it detailsoptionstohelpreadersreducetheirexposureriskaswell best from your supply chain. Illustrating how Incoterms impact compliance and risk, and leveraged options, along with Incoterms, to extract the maximum benefits business personmustknow, thisbookdescribeshowtoutilizenegotiationskills Explaining thekeyelementsofwhatanyinternational American RiverInternational,Melville,NewYork, USA Thomas A.Cook and LeveragingSupplyChainOptions Contractual BestPractices,Incoterms, Negotiating CompetitiveAdvantage of GlobalTrade Mastering theBusiness Suggested Price: April 2015,6-1/8x9-1/4,248pp. Print ISBN:978-1-4822-2615-7 and supplychain,withspecificanalysisoftheissuesrelevanttotheseareas. disciplines, includingsales,purchasing, contractmanagement,customerservice, from otherbooksonthesubjectasitprovidesanoutlineofvariouscorporate ofpracticalnegotiationtips,strategies,andactionsteps.Itisdifferent overview prospered recently. Thisbooksuppliesacomprehensive than averagenegotiationskillsetsaretheonesthathave important .Thecompaniesandindividualswithbetter Never hastheabilitytonegotiategloballybeenmore The GlobalWarrior Series American RiverInternational,Melville,NewYork, USA Thomas A.Cook Negotiation SkillSets Mastering International Suggested Price: November 2013,6-1/8x9-1/4,493pp. Print ISBN:978-1-4822-0533-6 increases incost-efficiencies. and achieve higherlevelsofresponsiveness,improvedcustomerservice, fundamental planningparadigmsinamannerthatwillhelptheirorganizations supply chainexperts.Itexplainshowreaderscanchangetheirapproachtothe developed byleadingresearch champions,and institutes,processindustry problems intheprocessindustry’s methods supplychains,itpresentspowerful a cutting-edgesupplychainmanagementconceptthataddressescurrent in today’s planningprocessesandsystems.Presenting to managingvariability, uncertainty, andcomplexity This bookintroducesanewparadigmand approach Josef Packowski Master Today’s VUCAWorld Paradigm forProcessIndustriesto The NewSupplyChainManagement LEAN SupplyChainPlanning $79.95 /£49.99 $89.95 /£57.99 $94.95 /£59.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Management Principles ofSupplyChain Textbook Suggested Price: June 2013,6-1/8x9-1/4,200pp. eBook ISBN:978-1-4665-5548-8 Print ISBN:978-1-4665-5546-4 presentation oftheauthor’s uniqueandsustainableagendaforchange. understand thecurrentsetofchallengesfacingindustry, andgetathorough center. Itdetailsthehistoricalcontextofbiopharmaceuticalvaluechain, evolution tooccur. Itdiscusseshowtoalignenterpriseswiththepatientat that patient-focusednetworkintegrationistheonlywayfororganizational to the huge populationswho arefacing healthcare uncertainty. Thisbook argues going through a massive change that is sending shudders asweknowittodayis The biopharmaceuticalindustry North CarolinaStateUniversity, Raleigh,USA Robert Handfield for theYears Ahead Strategic Imperatives Integration inBioPharma Patient-Focused Network Suggested Price: 2013,6-1/8 x9-1/4,422pp. January eBook ISBN:978-1-4398-9903-8 Print ISBN:978-1-4398-9902-1 suitable combinationoftwoormorequantitativetechniques. particular decision-makingsituation,usingasuitablequantitativetechnique ora the issues.Ithighlightshowacurrentissuecanbeeffectivelyapproached in a and/or simulationmodelingbasedsolutionmethodologiesforamajority of making situationsprovidingeasy-to-usemathematical chains, usingefficientmodelsinavarietyofdecision- strategic, tactical,andoperationplannersofreversesupply This bookaddressesseveralimportantissuesfacedby Northeastern University, Boston,Massachusetts,USA Surendra M.Gupta Edited by Issues andAnalysis Reverse SupplyChains Suggested Price: December 2014,7x10,712pp. Print ISBN:978-1-4822-1202-0 with theneweditionisacompletesetofinstructormaterials. reshoring, sustainability, projectmanagement,anddataanalysis.Alsoavailable on currenthottopicssuchase-commerce, riskmanagement,outsourcing and designing andimplementinganintegratednetwork.Thisneweditionexpands of supply chain components. The third section presents a practical look at the currentlandscapeofbusiness.Thesecondsectionpresentsadetailedstudy ofhowsupplychainmanagementfitsinto section givesacompleteoverview oftheprinciplessupplychainmanagement.Thefirst a balancedoverview This secondeditionofapopulartextbookpresents Series: Resource Management and CharlieC.Chen Richard E.Crandall,William R.Crandall, Second Edition $71.95 /£45.99 $94.95 /£59.99 $89.95 /£57.99
95 Supply Chain Management/Logistics Risk Intelligent Supply Chains Supply Chain Optimization How Leading Turkish Companies through Segmentation Thrive in the Age of Fragility and Analytics Çagˇ rı Haksöz Gerhard J. Plenert Sabancı University, Istanbul, Turkey MainStream GS, LLC, Carmichael, California, USA This unique avant-garde book brings the risk intelligent Series: Resource Management supply chain (RISC) concept to life for the first time. It Supply Chain Segmentation (SCS) has become a critical
Supply Chain Management/Logistics answers the question of how to become a risk intelligent tool in optimizing supply chain performance. By using supply chain. It proposes the I-Quartet Model with four segmentation, an organization is taken out of the world of “one size fits all” and essential roles “Integrator, Inquirer, Improviser, and Ingenious,” that any supply brought into a world that facilitates customized responses. This book explains chain network must play to become risk intelligent. The book also presents what SCS is, how it works, and the role of analytics. The book gives detailed never-before-published cases and practices of leading Turkish companies that case studies demonstrating how SCS is applied and improves efficiency. It covers thrive globally in the age of fragility with their supply chain risk intelligence. This software appropriateness and integration, as well as a full summary perspective book is a must-have for any business leader looking to better understand their on segmentation and its competitive impacts in terms of economic pressure, global position and develop their strategic capabilities. supplier and consumer interfaces. Print ISBN: 978-1-4665-0447-9 Print ISBN: 978-1-4665-8476-1 eBook ISBN: 978-1-4665-0448-6 eBook ISBN: 978-1-4665-8477-8 April 2013, 6-1/8 x 9-1/4, 289 pp. April 2014, 6-1/8 x 9-1/4, 259 pp. Suggested Price: $83.95 / £53.99 Suggested Price: $69.95 / £44.99
Textbook Supply Chain Engineering Supply Chain Risk Management Models and Applications An Emerging Discipline A. Ravi Ravindran Gregory L. Schlegel The Pennsylvania State University, University Park, USA VP Business Development, SherTrack LLC and Founder, The Supply Chain Risk Management Consortium Donald P. Warsing, Jr. North Carolina State University, Raleigh, USA Robert J. Trent Lehigh University, Bethlehem, Pennsylvania,USA Operations Research Series Series: Resource Management Using state-of-the-art models, concepts, and solution methods, this book provides This book presents a risk management framework that an understanding of how companies plan, source, make, and deliver products will help readers position and conceptualize the topic of supply chain risk to create and maintain a global competitive advantage. The authors employ the management. With this framework, practitioners will be able to reduce costs precise tools of engineering analysis to address broad and challenging problems associated with risk, protect their brand and reputation, ensure positive financial in business management, emphasizing a quantitative approach to solving outcomes, and begin to develop visible, predictable, resilient, and sustainable problems related to designing and operating supply chains. This comprehensive supply chains. The book provides access to a Cloud-based, end-to-end supply text progresses from laying out a strategic framework to addressing tactical chain risk assessment “Heat Map” which illustrates the maturity of the chain elements for managing flow of goods, putting it together in the context of the through the various stages. global supply chain. Print ISBN: 978-1-4822-0597-8 Print ISBN: 978-1-4398-1198-6 96 October 2014, 6-1/8 x 9-1/4, 334 pp. eBook ISBN: 978-1-4398-1199-3 Suggested Price: $79.95 / £49.99 September 2012, 6-1/8 x 9-1/4, 548 pp. Suggested Price: $139.95 / £89.00
Textbook Supply Chain Security Supply Chain Management A Comprehensive Approach for Engineers Arthur G. Arway Samuel H. Huang St. James City, Florida, USA University of Cincinnati,Ohio, USA The challenge of trying to secure the supply chain at The book focuses on helping students develop strong every level is both a domestic and global concern. This analytical skills and the ability to solve real-world volume provides security professionals the tools necessary problems through analysis and synthesis. It also stresses to ensure supply chain security. It demonstrates how to the importance of integrating engineering optimization establish and enforce security policies and protocols, techniques with business strategic thinking. It starts with the description of including rapid responses that must be deployed in the event of a theft or different types of supply chains and the strategy for designing an appropriate security incident. Most importantly, it enables professionals to integrate business supply chain based on product life cycle analysis. It then focuses on quantitative practices into the planning, development, and successful operation of supply analysis techniques including demand forecasting, aggregate planning, inventory chains to ensure security and protect assets. management, and distribution network design. It also covers supplier selection. Print ISBN: 978-1-4665-1187-3 The book is comprehensive yet concise, and includes many practical examples eBook ISBN: 978-1-4665-1190-3 that are designed to help students acquire deep subject matter knowledge. March 2013, 6-1/8 x 9-1/4, 189 pp. Print ISBN: 978-1-4665-6892-1 Suggested Price: $71.95 / £45.99 eBook ISBN: 978-1-4665-7092-4 June 2013, 6-1/8 x 9-1/4, 240 pp., Soft Cover Suggested Price: $94.95 / £59.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,6-1/8x9-1/4,296 pp. Print ISBN:978-1-4665-9580-4 decentralized, net-enabledapproaches toC2;and,(4)Thedatadeluge. establishmentsformcoalitionsandpartnerships; (3)Theriseof as military and communicationstechnologies;(2)Theincreasingcomplexityofendeavors megatrends are:(1)Thewideavailabilityofadvancedcommercial information state oftheartandpracticeC2,butalsochallengesweface.These individually andcollectivelyareshapingnotonlythe This bookidentifiesfourinterrelatedmegatrendsthat communications technology of thepast two decades. of mostthemajordevelopmentsininformationand Command andControl(C2)technologysitsatthenexus and JonathanRussellAgre Marius S.Vassiliou, DavidS.Alberts, The FutureoftheEnterprise C2 Re-envisioned Suggested Price: October 2014,6-1/8x9-1/4,396pp. Print ISBN:978-1-4822-3254-7 homeless andviolencepreventioninschools. police andexploresnewrolesforvolunteerpolice,includingtreatmentofthe andreserve policing. ItincludesthelatestCALEAstandardsconcerningauxiliary and discussesavarietyoflegalmattersconcerningvolunteerparticipationin police departments, government, examines youth involvement in contemporary contributions of police andsafetyvolunteersatalllevelsof or modifytheirownvolunteerprograms.Itpresents U.S., thisbookisdesignedtohelppoliceleadersadopt operations andlegalaspectsofvolunteerpoliceinthe ofthehistory,A selectiveoverview organizations, SUNY Ulster(Retired),NewYork, USA Martin AlanGreenberg Mobilizing forSecurity American Volunteer Police Suggested Price: December 2013,6-1/8x9-1/4,280pp. eBook ISBN:978-1-4822-0911-2 Print ISBN:978-1-4822-0909-9 logistic planning. improved planning relative to human usage, freight transportation, and city logistics. Italsointroducesthenotionofmegalopolisandneedfor Technologies (andIntelligentTransport System applicationswithinurban considerations onhumanlife.ItaddressesInformationandCommunication and logisticssystemsinurbanareasfromtheviewpointofsafetysecurity comprehensive coverageprovidesthefoundationforexaminingtransport and avisionforurbantransportlogisticsrelatingtohumansecurity. Its the world,thisbookexaminescutting-edgeconcepts Detailing thebestpracticesof expertsfromaround and RussellG.Thompson Eiichi Taniguchi, Tien FangFwa, Edited by Health, Safety, andSecurityConcerns and Logistics Urban Transportation $59.95 /£38.99 $79.95 /£49.99 $104.95 /£65.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Preparedness, ThirdEdition Homeland SecurityandEmergency Critical Infrastructure Suggested Price: November 2011,6-1/8x9-1/4,246pp. eBook ISBN:978-1-4398-7455-4 Print ISBN:978-1-4398-7454-7 efforts. the responseandrecovery of a crisis, and the roles of high-level personnel in settingpolicyand direction for mass destructionincidents,stressmanagement,businesscontinuityintheface successfully, guidelinesforrespondingtohazardousmaterialsandweaponsof scene, leadershipstyleandtechniquesrequiredtomanageacriticalincident Topics includethephasesofacriticalincidentresponseandstabilizing applicable to a host of public and private sector scenarios. effectively, thisvolumeprovidesprovenmethodologies contain, manage, and resolve emergencies efficiently and Filled withtacticaldirectiondesignedtoprevent, and ThomasT. Gillespie Vincent Faggiano,JohnMcNall, Second Edition A CompleteResponseGuide, Critical IncidentManagement Suggested Price: April 2013,6-1/8x9-1/4,229pp. eBook ISBN:978-1-4665-5751-2 Print ISBN:978-1-4665-5750-5 protection systemdesignandconsequence mitigation. modeling dependencies—optimizingsystemresiliencyforeffectivephysical the theoretical to practical application. These protocols leverage expertise in andutilizeriskassessmentsinamanner thatextendsbeyond experts toperform analytical approachandmethodologyenablesdecision-makerssecurity events. DevelopedatSandiaNational Labs, theauthors’ undesired eventsormitigatetheconsequencesofsuch effective protection system that can either prevent presents a practical methodology for developing an itsmissionorfunction,thisvolume ability toperform With anemphasisonprotectinginfrastructure’s Betty Biringer, EricVugrin, andDrakeWarren Security andResiliency Critical InfrastructureSystem Suggested Price: April 2013,6-1/8x9-1/4,283pp. eBook ISBN:978-1-4665-0346-5 Print ISBN:978-1-4665-0345-8 systems, andSCADAsystemstheirchallenges. impact of different types of regulations, and evaluates ISACs, distributed control examinesthe importance ofriskassessmentsandhowtheyareperformed, within theinfrastructuresectoraswellbetweensectors.Italsodiscusses discusses changes in how governments and the private sector share information redundant infrastructure. Updated to reflect these new emphases, this volume shift to more fluid postures associated with resilience and the establishment of significant stridestosafeguardourworld’sa infrastructures.Therehasalsobeen Since theinitialinceptionofthisbook,therehavebeen Arnprior, Ontario,Canada SecurityManagementInc., Evolutionary Allan McDougall Infracritical, Geneva,Illinois,USA Robert S.Radvanovsky $92.95 /£58.99 $94.95 /£59.99 $99.95 /£65.99
97 Supply Chain Management/Logistics / Disaster Planning & Recovery Critical Urban Emergency Management Infrastructure Handbook The American Experience 1900-2010, Edited by Second Edition Takeshi Koike and Takehiko Ono Edited by Japan Society of Civil Engineers, Tokyo, Japan Claire B. Rubin A superb reference for civil and mechanical engineers Arlington, Virginia, USA involved in the planning, operations, management, This volume provides a history and analysis of the and maintenance of all urban utilities, this handbook political and policy processes of the federal government addresses water supply and sewerage, power, gas, involvement in emergency management from 1900 telecommunications joint utility corridor (utilidor) lifeline facilities and other
Disaster Planning & Recovery through 2010. This second edition presents the necessary background for critical civil infrastructure lifelines. It covers the design and construction of understanding political, policy, and other essential aspects of emergency facilities, maintenance, disaster management, environmental protection, and management, including identifying and developing the key time bands of disaster and emergency recovery measures. It also discusses urban planning, life information about emergency management. The book covers updates to policy, cycle cost, GIS analysis of lifeline systems, computerized integrated management shifts in the DHS and FEMA, and responses to disasters over the last 5-plus years systems, and the use of new materials and technologies. including considerable coverage of the BP oil spill. Print ISBN: 978-1-4665-9204-9 Print ISBN: 978-1-4665-1753-0 December 2014, 7 x 10, 584 pp. eBook ISBN: 978-1-4665-1754-7 Suggested Price: $179.95 / £114.00 April 2012, 6 x 9, 312 pp., Soft Cover Suggested Price: $46.95 / £29.99
Textbook Emergency Planning Guide Disaster Recovery for Utilities Second Edition Second Edition Brenda D. Phillips Samuel Mullen Oklahoma State University, Stillwater, USA Absecon, New Jersey, USA
The first edition of Disaster Recovery set a high An increase in major natural disasters has led to heightened standard for evidence-based best practices in a user- concerns about utility operations and public safety. Due to friendly textbook. Since its publication, a number today’s complex, compliance-based environment, utility of important new studies and guides have become managers and planners often find it difficult to plan for the action needed to available, necessitating an update to this work. This second edition includes help ensure organization-wide resilience and meet consumer expectations updated coverage of recent disasters, including the Haiti earthquake of 2010 during these incidents. This volume offers a working guide that presents new and the Japanese tsunami. More international in scope, the book contains cases and field-tested approaches to plan development, training, exercising, and from all over the world, practitioner insight in boxed sections for quick access, emergency program management. The book will help utility planners, trainers, and a survey of overseas recovery practices to provide a more rounded, global and responders to more effectively prepare for damaging events and improve perspective. the level of the utility’s resilience. Print ISBN: 978-1-4665-8384-9 Print ISBN: 978-1-4665-0485-1 98 May 2015, 7 x 10 eBook ISBN: 978-1-4665-0486-8 Suggested Price: $69.95 / £44.99 January 2013, 6-1/8 x 9-1/4, 232 pp. Suggested Price: $94.95 / £59.99
Disaster’s Impact on Livelihood Textbook and Cultural Survival Geographic Information Systems (GIS) Losses, Opportunities, and Mitigation for Disaster Management Edited by Brian Tomaszewski Michele Companion Rochester Institute of Technology Disasters continue to escalate in frequency, scope, and impact. Geographic Investigating 18 countries around the world, leading information systems (GIS) provide essential decision support and analytical policy makers, community leaders, urban planners, and capabilities for the full disaster management cycle. Assuming no previous emergency practitioners and managers review livelihood knowledge in GIS and/or disaster management, this book is a primer on GIS challenges and cultural survival in the wake of disasters. The contributors explore principles. Topics include the basics of GIS, what it can and can’t do, GIS data both losses and opportunities for cultural and livelihood adaptation, change, and formats (vector, raster, imagery), and basic functions of GIS including analysis, disaster impact mitigation. They suggest “best practices” models to enhance map production/cartography, and data modeling. The book provides disaster future event response and assess new instruments and methodologies for management practitioners and students with the latest developments in both better planning and assessment of disaster impacts. Multiple forms of disasters the current state of the art and future trends. are introduced to demonstrate the myriad long-term and sociological impacts disasters can have on communities. Print ISBN: 978-1-4822-1168-9 November 2014, 7 x 10, 312 pp. Print ISBN: 978-1-4822-4843-2 Suggested Price: $89.95 / £57.99 March 2015, 6-1/8 x 9-1/4, 352 pp. Suggested Price: $99.95 / £63.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: September 2014,6-1/8x9-1/4,338 pp. eBook ISBN:978-1-4822-2892-2 Print ISBN:978-1-4822-2891-5 sustainability. and regionallevelstoreducetheadverse consequencesofdisastersandtofoster examine strategies that may be taken at the individual, organization, community, assessment forthenatural,built,andhumanenvironment.Thebookaims to book presentsasystematicprocessofhazardsidentificationandvulnerability can haveregional,national,andevenglobaleconomicconsequences. This growing scaleofdisasters,today’s catastrophicdisasters Moreover, withourglobalinterconnectedness andthe increased exponentiallyoverthepastfewdecades The impactsofnaturalandman-madedisastershave Appalachian StateUniversity, Boone,NorthCarolina, USA John C.Pine Second Edition Reducing theImpactofDisasters, Hazards Analysis Suggested Price: 2013,6-1/8x9-1/4,383pp. February eBook ISBN:978-1-4665-0227-7 Print ISBN:978-1-4665-0226-0 management environmentsatthestrategic,tactical,andoperationallevels. program. The authors present a “best practices” approach to securing business automation/process controlsystemsaspartofacriticalinfrastructureprotection facilities worldwide.Thebooksuppliesinformationforsecuringindustrial and technologythatquietlyoperateinthebackgroundofutilityindustrial controlanddataacquisition(SCADA)systems pertaining tothesupervisory volume outlinessecurityconcepts,methodologies,andrelevantinformation upon are routinely put at risk by cyber threats. This werely The availabilityandsecurityofmanyservices Woodbine, USA Maryland, Jacob Brodsky CIPS, Infracritical,Geneva,Illinois,USA Robert Radvanovsky Edited by Systems Security Handbook ofSCADA/Control Suggested Price: June 2015,6-1/8x9-1/4,264pp. Print ISBN:978-1-4665-9934-5 their efforts. knowledge oftherangegeographicinformationtoolsavailabletosupport protection withanunderstandingofthebenefitsGISfortheirworkandabasic book provides first responders and agencies responsible for critical infrastructure health andsafety, economicvitality, andwayoflife.This isessentialtothenation’sthe country security, public ensuring thecontinuityofcriticalinfrastructure role incriticalinfrastructureprotection.Protectingand Geographic informationsystems(GIS)playaprimary and Talbot J.Brooks Robert F. Austin,DavidP. DiSera, Protection GIS forCriticalInfrastructure $79.95 /£49.99 $99.95 /£65.99 $119.95 /£76.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
the BuiltEnvironment Hurricane Mitigationfor Suggested Price: April 2015,6-1/8x9-1/4,288pp. Print ISBN:978-1-4822-4190-7 of experienceinrealdisasterevents,includingHurricaneKatrina. effective emergency plan to all staff. All content is based on the author’s decades developing anEmergencyOperationsCenter(EOC)andcommunicating response, andrecovery. Itprovidesbestpracticesfor from preparednessand planning to event mitigation, all aspects of hospital emergency management— presents manyuniquechallenges.Thisbookaddresses Emergency managementinahospitalenvironment NorthShore RegionalMedicalCenter, Slidell,Louisiana,USA Robert J.Muller, M.D. Management Hospital Emergency Suggested Price: October 2011,7x10,517pp. eBook ISBN:978-1-4398-3072-7 Print ISBN:978-1-4398-3070-3 and includesdiscussionquestions,references, andadditionalresources. world provide real-world insights. Each chapter begins with learning objectives of emergencymanagementprograms andexpertpractitionersfromaroundthe responsibilities oftheemergencymanager. Boxedfeatureswrittenbygraduates on core competencies, ethical practice standards, certification issues, and the It outlinesvariouscareertrackswithinemergencymanagementwithafocus ofcommunitiesandpeopleatriskfromdisasters. service practitioner viewpointstorevealthechallengeofafieldin life casestudies,integratingscientificfindingswith management, thisvolumeengagesreadersinreal- Providing aninsider’s glimpse intoemergency WebbBrenda D.Phillips,DavidM.Neal,andGary Emergency Management Introduction to Textbook Suggested Price: June 2015,6x9,288pp. Print ISBN:978-1-4987-1498-3 term effectssuchasbeacherosionandtheimpactontourism. landscaping, andcityplanning.Theauthormakesapointtolookalsoatlong- to demonstrate,indetail,thestrengthsandweaknessesofinfrastructure, severity ofthedamagecausedbystorms.Itusescasestudiesandimagery of failuresandoversightinplanningthatamplifythe hazard mitigation.Itlooksatthecommonsequence hazards, damage,risk,emergencymanagement,and cyclones, thisbookhighlightsvulnerability, natural Focusing oncoastalregionsaffectedbytropical MITIGAT.com, Inc. Ricardo A.Alvarez $89.95 /£57.99 $68.95 /£43.99 $69.95 /£44.99
99 Disaster Planning & Recovery Leadership in the Open Organizational Resilience A New Paradigm in Managing the Risks of Disruptive Events Emergency Management - A Practitioner’s Guide Adam Crowe James J. Leflar Richmond, Virginia, USA Johns Hopkins University, Baltimore, Maryland, USA
The infusion of social media in emergency management Marc H. Siegel Encinitas, California, USA communication functions throws a major wrench into traditional models of management. A new paradigm is Exploring the concepts and methodologies of how to required to look at how leadership, communication, and implement enterprise-wide organizational resilience public expectations are shaping the future of the profession. A contemporary
Disaster Planning & Recovery management, this book explains the necessary steps for effective disaster leadership guide to emergency management, this book covers current preparedness. It identifies the principles and techniques associated with threat technology and the public’s demand for transparency and instant updates assessment and business impact analyses and explains the cost advantages of and information. It examines an emergency manager’s role not just based on implementing organizational resilience management. The text details the steps functions, but on what is necessitated by current public expectations. needed to train, exercise, evaluate, and maintain disaster plans within the Print ISBN: 978-1-4665-5823-6 framework of organizational resilience management. It also describes the cost- eBook ISBN: 978-1-4665-5824-3 benefits of establishing a resilient culture and processes. May 2013, 6-1/8 x 9-1/4, 327 pp. Print ISBN: 978-1-4398-4137-2 Suggested Price: $71.95 / £45.99 eBook ISBN: 978-1-4398-4138-9 May 2013, 6-1/8 x 9-1/4, 374 pp. Suggested Price: $83.95 / £53.99
Long-Term Community Recovery from Natural Disasters Physical Security and Lucy A. Arendt Environmental Protection University of Wisconsin, Green Bay, USA John Perdikaris Daniel J Alesch Engineering Consultant, Ontario, Canada Emeritus Professor, University of Wisconsin, Green Bay, USA This book takes an all-hazards approach to managing After a natural disaster, rebuilding the physical artifact disasters and their impact on critical infrastructure and of the community is necessary, but not alone sufficient services. It examines the engineering, planning, and for long-term community recovery. This book addresses emergency management processes involved, including the need to understand how communities develop and/or decay after an mitigation, preparedness, response, and recovery extreme natural hazard event. It focuses on how these events disrupt “normal” operations. It illustrates the elements common to all disasters, including threat, development and change—examining which parts of the community have to risk, and vulnerability assessments as well as mitigation strategies. The book offers become reestablished, or made more functional, so that the community can new insights on coping with both unintentional and intentional disasters, as well achieve long-term viability. The book will help communities establish their as strategies to reduce the risk of loss to facilities, equipment, and personnel. “baselines” and show that, with recovery, one size does not fit all. Print ISBN: 978-1-4822-1194-8 Print ISBN: 978-1-4665-9302-2 eBook ISBN: 978-1-4822-1195-5 100 November 2014, 6-1/8 x 9-1/4, 312 pp. April 2014, 6-1/8 x 9-1/4, 344 pp. Suggested Price: $69.95 / £44.99 Suggested Price: $129.95 / £82.00
Textbook Policing Major Events Natural Hazard Mitigation Perspectives from Around the World Edited by Edited by Alessandra Jerolleman James F. Albrecht, Martha Christine Dow, Natural Hazard Mitigation Association, New Orleans, Darryl Plecas, and Dilip K. Das Louisiana, USA John J. Kiefer Whenever a major event requires police intervention, University of New Orleans, Louisiana, USA questions are raised about the nature of the police response. Could the police have prevented the conflict, Hazard mitigation is essential for reducing disaster effects been better prepared, reacted more quickly, acted more on human populations and making communities more resilient. Presenting forcefully, or brought the altercation under control more effectively? Based upon an up-to-date look at the changing nature of disasters, this volume offers real case studies of events from all over the world, this volume explores the practical guidance on the implementation and selection of hazard mitigation complex set of factors comprising the policing of major events. The concepts programs and projects. Based on real-world applications, the book includes case presented will enable police departments to improve their readiness for policing studies that present a thorough explanation of the various issues involved. The major events across a diverse set of events and socio-political contexts. contributors describe the value and potential of mitigation efforts and explain how to convince public officials and communities of that value. They also discuss Print ISBN: 978-1-4665-8805-9 how to better involve the community and uniquely tailor solutions to regional November 2014, 6-1/8 x 9-1/4, 304 pp. and local situations. Suggested Price: $89.95 / £57.99 Print ISBN: 978-1-4398-3493-0 eBook ISBN: 978-1-4398-3494-7 November 2012, 7 x 10, 377 pp. Suggested Price: $76.95 / £48.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2015,6-1/8x9-1/4,320pp. Print ISBN:978-1-4822-4408-3 private partnershipsandsomeofthecommon pitfallsofthecontractingmodel. private sectorinvolvement,thebook alsolooksatbestpracticesforpublic- areas inwhichgovernmentregulation andguidelinespromoteorencourage sectors inallphasesofemergencymanagement.With aparticularfocusonthe and itsintersectionwithgovernment,governmentagencies,thepublic federal, state,andlocallevels.Thisbookexaminestheroleofprivatesector of policiesrelated to emergencymanagement and their implementation at the The privatesectorplaysatremendousroleinthecreation John J.Kiefer, Ph.D. JEO ConsultingGroup Alessandra Jerolleman Emergency Management Leveraging thePrivateSectorin in Disasters The PrivateSector’s Role Suggested Price: May 2015,7x10,352pp. Print ISBN:978-1-4822-3503-6 during disasterevents. communicating with the public and media, and leadership and decision-making The neweditioncontainsaddedchaptersonin-crisiscommunications, media. ThisbooklooksatthefunctionandroleofEOCstheirorganizations. communicate withothergovernmentagencies,responders,thepublic,and to coordinateresponseandrescueefforts.Theyalsodeployresources and and theirstaffcoordinateincominginformationfromthefieldpublic response efforts during disasters. Emergency managers Emergency operationscenters(EOCs)arethehubof Aurora Safety, Founder, CEO,Illinois,USA Michael JFagel Second Edition Operations Centers(EOC) Management andEmergency Principles ofEmergency Suggested Price: May 2013,6-1/8x9-1/4,416pp. eBook ISBN:978-1-4665-6702-3 Print ISBN:978-1-4665-1189-7 aftermath. can institutetobetterpreparepopulationsforcatastrophiceventsandtheir addresses new, innovative,andfundamentallyuniquestrategiescommunities by them.Itexploreshowcatastrophescandramaticallyaffectpopulationsand catastrophes andtheuniquelogistical,planning,responsechallengesposed constitutes acatastrophicevent,outliningboththefactorsthatcanleadto events. Written bytopdisasterscholarsandpractitioners,thebookdefineswhat to mitigate and respond to the devastation caused by large-scale catastrophic project, thisvolumeprovidesimportantinsightintoplans Based onapopularcoursefortheFEMAHigherEducation Baltimore,USA University ofMaryland, Rick Bissell Edited by for CatastrophicDisasters Preparedness andResponse Textbook $69.95 /£44.99 $79.95 /£49.99 $79.95 /£52.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Textbook Suggested Price: May 2013,7x10,514pp. eBook ISBN:978-1-4665-1640-3 Print ISBN:978-1-4665-1637-3 the conceptofcommunityresilienceandbuildingcapacitythroughouttext. recent policychangesandcurrentdisastermanagementapproachesinfuses approach andincludesnumerousinternationalcasestudies.Thebookhighlights data available.InadditiontohighlightingtheU.S.context,itintegratesaglobal studies toillustrateconcepts,relevantandseminalliterature,themostrecent event arenottheonlyreasonthattragediesunfurl.Itincorporatesdisastercase social constructionofdisasters,demonstratinghowthecharacteristicsan on social vulnerability, this second edition focuses on the With chaptersthatincorporateadditionalperspectives William E.Lovekamp,andAlice Fothergill Deborah S.K.Thomas,BrendaD.Phillips, Edited by Second Edition Social Vulnerability toDisasters Textbook Suggested Price: March 2015,6-1/8x9-1/4,300pp. Print ISBN:978-1-4665-7948-4 and emergencymanagementworldwide. causes, consequences(bothpositiveandnegative),implicationsforcrisis twin fields of crisis and emergency management. It focuses on globalization, its and practicein the navigates the increasinglycomplicated advances in theory future mustbeaddressedandmanaged.Thisbook connected, issuesinsecurity, systemsviability, andthe As theworldbecomesmorepopulatedandglobally Florida AtlanticUniversity, BocaRaton,USA Ali Farazmand andPractice Theory Emergency Management Advances inCrisisand Suggested Price: March 2013,6-1/8x9-1/4, 446pp. eBook ISBN:978-1-4665-0687-9 Print ISBN:978-1-4665-0685-5 organizations, andpublicpolicy. be aninvaluablereferenceforprofessionalsinemergencymanagement,aid Fully updatedwithnewcasesandreal-worldexamples,thebookcontinuesto ofemergencymanagementaswellselectedpolicyissues. describes thehistory warnings, initialresponses, evacuation decisions, and longer-term impacts. He to helpreadersunderstandthesocial constraints thatguideresponsestodisaster situations. Theauthorusesaninformalconversationalstyle best tocommunicateandworkwiththepublicindisaster resource forunderstanding humanbehaviorandhow Now initssecondedition,thisvolumeisanexcellent University ofDenver, Colorado,USA Thomas E.Drabek Second Edition The HumanSideofDisaster $83.95 /£52.99 $59.95 /£38.99 $64.95 /£42.99
101 Disaster Planning & Recovery / Fundamentals Canadian Public Administration Crisis and Emergency in the 21st Century Management Edited by Theory and Practice, Second Edition Charles Conteh Ali Farazmand Brock University, Canada Florida Atlantic University, Boca Raton, USA Ian Roberge Series: Public Administration and Public Policy York University, Canada Examining emergency responses to environmental The book identifies and analyzes key concepts, dangers and natural disasters, this book provides frameworks, and issues in Canadian public administration. coverage of a wide range of international issues using critical, empirical, and Bringing together promising new scholars and practitioners, the book bridges quantitative analyses. It discusses various approaches to such topics as resolving the gap between established analytical traditions and novel theoretical and political tension, the potential use of biological weapons, and the role of public methodological approaches in the field; for example, connecting the French relations in crisis. With contributions from leading experts, this second edition and English literature on Canadian public administration by fostering mutual features 40 new chapters that address recent worldwide crises including the exchange and learning between these rich analytical traditions. The book consists September 11th attacks, the devastating effects of Hurricane Katrina in New
Fundamentals of three thematically organized sections that explore processes, structures, and Orleans, the Tsunami disaster in Asia, earthquakes in Iran, and terrorism issues. principles. Print ISBN: 978-0-8493-8513-1 Print ISBN: 978-1-4665-9171-4 eBook ISBN: 978-1-4200-1367-2 eBook ISBN: 978-1-4665-9172-1 March 2014, 7 x 10, 849 pp. August 2013, 6-1/8 x 9-1/4, 240 pp. Suggested Price: $99.95 / £63.99 Suggested Price: $125.95 / £79.99
Cyber Power Citizen Participation at the Crime, Conflict and Security Local Level in China and Canada in Cyberspace Edited by Solange Ghernaouti-Helie Andrew Sancton University of Lausanne, Switzerland University of Western Ontario, London, Canada Most books on cybercrime are written by national security Chen Zhenming or political experts, and rarely propose an integrated and This book presents the work of leading scholars on the comprehensive approach to cybercrime, cyber-terrorism, topic of citizen participation at the local level. Case cyber-war and cyber-security. This work develops studies compare Canadian and Chinese communities and approaches to crucial cyber-security issues that are non-political, non-partisan, extrapolate interesting policy-level changes at the local level based on citizen and non-governmental. It informs readers through high-level summaries and the behavior and involvement. Coverage includes the characteristics of political presentation of a consistent approach to several cyber-risk related domains, both culture and climate on local participation; factors especially unique to urban from a civilian and a military perspective. Explaining fundamental principles in poor, class migration, aboriginal, and immigrant populations; means of protest, an interdisciplinary manner, it sheds light on the societal, economic, political, demonstration, and articulation of preference by populations; land-use, housing, military, and technical issues related to the use and misuse of information and urban development, and resource sustainability. communication technologies. 102 Print ISBN: 978-1-4822-2897-7 Print ISBN: 978-1-4665-7304-8 November 2014, 6-1/8 x 9-1/4, 321 pp. eBook ISBN: 978-1-4665-7305-5 Suggested Price: $119.95 / £76.99 April 2013, 6-1/8 x 9-1/4, 220 pp. Suggested Price: $89.95 / £57.99
Creating Public Value in Practice Democracy and Civil Society Advancing the Common Good in a in a Global Era Multi-Sector, Shared-Power, Edited by No-One-Wholly-in-Charge World Scott Nicholas Romaniuk American Military University Edited by John M. Bryson, Barbara C. Crosby, Marguerite Marlin McMaster University, Canada and Laura Bloomberg Series: Public Administration and Public Policy Series: Public Administration and Public Policy, 194 Providing an understanding about the practical There is a lot of chatter in the media about whether the pride that Americans mechanisms of agency within a civil society, this book demonstrates concepts have felt towards their citizenship and the connection they’ve felt towards their through case studies in practical settings, such as decentralized service delivery; democratic values, can ever be restored. This book brings together a set of stellar examples in citizens bridging religious, linguistic, and ethnic gaps; alternatives scholars and practitioners to discuss and advance the cross-cutting themes and to secessionist movements; the role of elections in Islamic states; enhancement methods of engagement in sections 1) citizens and democracy, 2) institutional of women’s rights through active government participation; how young adults design, 3) cross-sector collaboration, and 4) value creation. The book contains are responding to employment challenges; and, how citizens are pushing for illustrative case studies spanning local to global, analytical to creatively improved human rights, health care, and environmental action. synthesized, and broad based to specific. Print ISBN: 978-1-4987-0703-9 Print ISBN: 978-1-4822-1460-4 April 2015, 6-1/8 x 9-1/4, 192 pp. February 2015, 6-1/8 x 9-1/4, 424 pp. Suggested Price: $79.95 / £49.99 Suggested Price: $89.95 / £57.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: April 2015,6-1/8x9-1/4,192pp. Print ISBN:978-1-4987-0706-0 of theserights. what arethebestpracticesforsustainability andaccountabilityintheprotection human rightsacrosscontexts,howdoesconflictandcrisisaffecttheissues, and book addresses such questions as, whether there are universal parameters for by engagingavarietyofsituational,professional,andregionalperspectives. The advocacy andpolicy, identifiestraps,andpresentsbestpracticesforvariousfields simplifies itintoactionableinformation.Itunpacksthequestionsofhuman This booktakestherequiredholisticperspectiveand Series: PublicAdministrationandPolicy McMaster University, Canada Marguerite Marlin University American Military Scott NicholasRomaniuk Edited by Politics ofHumanRights Development andthe Suggested Price: November 2014,6-1/8x9-1/4,194pp. Print ISBN:978-1-4398-4046-7 usability, technologyintheautomationofhighqualityservice. Itconsiderspeople, ultimately determinesthesuccessorfailureofservice. quality,investigates theconsumersexperienceandjudgmentonservice which delivery.and financialinstitutions,retail,publicsectorservice Thebook industries,suchashotels,restaurants,banks many differenttypesofservice practical information on the design,management, and organization of business success.Thisresearch-driven bookprovides quality—oftendecides experience andjudgeservice The moment of truth—that instantwhenconsumers Ragsit University, Bangkok,Thailand Toni Ivergard Mahidol University, Bangkok,Thailand Brian Hunt People andTechnology Excellence Designing Service Suggested Price: December 2013,6-1/8x9-1/4,254pp. eBook ISBN:978-1-4665-1156-9 Print ISBN:978-1-4665-1154-5 high crimerateandlackingsenseofsecurityamongthecommunitiesPakistan. in the2000s,andcurrentvolatilesituationBalochistanFATA, aswell violence anddrugsinthe80s,crimeinfestedcommunities90s,terrorism date lacksfirmfoundation,asevidencedbythecountry’s disintegrationin1971, and stabilityofthecountry. TheauthorscontendthatPakistan’s democracyto- for Pakistan,anditsviabilityameaningfuldemocracy administrative institutionofDC&DMinhistoricalcontext This bookexplorestheroleofgrassrootspublic Series: PublicAdministrationandPolicy Trade Division,LosAngeles,California,USA Eazaz A.Dar Amna Imam Administration inPakistan Democracy andPublic $79.95 /£49.99 $79.95 /£49.99 $94.95 /£59.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Suggested Price: October 2013,6-1/8x9-1/4,754pp. eBook ISBN:978-1-4822-0902-0 Print ISBN:978-1-4665-9206-3 Calc spreadsheetsoftware. step-by-stepprocesseswithExcelandLinux examples usingstraightforward, of advancedmathematics,quantitativeanalysis,orspreadsheets,itpresents financial andeconomicmodels.Designedforreaderswithlittleknowledge book both thenon-profitandfor-profitsectors.Usingonlyaminimumoftheory, the methods designedtoimprovetheefficiencyandeffectivenessoforganizationsin from a variety of economic and financial perspectives and introduces quantitative Organizations, thisvolumeconsidersthejusticesystem A complementtoStrategicFinanceforCriminalJustice David H.McElreath,andDonW. Jones Daniel AdrianDoss,William H.Sumrall III, Organizations Analysis forCriminalJustice Economic andFinancial Textbook Suggested Price: 2014,6-1/8x9-1/4,428pp. January eBook ISBN:978-1-4665-7954-5 Print ISBN:978-1-4665-7952-1 assignments andquizzes. discussions of the most recentliteratureand case studies, plus end-of-chapter fortheprofessionalreader,It isausefuloverview andclassroom-friendly, with and outcomes.Italsoprovidesupdated informationonthefuturestateofunions. bargaining environment on financialand human resource management issues influence bargainingrights.Ithighlightstheimplicationsofnewcollective recent trendsandmembershipfigures,newlegislation,politicsas they and unionizationlandscape,thisneweditionretainsicontainssections on Thoroughly revisedtoincorporateimportantchangesinthepubliclaborrelations Series: PublicAdministrationandPolicy Rutgers University, Camden,NewJersey, USA Patrice M.Mareschal North CarolinaStateUniversity, Raleigh,USA Richard C.Kearney Fifth Edition in thePublicSector Labor Relations Textbook Suggested Price: December 2013,6-1/8x9-1/4,199pp. eBook ISBN:978-1-4822-0826-9 Print ISBN:978-1-4822-0825-2 medicine principlestotakethefieldforward. to paint a clearpictureof a flawedpublicpolicy approachandoffers preventive public health. It uses examples fromthe media and from public policy debates in anon-technicalwayanddrawsparallelswithotherareasofpublicsafety and serious injury. It presents current scientific knowledge view oftrafficsafetyandlimitprogressinreducingdeath The bookexplodesthemythsthatcurrentlydrivesociety’s and LauraBloomberg BarbaraC.Crosby,John M.Bryson, A CrisisofComplacency Death fromRoadTransport and Eliminating SeriousInjury demonstrates how to make decisions in the justice system using multiple demonstrates howtomakedecisionsinthejusticesystemusingmultiple $157.95 /£99.00 $89.95 /£57.99 $104.95 /£65.99
103 Fundamentals Textbook Public Administration Personnel Management and Policy in the Caribbean in Government Edited by Politics and Process, Seventh Edition Indianna D. Minto-Coy Shridath Ramphal Centre, University of the West Indies Katherine C. Naff, Norma M. Riccucci, Evan Berman and Siegrun Fox Freyss Series: Public Administration and Public Policy Series: Public Administration and Public Policy This collected volume offers the single most Human resources comprises one of the largest shares of comprehensive reference on public administration government budget at every level. The management of people who carry out the in the Caribbean to date. Drawing together some of the best researcher government’s work is therefore a critical issue to politicians as well as citizens. This and practitioner perspectives on these small and developing states, the text reference includes comprehensive sections on the history of civil service reform; provides an overview of the academic methodologies of comparative public the processes of human resource management; equal employment opportunity, administration. It includes comparative discussions of crucial administrative affirmative action, and diversity in government; unions; and employee relations. topics and coverage of key policy issues. It also contains chapters that give This new edition adds extensive coverage of new government developments from Fundamentals complete histories of the Commonwealth Caribbean, French Caribbean, Dutch personnel reforms under the Obama administration, pension issues, labor relations Caribbean, Spanish-Speaking Territories, and U.S. Territories. reform and other changes to labor laws and policies, and performance initiatives. Print ISBN: 978-1-4398-9294-7 Print ISBN: 978-1-4665-1363-1 May 2015, 7 x 10, 550 pp. eBook ISBN: 978-1-4665-1366-2 Suggested Price: $129.95 / £82.00 July 2013, 6-1/8 x 9-1/4, 510 pp. Suggested Price: $94.95 / £59.99 Public Administration in Post-Communist Countries Politics of Preference Former Soviet Union, Central and India, United States, and South Africa Eastern Europe, and Mongolia Krishna K. Tummala, Ph.D Edited by North Oaks, Minnesota, USA Series: Public Administration and Public Policy Saltanat Liebert, Stephen E. Condrey, and Dmitry Goncharov Minorities, based on whatever criteria—linguistic, religious, Series: Public Administration and Public Policy ethnic, tribal, racial, or otherwise—share a distinctive contextual and social experience. Their representation in In this work, expert contributors provide an overview and analysis of public public service is important, especially when there have administration in select post-communist countries, including Russia, Georgia, been public policies which have historically discriminated against them. This Czech Republic, Romania, and Mongolia. Because these countries were largely book is about the importance of offsetting past discrimination in an attempt at closed off to the world, there has yet to be a comprehensive study on their bringing all citizens in as active participants of their representative bureaucracies. administrative systems. The book includes coverage of public management and The author, a distinguished public administration comparativist, brings together administration, political and economic reforms, civil society, human resource the uniquely large and complex cases of United State, India, and South Africa. management, financial and budgetary management, accountability and corruption, as well as prospects for future development. Print ISBN: 978-1-4665-0389-2 104 eBook ISBN: 978-1-4665-0390-8 Print ISBN: 978-1-4398-6137-0 July 2014, 6-1/8 x 9-1/4, 225 pp. eBook ISBN: 978-1-4398-6139-4 Suggested Price: $69.95 / £44.99 February 2013, 7 x 10, 376 pp. Suggested Price: $94.95 / £59.99
Public Administration Public Sector Ethics and Disability Theory and Applications Community Services Administration Steven G. Koven in the US University of Louisville, Kentucky, USA Edited by This book is a guide to public sector ethics covering Julie Ann Racino the major obstacles and stigmas within the field. For Syracuse University, New York, USA example, the ethics and rules of behavior will differ greatly in an elementary classroom versus a public library or a This book brings together the diverse, expert perspectives sanitation route or a battlefield. The book offers macro of administrators, researchers, and discusses the leading efforts of the past three and local level ripped-from-the-headline style examples spanning areas such as decades in the field of disability and community services. This comprehensive whistle-blowing, public official scandal and resignation, even the age old stigma book covers many areas: theory and history; leadership; long-term support “are government employees lazy?” services in the US; family support services; housing and community; employment and “adult day programs”; comparative systems at the state level; services at the Print ISBN: 978-1-4822-3228-8 city level; issues in rural and independent living; public and individual budgeting/ February 2015, 6-1/8 x 9-1/4, 248 pp. finance; contemporary workforce issues; intergovernmental relations; disability Suggested Price: $69.95 / £44.99 public policy and policy research; international agendas; and a look at the future. Print ISBN: 978-1-4665-7981-1 December 2014, 6-1/8 x 9-1/4, 412 pp. Suggested Price: $89.95 / £57.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2015,6-1/8x 9-1/4,256pp. Print ISBN:978-1-4665-6725-2 development. to the field of public administration’s pedagogy, scholarship, and intellectual scholarship, withthegoalofmaking itmorevisible,accessible,andcentral volume brings together the most prominent names in constitutional school reference toconstitutionaldesigns,institutions, andregimevalues.Thisedited that the“bigquestions”inpublicadministrationcannotbeansweredwithout of publicadministration.Participantsinconstitutionalschoolresearch believe law, leadersandcontributors inthefield andthewritingsofseveralcontemporary The growing constitutionalschool has roots in theFederalistPapers, constitutional Series: PublicAdministrationandPolicy American University, Washington, DC,USA David H.Rosenbloom Stephanie Newbold Edited by Administration of AmericanPublic The ConstitutionalSchool Suggested Price: August 2014,6-1/8x9-1/4,318pp. eBook ISBN:978-1-4665-5542-6 Print ISBN:978-1-4665-5541-9 state governmentsintheUnitedStates. the fiscalhistory, currentresources,of majorexpendituresandfiscalsustainability fiscal possibilities.Readerswillcomeawaywithasubstantiveunderstandingof a complete picture of states’ current financial conditions, functions, and future have wellover200yearsofexperienceinstudyingstatefinances,presentthe sustainability oftheAmericanstates.Thecontributorstothistext,whocollectively This book providesa comprehensive analysis of the fiscal viabilityand Series: ASPA SeriesinPublicAdministrationandPolicy Georgia StateUniversity, Atlanta,USA Katherine G.Willoughby John JayCollege,CityUniversityofNewYork, USA Marilyn MarksRubin Edited by American StateGovernments The FiscalViability of Sustaining theStates Suggested Price: December 2014,6-1/8x9-1/4,286pp. Print ISBN:978-1-4822-3176-2 direction. can moveAmericabackinaforward hope isnotlostandofferssuggestionsforhowsimpleshiftsinattitudepolicy disconnect.But,heassuresus there reallyisapowerful isn’t Americanentitlementrunamuck.Rather, hesuggests current stateofAmericanpolicy. Theauthorarguesthis style ofwitandcandor, thisbookcastsaharshlightonthe Presented intheauthor’s characteristicno-holds-barred San JoseStateUniversity, California,USA N.Gerston Larry Policies toRenewNationalCommunity Reviving CitizenEngagement $79.95 /£49.99 $69.95 /£44.99 $69.95 /£44.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Across theGlobe,Volume One withJudges Interviews Trends intheJudiciary Suggested Price: June 2015,6-1/8x9-1/4,200pp. Print ISBN:978-1-4398-5471-6 the newlyavailableGovernmentFinancialOfficersAssociationsurvey. touseactualfinancial,demographicandTELdatafrom beyond simpletheory includes aCDwithforecastingtechniquesandcalculators.Thisauthorsgo socioeconomic andstate-policybarrierstopoststrongfiscalconditions.Italso limitations influencefiscalpoliciesandhowcommunitiescanovercome fiscal health.Itexplainshowartificialpoliciessuchastaxandexpenditure structure, measuringfiscalcondition,and currently available to cities for designing a revenue throughout theU.S.,thistextexaminestools An in-depthassessmentofthefiscalhealthcities University ofWisconsin, USA Steven C.Deller University ofNebraskaatOmaha Craig S.Maher The FiscalHealthofU.S.Cities Suggested Price: May 2013,6-1/8x9-1/4,337pp. eBook ISBN:978-1-4398-0349-3 Print ISBN:978-1-4398-0348-6 1802 tothe2011PoliceReformbyMedvedev. ofInternalAffairstheRussianFederation(MVD)in the creationofMinistry forces thathaveshapedpolicinginthiscountry. Coverage spanstheperiodfrom of policinginRussiaenablesreaderstocomprehendthesocietalandpolitical Economy andPublicAdministration(VAPA). Theextensivereviewofthehistory MVD) and the Volgograd branch of the Russian Presidential Academy of National Volgograd (VA Academyof Russian Internal Affairs Ministry research andanongoingpartnershipbetweenthe This bookrepresentstheculminationoftenyears University ofCentralFlorida,Oviedo,USA Kenneth MichaelReynolds Marquette University, Milwaukee,Wisconsin, USA Olga B.Semukhina Modern RussianPolice Understanding the Suggested Price: December 2013,6-1/8x9-1/4,292pp. eBook ISBN:978-1-4200-9979-9 Print ISBN:978-1-4200-9978-2 andpractice. and therelationshipbetweentheory career; theirjudicialrole;themajorchangesandchallengestheyhaveexperienced; eachdiscusstheirbackground,education,and economic systems,theinterviewees the United States. Representing a variety of cultures, political environments, and Australia, Austria,Bosnia-Herzegovina,theRepublicofSlovenia,Canada,India,and scholars andresearchers. administerjusticein The subjectsoftheseinterviews law, thisvolume with significantlegaldevelopmentsandtheissuestheyfaceincriminalprocedural Providing aninsider’s cope perspectiveofhowmemberstheworldwidejudiciary withGlobalLeadersinPolicing,Courts,andPrisons Series: Interviews Topeka, Kansas,USA Emeritus ProfessorofCriminalJustice,Washburn University, Cliff Roberson International PoliceExecutiveSymposium,NewYork, USA Dilip K.Das Edited by assembles a collection of interviews conducted by international conductedbyinternational assembles acollectionofinterviews $69.95 /£44.99 $104.95 /£65.99 $129.95 /£107.00
105 Fundamentals Educating Scientists and Engineers for Textbook Academic and Non-Academic Career Success An Introduction to Comparative James Speight
Government & Education / Leadership Performance Legal Models of Criminal Justice CD&W Inc., Laramie, Wyoming, USA Cliff Roberson Series: Chemical Industries Emeritus Professor of Criminal Justice, Washburn University, Topeka, Kansas, USA This book focuses on methods to improve the education of science and engineering students so that they are well prepared for careers in either the Dilip K. Das academic or nonacademic world. The author offers ways for university faculty International Police Executive Symposium, New York, USA to adapt accordingly and teach a broader range of skills, the willingness to Examining different types of criminal justice systems and participate in teamwork, technical proficiency, adaptability, and versatility within the legal models that shape them, this text uses specific examples to highlight five the undergraduate and postgraduate curriculum. The book covers ways to basic legal foundation models: continental, common law, Islamic, Marxist, and provide a broader exposure to experiences desired by both academic employers mixed. The book explains how these legal models dictate the roles of the police, and non-university employers so that students are prepared for an increasingly courts, and corrections systems in various countries, how the roles differ from interdisciplinary, collaborative, and global job market. place to place, and how these differences are justified under respective national Print ISBN: 978-1-4665-5356-9 philosophies. Each chapter features a case study, includes tables delineating the December 2014, 6-1/8 x 9-1/4, 198 pp., Soft Cover action and rationalization of each system under each topic, and concludes with Suggested Price: $49.95 / £31.99 a summary and discussion questions. Print ISBN: 978-1-4200-6592-3 eBook ISBN: 978-1-4200-6593-0 June 2008, 6-1/8 x 9-1/4, 352 pp. Suggested Price: $115.95 / £73.99
The Ethics of Cultural Public Administration Competence in Higher Education in South Asia Edited by Beverly A. Burnell and Heidi Schnackenberg India, Bangladesh, and Pakistan State University of New York at Plattsburgh, USA Edited by This book presents research and conceptual chapters Meghna Sabharwal and Evan M. Berman about the ethical factors to be considered in teaching, Series: Public Administration and Public Policy administration, and professional practice in higher The south Asian countries of India, Pakistan, Bangladesh, education settings. The book includes recent research- and Sri Lanka face enormous challenges and opportunities based ideas in the field of higher education. It covers cultural competencies in terms of population growth, localized poverty and prosperity, citizen for higher education faculty, professionals, and administrators, such as use of access to services, governmental transparency, and national security. The first language in communicating concepts to students for whom English is not a first comprehensive, comparative treatment of public administration issues in the language, avoiding imposition of bias, encouraging exposition of perspective, region, this book offers practical and in-depth discussions of new reforms and and ethical practices for professionals working with the diverse environments and innovative practices as well as topics relevant to public administration practices— populations in higher education settings. including performance management, civil service, policy processes, ethics, and Print ISBN: 978-1-926895-50-5 e-government. 106 October 2014, 6 x 9, 265 pp. Print ISBN: 978-1-4398-6911-6 Suggested Price: $99.95 / £63.99 eBook ISBN: 978-1-4398-6913-0 May 2013, 7 x 10, 517 pp. Suggested Price: $132.95 / £85.00
Facilitating Deep Learning Challenges in City Management Pathways to Success for University A Case Study Approach and College Teachers Becky J. Starnes Julian Hermida ASPA Series in Public Administration and Public Policy Algoma University, Saulte Ste. Marie, Ontario, Canada Incorporating urban management and organizational This book provides the theoretical and pedagogical tools management theories with actual practice, the author needed to understand the notion of deep learning and presents a series of case studies based on observations design and implement courses that encourage students made during her extensive experience. Multiple cases to take a deep approach to learning. It covers how to are offered in common contemporary city topics ranging design engaging and innovative teaching and learning activities that encourage from personnel, policy-making, housing, homelessness, transportation, and students to use higher-order cognitive skills to construct knowledge and budgeting. Each study describes and analyzes a scenario, identifying the negotiate meaning. The book begins with an examination of the big picture: the economic and political factors as well as the often conflicting players and interest institutional constraints that hinder a culture of deep learning. From there, it will groups. For classroom use, the case approach lends to discussions, debates, and deconstruct the concept of deep learning, and it will examine every element of role-playing activities. the deep learning process. Print ISBN: 978-1-4398-8436-2 Print ISBN: 978-1-77188-005-3 eBook ISBN: 978-1-4398-8437-9 eBook ISBN: 978-1-4822-3911-9 May 2013, 6-1/8 x 9-1/4, 200 pp. July 2014, 6 x 9, 370 pp. Suggested Price: $71.95 / £45.99 Suggested Price: $99.95 / £63.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: April 2013,6-1/8x9-1/4,230pp. eBook ISBN:978-1-4665-1381-5 Print ISBN:978-1-4665-1380-8 of topic-drivenfocusedstudies,thebook extrapolatesbestpracticesforsuccess. and different policy sectors. By highlighting the successes and failures of a series effective coordinationamongdifferentlevelsofgovernment,neighborcountries, from Canada,US,andItaly. Thebookindentifiesandanalyzestheexperiences of and practiceofintergovernmenalrelationships,bringingtogether8casestudies This collected volume provides insights into the theory Series: PublicAdministrationandPolicy Denita Cepiku,DavidK.Jesuit,andIanRoberge Edited by from EuropeandNorthAmerica Stories ofSuccessandFailure Management Work Making MultilevelPublic Suggested Price: May 2015,6-1/8x9-1/4,224pp. Print ISBN:978-1-4987-1200-2 approaches topreventing,reducing,andcombatingcorruption. provides readerswithusefulknowledgeaboutpubliccorruptionandstrategic in anti-corruptionandwhysomeothersarestillsuffering.Insum,thebook government andwhathavenot,whysomecountriesachievedgreatsuccess dealing with public corruption, whatstrategies have been implemented by the The bookdescribestherealproblemsfacingeachofgovernmentsin public corruptionandanti-corruptionpracticesfromaninternationalperspective. This bookisdesignedtohelpstudents,practitioners,andresearchers understand Universidad deSanAndres,Victoria, Argentina Cecilia Lavena Rutgers University, Newark,NewJersey, USA Yahong Zhang Edited by A Cross-CulturalPerspective Strategies Government Anti-Corruption Suggested Price: July 2010,6-1/8x9-1/4,389pp. eBook ISBN:978-1-4200-7127-6 Print ISBN:978-1-4200-7126-9 will bemadeavailablefordownloadfromtheCRCPresswebsite. mobilized bytheserelationships.PowerPoint®slidesandsupportingmaterials involved in the failure of networkedactivities,and illustrates how policy tools are various actors take on through networkedrelationships, highlights challenges trends ingoverningthatledtogovernancenetworks,explainstheroles analyze governancenetworks.Itidentifiesreformsand and presentsthetheoretical foundationsrequiredto administrators inthecontextofnetworkedrelationships tools, this text describes the skills and functions of public Highlighting theinterplaybetweenpublicactorsandpolicy Series: PublicAdministrationandPolicy Christopher Koliba,JackW. Meek, andAsimZia Administration andPublicPolicy Governance NetworksinPublic $83.95 /£53.99 $89.95 /£57.99 $83.95 /£53.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Training inAfrica Public Administration Suggested Price: October 2013,7x10,208pp.,SoftCover eBook ISBN:978-1-4665-7995-8 Print ISBN:978-1-4665-7994-1 the handsofthosewhocanbestusethem. practitioners andatthesametimetogettoolsneededforassessmentinto organizational survey. Itsuppliesstrategiestoaddresstherealfiscallimitationsof assessment modelfromPSAIandBaldrigetoamorebasicSWOTanalysisor but itspre-assessmentreadinessperspectivemeansthatitcanbeusedwithany to implementthePublicSectorAssessmentandImprovement(PSAI)model, providing practicalmethodologyforimplementation.Itcanbeusednotonly the practicalaspectsofassessmentimplementation, Grounded inorganizationaltheory, thisbookaddresses ASPA SeriesinPublicAdministrationandPolicy New Brunswick,USA Rutgers, TheStateUniversityofNewJersey, Kathleen M.Immordino Sector Workbook and ImprovementinthePublic Organizational Assessment Suggested Price: November 2013, 6-1/8 x9-1/4,277pp. eBook ISBN:978-1-4398-8074-6 Print ISBN:978-1-4398-8073-9 impact ofglobalizationandtheterror threat. andpractice,the book alsoexplorestherelationshipbetween policetheory mission, strategyandtactics,experience withdemocraticpolicing.The provide insightonanumberoftopics relevanttotheirwork,including explorethe executives’backgrounds,education,andcareers interviews environments. Conducted by a team of academic and practitioner experts, the perspective onpolicegoals,practices,andmanagementinarangeofdisparate executives worldwide,thisbookoffersreadersanunparalleledinsider’s withseniorpolice The latestinstallmentinaseriesofinsightfulinterviews International PoliceExecutiveSymposium,NewYork, USA Dilip K.Das University,Coventry UK Bruce F. Baker Edited by the Globe,Volume Four withPoliceLeadersAcross Interviews Trends inPolicing Suggested Price: 2015,6-1/8x9-1/4,256pp. January Print ISBN:978-1-4822-2380-4 from ahostofkeynations. transparency and accountability, it offers concrete solutions to illustrative cases andethicspracticessuchas policies, public-privatepartnerships,performance materials thatprepareAfricanprofessionalsforimplementationofreform recent increaseddemandforstrongerandsmartertraininginstitutions Responding to the agencies, enacting policies, and delivering public services. individuals withthecompetenciesneededforleadingandmanagingpublic importance ofpublicadministrationtraininganddevelopmentforequipping Drawing on a stellar collection of contributors, this book highlights the North-West University, Vanderbijlpark, SouthAfrica Shikha Vyas-Doorgapersad Texas A&MInt’lUniversity, Laredo,USA Peter FuseiniHaruna Edited by Management Competencies inDevelopment $41.95 /£26.99 $129.95 /£85.00 $79.95 /£49.99
107 Leadership & Performance Adapting to Sea Level Rise Drought, Risk Management, in the Coastal Zone and Policy Law and Policy Considerations Decision-Making Under Uncertainty Chad J. McGuire Edited by University of Massachusetts, Dartmouth, USA Linda Courtenay Botterill Comprehensive, but not overly technical, this book University of Canberra, Australia provides a legal-policy framework to the discussion of how Geoff Cockfield coastal managers can best approach the problem of sea University of Southern Queensland, Australia level rise. It identifies legal barriers and offers proposed solutions to mitigate the Series: Drought and Water Crises impact of those barriers. The book introduces the issue, delves into the science This timely collection explores the complex relationship between scientific behind sea level rise, discusses policy complexities and options, followed by an Planning & Development research and decision making with respect to drought in Australia and the United overview of related legalities, then, bringing it all together, the author applies States. Drawing on the work of respected researchers and policy practitioners, it the principles offered in the book, concluding with strategies and solutions and discusses the issues associated with decision making under uncertainty, as well a perspective on the future. as the perspectives, needs, and expectations of scientists, policy makers, and Print ISBN: 978-1-4665-5980-6 individuals. Starting from the position that drought is a risk to be managed, eBook ISBN: 978-1-4665-5982-0 the contributors examine the challenges of evidence-based policy-making. March 2013, 6-1/8 x 9-1/4, 232 pp. Throughout, they offer valuable insights for countries facing drought. Suggested Price: $71.95 / £45.99 Print ISBN: 978-1-4398-7629-9 eBook ISBN: 978-1-4398-7650-3 January 2013, 6-1/8 x 9-1/4, 226 pp. Case Studies in Disaster Suggested Price: $104.95 / £65.99 Response and Emergency Management Information Needs Nicolas A. Valcik University of Texas at Dallas, USA for Water Management Paul E. Tracy Jos G. Timmerman University of Massachusetts at Lowell, USA This book provides the necessary elements to determine ASPA Series in Public Administration and Public Policy exactly what information should be collected to make Presenting more than 50 case studies, this book illustrates the application of the collected information relevant for policy makers. public administration theories and practices to real-life disasters. Arranged It highlights the dissatisfaction of information users chronologically, the case studies involve worldwide incidents, with topics about the information they get and the reasons for this including natural disasters, industrial accidents, epidemics, and terrorist attacks. dissatisfaction. It also discusses general issues around The book demonstrates with 20/20 hindsight how preventive planning measures the role and use of information in policy making. The text then describes the are best practiced. The authors include a lengthy introduction that explains their how to develop a full understanding of the policy makers’ information needs case selection criteria and how the book can be used as a learning and reference and will describe how policy makers can be included in the process. Finally, the tool for any current or future public manager faced with the complexities of a book describes how the results from this process are input for the information wide-scale emergency. production process. Print ISBN: 978-1-4398-8316-7 Print ISBN: 978-1-4665-9474-6 108 eBook ISBN: 978-1-4665-9523-1 eBook ISBN: 978-1-4665-9475-3 January 2013, 6-1/8 x 9-1/4, 262 pp. July 2014, 6-1/8 x 9-1/4, 234 pp. Suggested Price: $83.95 / £53.99 Suggested Price: $99.95 / £63.99
Digital Humanitarians Textbook How Big Data Is Changing the Introduction to Face of Humanitarian Response Transportation Security Patrick Meier Frances L. Edwards and Daniel C. Goodrich iRevolution Mineta Transportation Institute, San Jose State University, California, USA This gripping real-time drama is set against the the devastation of the Haiti earthquake. The author, a Providing transportation managers with the knowledge, pioneer of digital humanitarianism, didn’t stay idle skills, and abilities to effectively manage the security of long. Within hours, from his laptop, he’d assembled a transportation assets, this volume discusses the integrated global network of volunteers to collect, analyze, sift through, map, and relay nature of the nation’s critical infrastructure and the threats to transportation in accurate information from survivors on the ground voicing cries of help using each surface mode. The authors explore federal agencies working in emergency social media. Their data-mining accomplishments were record-breaking and management and transportation security and their intelligence and response set new standards for quick action in large scale disaster relief situations. This requirements and capabilities. They also presents cost-beneficial security book explains the technology behind this new wave of ICT networking and data- strategies aimed at preventing catastrophic failures in each transportation mining. mode and supply effective methods for organizing, testing, and evaluating transportation security across modes and professions. Print ISBN: 978-1-4822-4839-5 January 2015, 6-1/8 x 9-1/4, 239 pp. Print ISBN: 978-1-4398-4576-9 Suggested Price: $29.95 / £19.99 eBook ISBN: 978-1-4665-6327-8 September 2012, 7 x 10, 388 pp. Suggested Price: $76.95 / £48.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: March 2013,6-1/8x9-1/4,346pp. eBook ISBN:978-1-4398-8009-8 Print ISBN:978-1-4398-8008-1 most immediatestruggles. includes manyactionorientedandempowering casestudiesrelevanttotoday’s obstacles. Bridgingthegapbetween policy-making intentionandoutcome,it a largerbodyofresearch thatwillhelpthemavoidlegal,technical, andpolitical locales andpresentingdailyapplications, itconnectsadministrativereaderswith economic developmentandenvironmentalprotection.Encompassingmyriad recommendations andstrategiesforoptimizingthedifficultbalancebetween this strainedeconomicclimate,bookprovidesanarrayofbestpractice In auniquelyclearandpracticaldiscussionoflocaleconomicdevelopment in ASPA Series inPublicAdministrationandPolicy West ChesterUniversity, Pennsylvania,USA L.Osgood,Jr.Jeffery Colorado StateUnversity, FortCollins,USA Susan M.Opp Finding CommonGround and theEnvironment Local EconomicDevelopment Suggested Price: October 2013,6-1/8x9-1/4,296pp. eBook ISBN:978-1-4665-8118-0 Print ISBN:978-1-4665-8114-2 by consciouslyprotectingandmaintainingsocial-environmentalsustainability. flows fromandalignswithnature’s biophysicalprinciplesbenefitsallgenerations govern theoutcomeofallplanning.Itfocusesonhowdecisionmakingthat land useplanningand nature’s impartial,inviolatebiophysicalprinciplesthat the most current success stories and explains the relationship between innovative systems-based innovation,andnoteworthylegislation.Thisneweditioncaptures sustainability havebecomemoreurgentwithanincreasedresearch focuson that mostclearlyconveysitsmeaning.Effortstowardsocial-environmental Society’s understandingofsustainabilityhasevolved,alongwiththatthelanguage Series: SocialEnvironmentalSustainability Oregon,USA Consultant, Corvallis, Chris Maser Bainbridge GraduateInstitute,Washington, USA Jane Silberstein,M.A. Second Edition Sustainable Development Land-Use Planningfor Suggested Price: June 2015,6-1/8x9-1/4,544pp. Print ISBN:978-1-4822-3739-9 and consistentsemanticdetails. modeling where designers and practitioners should be aware of providing clear and explanationsofcurrentbestpractices,thebookreviewsaspectsdata in advancingLULCsemantics.With analysisofland-use/land-coversemantics reassess thefield,affirmsuccessfulapproaches,andpointtofuturepossibilities is a frequently proposed solution. This book provides a platformfor scholars to developed, theneedtoharmonizeclassificationsystemsforlandscapeanalysis As moreandlandcoverdatasetshavebeen Ohio StateUniversity, Columbus,USA Ola Ahlqvist Edited by and Prospects Principles, BestPractices Semantics Land UseandCover $71.95 /£45.99 $89.95 /£57.99 $149.95 /£95.00
For more informationand acompletelistof titles,visitusat www.crcpress.com
Textbook Suggested Price: August 2014,6-1/8x9-1/4,286pp. eBook ISBN:978-1-4822-5072-5 Print ISBN:978-1-4822-5071-8 again, andrecommendationsfornationalplanningresource management. at lingeringchallengesandregionalinstabilities,policymistakesnottobemade book concludeswitharealisticpictureoffuturehurdlesforthisregion,looking institutions for advancements like innovation and private wealth creation. The to abettransparencyandtrustbywayofdevelopingnewpublicprivate development suchasdemocratization.Itthendetailsgovernments’efforts strifeandpolity as positionedinthenortheastcorridortermsofmilitary This bookexploresthecharacteristicsofBalticstates Pacific LutheranUniversity, Tacoma, Washington, USA Gundar J.KingandDavidE.McNabb in NorthernEurope Social Welfare, andSecurity Transforming Governance, in theBalticStates Nation-Building Suggested Price: June 2015,6-1/8x9-1/4,300pp. Print ISBN:978-1-4665-8672-7 efficiency; andthedesiretoalleviate suffering. information, andassuranceofresults; thecompetingpullsofadministrative imperatives, and limited financial resources; the need to act despite limited time, demands oflocaldevelopmentneeds,internationaldonor often contradictory moral quandariesonadailybasis.Itexaminesrealissuesandnavigates the practitioners whoconfronttechnical,managerial,political,theoretical, and this uniquebookconsiderschallengesfromtheperspectiveofdevelopment aspects ofdesignandmanagementinternationaldevelopmentactivities, A collectionofessaysbyexpertpractitionersondifferent Series: PublicAdministrationandPolicy Michael Gubser Washington, DC,USA American UniversitySchoolofPublicAffairs, Jerrold Keilson Edited by International Development The Practiceof Suggested Price: July 2014,7x10,406pp. eBook ISBN:978-1-4822-0678-4 Print ISBN:978-1-4822-0675-3 potential problemareas. framework, pinpointstheindustry’s implementationreadiness,andidentifies at thenational,regional,andgloballevels.Itevaluatesnewregulatory sourcebook describeshow seaportsarebeingaffectedbythechangesoccurring technological, operational,financial,andsociopoliticallevels. examines globalportmanagementpracticesattheregulatory, commercial, thinking andproblem-solvingskills,whiledevelopingmarketforesight.It readers theopportunitytoenhancetheirstrategic economy. transported bywater, portsarethepillarsofglobal With 80percent oftheworld’s commoditiesbeing Texas SouthernUniversity, Houston,USA Maria G.Burns and Operations Port Management offers Port ManagementandOperationsoffers $79.95 /£49.99 $59.95 /£38.99 $89.95 /£57.99
This powerful This powerful 109 Planning & Development Public Transport Planning Reversing Urban Decline and Management in Why and How Sports, Entertainment, Developing Countries and Culture Turn Cities into Major Ashish Verma and T.V. Ramanayya League Winners, Second Edition Mark S. Rosentraub Many developing countries are attempting to expand and University of Michigan, Ann Arbor, USA upgrade their public transport system to create sustainable solutions within the constraints of poor land use and This book explains how sports centers factor into urban planning, haphazard growth of settlements, high downtown economies. Dubious planning decisions population and population density, growing income, and increased travel surrounding large-scale centers have led to stagnation rather than revitalization. demand. This text explains the principles of public transport planning and But with the right planning, design, and financing, large-scale centers can be management that are relevant and suitable for developing countries. It covers integrated into a development area with successful returns. Combining theory Planning & Development both urban and rural public transport planning and management, as well as and practice, the book offers insightful, detailed studies of some of the most aspects of economics and finance related to public transport. dramatic cases of city arena projects. The new edition incorporates longer- term data on the original case studies, and adds cases in Denver, Minneapolis, Print ISBN: 978-1-4665-8158-6 Phoenix, Detroit, Los Angeles, San Diego, as well as information on Canadian December 2014, 6-1/8 x 9-1/4, 285 pp. development projects. Suggested Price: $99.95 / £63.99 Print ISBN: 978-1-4822-0621-0 eBook ISBN: 978-1-4822-0623-4 July 2014, 6-1/8 x 9-1/4, 413 pp. Suggested Price: $69.95 / £44.99
Quantitative Methods and Risk Assessment and Security Socio-Economic Applications for Pipelines, Tunnels, and in GIS Underground Rail and Second Edition Transit Operations Fahui Wang Anna M. Doro-on Louisiana State University, Baton Rouge, USA This book details an integrated quantitative risk assessment The second edition of a bestseller, this book details methodology to help readers systematically analyze applications of quantitative methods in social science, various alternatives for protecting underground rail, oil planning, and public policy with a focus on spatial perspectives. Updated to and gas pipelines, pipeline freight transportation, and other tunnel systems from include the most recent version of ArcGIS 10.1, the new edition also covers terrorism threats and other disasters. It analyzes the engineering, environmental, recent developments in GIS—for example, simulation of urban environment. and economic impacts and addresses both direct and collateral damage. Two new chapters highlight cellular automata-based simulation of urban growth Approved for public release by the U.S. Federal Government, the text presents and Monte Carlo simulation of urban traffic, each co-authored with leading regulations, standard processes, and risk assessment models recommended by experts in the respective fields. In addition, all discussion has been expanded to the US Department of Homeland Security and other agencies. improve readability, particularly for students. Print ISBN: 978-1-4665-6932-4 Print ISBN: 978-1-4665-8472-3 eBook ISBN: 978-1-4665-6934-8 110 December 2014, 6-1/8 x 9-1/4, 339 pp. June 2014, 6-1/8 x 9-1/4, 414 pp. Suggested Price: $119.95 / £76.99 Suggested Price: $99.95 / £63.99
Remote Sensing of Impervious Traffic Simulation and Data Surfaces in Tropical and Validation Methods and Applications Subtropical Areas Edited by Hongsheng Zhang, Hui Lin, Yuanzhi Zhang, Winnie Daamen, Christine Buisson, and Qihao Weng and Serge P. Hoogendoorn Remote Sensing Applications Series This book provides an overview of calibration and Urban impervious surfaces include any man-made validation techniques for traffic simulation models. It surfaces such as roads, parking lots, and rooftops details the data required as an input for the calibration which prevent rainwater from infiltrating into the soil. This book investigates and validation processes and shows how to increase the state of the art of remote sensing of impervious surfaces by summarizing its applicability using data enhancement techniques. It presents an extensive the environmental and socioeconomic impacts of impervious surfaces, the overview of traffic estimation, calibration, and validation techniques, taking into methods of impervious surface estimation using remote sensing technology, account the key factor of uncertainty. This book derives from the MULTITUDE and challenges of remote sensing in humid subtropical regions. It pays special project of the European Union COST framework. attention to the seasonal effects of impervious surface estimation in humid Print ISBN: 978-1-4822-2870-0 subtropical areas. A methodological framework for using optical and SAR images eBook ISBN: 978-1-4822-2871-7 is proposed for impervious surface estimation in humid subtropical regions. September 2014, 6-1/8 x 9-1/4, 262 pp. Major conclusions as well as recommendations for future study are also provided. Suggested Price: $129.95 / £82.00 Print ISBN: 978-1-4822-5483-9 June 2015, 6-1/8 x 9-1/4, 350 pp. Suggested Price: $129.95 / £82.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: March 2015,6-1/8x9-1/4,300pp. Print ISBN:978-1-4822-5140-1 bythepolice. living inthecommunitiesserved providedbythepoliceaswellqualityoflifeforthose quality oftheservices academic contributorswhoexploreprograms thatcanpotentiallyenhancethe and sociology;residentsofthe community. Itfeaturesprofessionaland academic community;professionalpractitioners inpsychology, anthropology, This bookfocusesonthecollaborationofpoliceadministratorswith the andPractice Series: AdvancesinPoliceTheory Austrian FederalPolice(Retired),Austria Maximilian Edelbacher Kent StateUniversity, Canton,Ohio,USA Peter C.Kratcoski Edited by Implementation Education, Training, andProgram Communities Working Together for Police, Academics,Professionals,and Collaborative Policing Suggested Price: August 2013,6-1/8x9-1/4,288pp. eBook ISBN:978-1-4822-1841-1 Print ISBN:978-1-4822-1840-4 disasters, andmore. activity, terrorism,environmentaldegradation,pandemicdiseases,natural region. Theseincludetheareasofnuclearproliferation,internationalcriminal perspective onthetopicsthatwillshapefutureofUSinvolvementin race andkeyregionalactors(China,NorthKorea,India),itprovidesabroad from economic integration to a potential nuclear arms strategy intheAsia-Pacificregion.Byaddressingissues by theAirForce Research InstituteconcerningAirForce This bookistheresultofayear-longstudyconducted US AirForce Research Institute,MaxwellAFB,Alabama, USA Adam B.Lowther Edited by Challenges andOpportunities The Asia-PacificCentury Suggested Price: June 2013,6-1/8x9-1/4 eBook ISBN:978-1-4665-5971-4 Print ISBN:978-1-4665-5970-7 lawyers, lobbyists,andpoliticians. sustainability amidstthecompetingprioritiesofconsumerneeds,ethicalideals, main decisioncriteriaforpolicy-makersandhowtoactually“operationalize” and thoughtfulapproach,thebookconcludeswithapracticallookto Tracing withthisfascinating,holistic, theenvironmentalAmericantrajectory stakeholders, andtenetsofthesustainabilitymovement. movement, andmodern environmental politics,agencies, of the environmental concepts, economics,history environmentalism withcompletecoverageofphilosophical This bookprovidesreaderswithafoundationinAmerican Kennesaw StateUniversity, Georgia,USA J. MichaelMartinez Philosophy, History, andPublicPolicy American Environmentalism $99.95 /£63.99 $49.95 /£31.99 $71.95 /£45.99
For more informationand acompletelistof titles,visitusat www.crcpress.com Policies in16Countries Comparing Environmental Suggested Price: March 2013,7x10,396pp. eBook ISBN:978-1-4398-8895-7 Print ISBN:978-1-4398-8894-0 effectiveness inreducingandorpreventingcrimedisorder. evolved ineachcommunity. Itexaminesorganizationalattributesaswellits across theglobe,bookexploreshowcommunitypolicingoriginatedor paradigm. Drawingontheexpertiseofpolicingpractitionersandresearchers these oftendeeplydividedsocietiesoperateunderthecommunitypolicing around theworld.Throughaseriesofcasestudies,thisvolume reluctantly—a part.Communitypolicinghasemergedinmanyoftheseregions of thenationstateswhichtheyhavebecome—often Indigenous communitiestypicallychallengethelaws University atAlbany-SUNY, NewYork, USA Graeme R.Newman Michigan StateUniversity, EastLansing,USA Mahesh K.Nalla Edited by Indigenous Communities Community Policingin Suggested Price: 2014,6-1/8 x9-1/4,293pp.,SoftCover February eBook ISBN:978-1-4822-2105-3 Print ISBN:978-1-4822-2104-6 accountable, productivepublicservice. provides practical,provensolutionsfor creatingacultureofchangebasedon destructiveprocess.Healso and personalexperiencestoexplainthe pervasive, meta-analysisofrelevantliterature, semi-structuredinterviews, observations, separation fromorganizationalideals.ChiefSilveriiusescovertparticipant intimidation asaresource forsecuringtheirdesiredoutcome—leadingtoa of police.Theseindividualsoperatebehindaveilsecrecyanduseforce or entitlement leadstothedevelopmentofadeviantculture bad. Thebookexplainshowafalsesenseof life experiencesofofficerstodiscusswhygoodcopsgo examining policing’s cultural expectancieswiththereal- This volumecombinesananthropologicalethnography Police Chief,Thibodaux,Louisiana,USA L. ScottSilverii,PhD Why GoodCopsGoBad Cop Culture Suggested Price: December 2013,6-1/8x9-1/4,304pp. eBook ISBN:978-1-4822-1459-8 Print ISBN:978-1-4822-1458-1 clarityandamusingvignettes. with masterful influenced one anothergloballyandovertime. Factsandideasareconveyed comparative approachshowinghowthesemovementshaveintersectedand shifts withineachcountry, theauthorpresentsathoughtfulandilluminating agenda. Notonlydoesthebookprovideadetaileddiscussionofpolicy parties, governmentalstructures,andthediplomatic and fivethemes:participation,interestgroups,political comparative perspective.Thebookcovers16countries in environmentaldilemmas and policies from a global, This bookoffersacompleteprimerforthoseinterested University ofToledo DepartmentofPoliticalScience,Ohio,USA David HowardDavis $104.95 /£65.99 $49.95 /£31.99 $71.95 /£45.99
hegemonic hegemonic
explores how explores how 111 Policy Textbook The Economic Viability of Crime Prevention Micropolitan America Theory and Practice, Second Edition Gerald L. Gordon Fairfax County Economic Development Authority, Stephen Schneider Vienna, Virginia, USA Saint Mary’s University, Halifax, Nova Scotia, Canada Series: Public Administration and Public Policy Dr. Schneider has updated every chapter in this reliable This book addresses the economic history and future of text using the latest research, the most recently published small cities and towns across the country, as they have and articles and books, and feedback from professors and will continue to see dramatic shifts in the roles they play students using the first edition. A new chapter that in the extant larger economies. The book addresses the difficult questions asked outlines crime prevention strategies and implementing then in practice adds to by these communities as they face an uncertain future. Can the small cities and this valuable resource. Case studies have been updated to reflect new data and a towns of this country survive and, if so, what economic roles can they play? Must companion website provides ancillary material for students and professors. they return to the days of being essentially self-sufficient? Or, is it possible that Print ISBN: 978-1-4665-7711-4 they will become epicenters of progress in the United States? November 2014, 7 x 10, 532 pp. Print ISBN: 978-1-4665-1368-6 Suggested Price: $79.95 / £49.99 eBook ISBN: 978-1-4665-1369-3 December 2013, 6-1/8 x 9-1/4, 326 pp. Policy Suggested Price: $94.95 / £59.99
Digital Divides Environmental Law from The New Challenges and the Policy Perspective Opportunities of e-Inclusion Understanding How Legal Frameworks Edited by Influence Environmental Problem Solving Kim Andreasson Chad J. McGuire DAKA Advisory AB, Varberg, Sweden University of Massachusetts, Dartmouth, USA Series: Public Administration and Public Policy, 195 Government at the federal, state, and local levels is The digital divide refers to the social and economic currently moving holistically in a direction where officials inequalities that arise among populations due to inclusion or exclusion in digital are taking on a more direct (regulatory) role in environmental issues. Responding resources. In the United States, for example, one quarter of the population is still to this trend, this text presents an overview of the environment focused on offline. As the digital age advances, public policy officials must determine where practical regulation and management, who the players are, and how the law the gaps are, and how to maneuver closure of these gaps. Divided into sections factors in. It details types of law (common, statutory, regulatory) and frameworks ranging from defining the issues, geographic and multilevel trends, stakeholder (legislative, executive, and judicial) relevant to environmental issues. The book perspectives, best practices, and future developments, this book explores how concludes with coverage of policies and acts by application type (pollution, land governments can bridge the digtial divide. use, waste, energy). Print ISBN: 978-1-4822-1659-2 Print ISBN: 978-1-4822-0367-7 January 2015, 6-1/8 x 9-1/4, 327 pp. eBook ISBN: 978-1-4822-0368-4 112 Suggested Price: $79.95 / £49.99 March 2014, 6-1/8 x 9-1/4, 325 pp. Suggested Price: $69.95 / £44.99
Economic Development, Crime, Environmental Policymaking and Policing and Stakeholder Collaboration Global Perspectives Theory and Practice Edited by Shannon K. Orr Frederic Lemieux, Garth den Heyer, Bowling Green State University, Ohio, USA and Dilip K. Das ASPA Series in Public Administration and Public Policy This book explores the current changes and challenges This book provides policy makers with the keys to facing the policing profession. It discusses the basis of navigating complicated environmental issues and policing in western nations and the current accepted policing models used stakeholder negotiations. It covers theories in environmental policy making and by law enforcement in these countries. It also examines the issue of training, stakeholder management, an overview of the concepts of failed versus successful discusses police and community partnerships, and presents a number of detailed process and policy, and practical guidelines and tools for the practitioner. The responses to issues facing the police in emerging or newly democratized book also includes a number of environmental case studies which fully engage states. The book will be useful for police international deployment instructors, the concept of collaboration. administrators, commissions, and policy makers. Print ISBN: 978-1-4822-0638-8 Print ISBN: 978-1-4822-0456-8 eBook ISBN: 978-1-4822-0640-1 November 2014, 6-1/8 x 9-1/4, 360 pp. December 2013, 6-1/8 x 9-1/4, 225 pp. Suggested Price: $129.95 / £82.00 Suggested Price: $71.95 / £45.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: March 2015,6-1/8x9-1/4,250pp. Print ISBN:978-1-4665-9905-5 relates tohealthandnutrition,genderissues. security andfoodsovereignty, measuringfoodsecurity, foodinsecurityasit of foodinsecurityandhealth.Chapterscover reviews theconceptualframeworkbehindinteractions tomitigatetheseissues.Inaddition,it interventions impacts offoodinsecurityonpublichealthaswell This bookprovidesanevidence-baseddiscussionofthe Louise Ivers Edited by and PublicHealth Food Insecurity Suggested Price: December 2013,6-1/8x9-1/4,408pp. eBook ISBN:978-1-4665-8821-9 Print ISBN:978-1-4665-8820-2 Symposium (IPES). the world.Thisbookisaco-publicationwithInternationalPoliceExecutive these findingsmayassistincombatingterrorismandpoliticalviolencearound gathering, andexaminesdifferentpolicingmodels.Theconclusionsdrawnfrom terrorism andradicalization,discussescounteringthroughintelligence readers betterunderstandthesethemes.Thebookdefinestheconceptsof exploring historical and sociopolitical contexts of conflicts in order to help book providesbothconceptualanalysisandcasestudies, articles inthejournalPolicePracticeandResearch, this A collectionofworks,somepreviouslypublishedas David Lowe,AustinT. Turk, andDilipK.Das Edited by and InternalWar Studies ofTerrorism, Counterterrorism, Examining PoliticalViolence Suggested Price: November 2013,6-1/8x9-1/4,497pp. eBook ISBN:978-1-4665-6718-4 Print ISBN:978-1-4665-6715-3 (IPES). This bookisaco-publicationwiththeInternationalPoliceExecutiveSymposium decentralization, andthepolicingofindigenousspecialpopulationgroups. The bookalsoexamineschallengestopolicepractices,suchasterrorism, relating toethics,technology, investigations,andhandlingpublicrelations. policing, innovationsoccurringinpolicetrainingandmanagement,issues democratic anddemocratizingstates,theimpactofcommunity-oriented their profession. The book discusses the trends in evolving police roles among presents practicalinsightsonhowpoliceareretooling policing initiativesandevolutionsacrosstheglobe Executive Symposium(IPES),thisvolume Drawn fromrecentproceedingsoftheInternationalPolice and DilipK.Das Melchor C.deGuzman,AiedeoMintieDas, Edited by Worldwide InnovationsandInsights The EvolutionofPolicing $99.95 /£63.99 $104.95 /£65.99 $125.95 /£79.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
explores major explores major
Suggested Price: May 2015,6-1/8x9-1/4,504pp. Print ISBN:978-1-4398-8024-1 government actionversusindividualliberty. of profiles ofnotablecontributorstothefield,textalsoexploresthemes allowances,foodlabeling,safety,dietary andschoolwellness.Containing guidelines and markets, sustainable agriculture, peanut-free schools, dietary trends, foodpolicies,andlegislation.Theauthoraddressessuchtopicsas and treatchronicdiet-relatedconditions,suchasobesity, andtheemergenceof ontheU.S.foodsystems.Itdiscusseseffortstoprevent government, andindustry examines theinfluencesofgrassrootsmovements, food isacornerstoneofpublichealth.Thisbook Access tosafe,adequate,andnutritionally-balanced Hunter College,NewYork, USA Arlene Spark Janel Obenchain Edited by fromthePast Looking Forward Food Policy Suggested Price: March 2011,6-1/8x9-1/4,320pp.,SoftCover eBook ISBN:978-1-4398-5374-0 Print ISBN:978-1-4398-5373-3 guidelines, checklists,andcasestudies thatillustratebestpractices. reporting during a crisis, the text includes a wealthof helpful tools, including the crisismanagementlandscape.Illustratingfourdistinctstagesofmedia how rapidlyevolvingsocialmediaandWeb 2.0technologieshavechanged crisis. Unveilingthesecretsofhowtomanagemediainacrisis,itexamines language andmediaoutlettoproperlyconveyamessageduringafter a this bookexplainsmethodsforchoosingtheappropriate Presenting cutting-edgemediacommunicationsolutions, Jane Jordan&Associates,GreenValley, California,USA Jane Jordan-Meier in theDigitalAge How toManagetheMedia Effective CrisisManagement The FourStagesofHighly Suggested Price: October 2014,7x10,640pp. Print ISBN:978-1-4822-3657-6 suit theneedsofspecificcircumstances amonglawenforcement organizations. approach andissupplementedwithtemplatematerialsthatmaybealteredto U.S. Constitutiontomoderncommunications.Thebookemphasizesapractical system. Itexploresfoundationalconceptsandexaminestherelevancyof This bookexaminescommunicationsfromtheperspectiveofcriminaljustice with thepublic,andnewsmediapresentsstoriesofeventsincourtrooms. speak tojuries,lawenforcement officerscommunicate and amonglawenforcement organizationsasjudges Daily communicationoccurswithinthejusticesystem Rebecca A.Goza,andMichaelWigginton, Jr. Daniel AdrianDoss,William H.Glover, Jr., Criminal JusticeSystems Communication in The Foundationsof $59.95 /£38.99 $68.95 /£43.99 $149.95 /£95.00
113 Policy Gay, Lesbian, Bisexual, and Juvenile Justice Transgender Civil Rights International Perspectives, A Public Policy Agenda for Models and Trends Uniting a Divided America Edited by Edited by John A. Winterdyk Wallace Swan Mount Royal University, Calgary, Alberta, Canada Based on the editor and his team of leading contributors A comparative analysis of juvenile justice systems, this collective years of work and experience at the forefront of book features the contributions of international experts. gay, lesbian, bisexual, and transgender (GLBT) issues, this book presents fresh Topics include the history of juvenile justice, the nature information and insights into the GLBT debate. As GLBT policies evolve and and status of delinquency, and how well current legislation complies with the take shape, and new voices of the movement emerge, the issue can be shown Standard Minimum Rules of the Administration of Juvenile Justice as defined by to pervade all other areas spanning mental and physical healthcare, religion, the UN. The book also discusses age limits for juvenile offenders, legal and social senior issues, economics, education, biology, business, workforce and other issues, and theoretical considerations. It enables readers to compare the relative demographics. A collection of fascinating contemporary perspectives, this book strengths and weaknesses of different juvenile justice models and to examine all explores the breadth of this important. countries in light of the larger international phenomena of delinquency. Print ISBN: 978-1-4665-6730-6 Print ISBN: 978-1-4665-7967-5 Policy eBook ISBN: 978-1-4665-6733-7 October 2014, 7 x 10, 410 pp. October 2014, 6-1/8 x 9-1/4, 451 pp. Suggested Price: $69.95 / £44.99 Suggested Price: $79.95 / £49.99
Living Legends and Full Agency Global Issues in Implications of Repealing the Contemporary Policing Combat Exclusion Policy Edited by G.L.A. Harris John A. Eterno, Aiedeo Mintie Das, Portland State University, Oregon, USA and Dilip K. Das Series: Public Administration and Public Policy
This book addresses six areas of policing: performance This book examine the role of women in the military management, professional and academic partnerships, and the overwhelming evidence to date that warrants preventing and fighting crime and terrorism, immigrant repealing the combat exclusion policy of women into and multicultural populations, policing the police, and the military. It explores 1) How can their success serve as justification for a full cyber-security. The book contains the most current and groundbreaking research repeal? 2) What is the potential impact of the repeal? 3) How will it affect the across the world of policing with contributors from over 20 countries. It is also way that women and men relate to one another? 4) How can it set women on a suitable reference or textbook in a special topics course. It consists of edited the course to full agency and representation as citizens in American society? The versions of the best papers presented at the IPES annual meeting in Budapest. book includes exciting interviews with pioneering former military women giving candid views on their career paths and views about the policy. Print ISBN: 978-1-4822-4852-4 June 2015, 6-1/8 x 9-1/4, 350 pp. Print ISBN: 978-1-4665-1378-5 Suggested Price: $99.95 / £63.99 October 2014, 6-1/8 x 9-1/4, 358 pp. 114 Suggested Price: $79.95 / £49.99
Handbook of Public Policy Analysis Local Food Environments Theory, Politics, and Methods Food Access in America Edited by Edited by Frank Fischer and Gerald J. Miller Kimberly B. Morland Rutgers University, Newark, New Jersey, USA Mount Sinai School of Medicine, New York, New York, USA Series: Public Administration and Public Policy This book describes the landscape of local food Exploring the interplay between empirical and normative environments through research methods and documented analysis, which is a crucial issue, Handbook of Public Policy Analysis: Theory, impacts. It provides information on the complex nature of Politics, and Methods provides a broad, comprehensive perspective on the food delivery systems as well as the historical and political field. This book examines the historical development of policy analysis as well trends that shaped them over time. Chapters cover community perspectives on as its role in the policy process. Presenting empirical methods that have defined food shopping in the US; economic and agricultural policies shaping US food this endeavor, this text then explores the various theories generated by these environments; geography of food environments; study design, measurement, methods. Normative and ethical issues surrounding the practice of public and analytical issues; local environments, behavior, and health; food delivery policy analysis are also addressed. Discussion of theoretical debated that have outside the US; local action to modify food environments; and local, state, and defined this field in recent years-such as postpositivist, interpretivist, and social federal policy changes. constructionist-completes the coverage. Print ISBN: 978-1-4665-6778-8 Print ISBN: 978-1-57444-561-9 eBook ISBN: 978-1-4665-6779-5 eBook ISBN: 978-1-4200-1700-7 September 2014, 6-1/8 x 9-1/4, 355 pp. December 2006, 7 x 10, 672 pp. Suggested Price: $99.95 / £63.99 Suggested Price: $209.95 / £134.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: September 2013,6-1/8x9-1/4,357 pp. eBook ISBN:978-1-4665-9313-8 Print ISBN:978-1-4665-9312-1 policies, practices,procedures,andprotocols fromthedangerofliability. sources ofliabilityandimplementriskmanagementstrategies toshieldtheir these typesofissues,lawenforcement agenciesarebetterabletomonitorthe concern sothatrisksmaybereduced.Byunderstandingthelawsgoverning administrators, criminaljusticeacademics,andattorneysunderstand this civil rights violations, and employment law issues. This volume helps police continually atriskforpotentialliabilityrelatedtotorts, Law enforcement agenciesandtheiremployeesare Robert J.GirodConsulting,LLC,FortWayne, Indiana,USA Robert JGirod and EmploymentLaw Torts, CivilRights, Risk Management Police Liabilityand Suggested Price: October 2014,6-1/8x9-1/4,230pp.,SoftCover Print ISBN:978-1-4665-7584-4 the lessonsrelatetootherdepartmentsthroughoutworld. such astheOccupyWall Streetmovement.Thefinalchapterdemonstrateshow strategies; andreviewslegalconcernstheresponsetopublicdemonstrations in recentyears.Itexploreshiring,firing,andretention;discussescrime-fighting NYPD, policeculture,resistancetochange,andthedropinhomiciderate years, thisbookreviewsqualitativeresearch onhowthecommunityviews An examination of the department by experts who have been studying it for critical tounderstandingpolicinganddemocraticsociety. Studying the flagship New York CityPolice Department is Molloy College,RockvilleCentre,NewYork, USA John A.Eterno Edited by The ImpactofItsPoliciesandPractices Police Department The NewYork City Suggested Price: June 2013,6-1/8x9-1/4,328pp. eBook ISBN:978-1-4665-7360-4 Print ISBN:978-1-4665-7358-1 and familycircumstance. public and private sector jobs with low and high income and at different ages professionalwomenspanning practice ofcommonlives.Theauthorinterviews on howthepoliciesofmaternityleaveplayoutin benefits. Thebookalsooffersanilluminatingperspective public healthissue,andtypesofleaveofferedasemployee legislative intent,theparametersofmaternityleaveasa covers thehistoricalandcurrentpublicpoliciestheir maternityleave.It This bookexaminescontemporary Victoria Gordon Policy andPractice Maternity Leave $89.95 /£59.99 $89.95 /£57.99 $62.95 /£39.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Russia’s ImperialRevival Suggested Price: April 2013,6-1/8x9-1/4,254pp. eBook ISBN:978-1-4398-8881-0 Print ISBN:978-1-4398-8880-3 poverty, economy, decentralization,financing,media,andpoliticalstructures. Nigeria, Ghana,Mauritius,andBotswana.Themesincludecolonialism,reform, application. Regions addressed range from South Africa, Congo, Uganda, and regionsbytakingananalyticapproachwiththestrongproblem-solution regional scholars.Theeditorsbringtogetheracohesivestudyofthemajorissues the uniqueAfricanperspective,aspresentedbyleading This publicadministrationandpolicyvolumestudies Series: PublicAdministrationandPolicy and ErnestPeprahAbabio Lukamba-Muhiya Tshombe, Shikha Vyas-Doorgapersad, Edited by andChallenges Performance Public AdministrationinAfrica Suggested Price: June 2015,6-1/8x9-1/4,300pp. Print ISBN:978-1-4665-7767-1 relative statefailure. specific method for assessing a unique analysis, the book articulates a very freedoms, thecriminaljusticeprocess,andmechanismsofpunishment.Through failure. Readerslearnwhatitistobeafailedstateandhowfailureimpacts core This volumeprovidesananalysisofthepathtostate oppressive actionstomaintainorderandkeeppower. often usemurder, kidnapping,andother violent or tolerated acts. On the flipside, these weak states inconsequentialor the criminalizationofotherwise Failed andfragilegovernmentsoftengovernthrough Laurie A.GouldandStephenMatthewPate Fractured JusticeandFierce Reprisal State FailureAroundtheWorld Suggested Price: June 2015,6-1/8x9-1/4,296pp. Print ISBN:978-1-4987-1198-2 andpoliticalforce.to re-establishRussiaasamilitary designed characterized by actualor threatened aggressive,armed interventions asithasmorphedintoarevanchistforeignpolicy and continuesthestory rapprochement apparentimmediatelyafterthecollapseofSovietUnion begins with a description of what was a policy of a possible,ifnotlikely, renewaloftheColdWar. It actions andforeignpolicydoctrineshavesignaled This book argues that Russia’s recent overtly aggressive Pacific LutheranUniversity, Tacoma, Washington, USA David E.McNabb of VladimirPutin The RevanchistForeignPolicy $83.95 /£53.99 $89.95 /£57.99 $69.95 /£44.99
115 Policy Sustainable Development Trends in Policing and Human Security in Africa Interviews with Police Leaders Governance as the Missing Link Across the Globe, Volume Five Edited by Edited by Louis A. Picard, Terry F. Buss, Taylor B. Seybolt, Bruce Baker Coventry University, UK and Macrina Lelei Series: Public Administration and Public Policy Dilip K. Das International Police Executive Symposium, New York, USA This book adopts a ‘governance’ perspective to Series: Interviews with Global Leaders in Policing, Courts, examine a number of the roadblocks to development in Africa and analyzes the and Prisons complexity and interrelatedness of these problems. The first part of the book Trends in Policing: Interviews with Police Leaders Across the Globe, Volume identifies issues, the second part focuses on actual strategies for sustainable 5 is based on the premise that police officials have a wealth of experience that governance policies, and the third part includes case studies that present toolsets can make significant contributions to our understanding of the prospects and gained in field experience across topics and countries. problems of policing today. Each chapter consists of an interview with a policing Print ISBN: 978-1-4822-5541-6 leader that explore their understanding of policing developments and current April 2015, 6-1/8 x 9-1/4, 192 pp. challenges in their countries and internationally, and examines how they evaluate Suggested Price: $119.95 / £76.99 or interpret these developments. Policy Print ISBN: 978-1-4822-2449-8 June 2015, 6-1/8 x 9-1/4, 350 pp. Suggested Price: $129.95 / £82.00
The Geography of Trends in the Judiciary International Terrorism Interviews with Judges Across An Introduction to Spaces and Places the Globe, Volume Two of Violent Non-State Groups Edited by Richard M. Medina David Lowe George F. Hepner Liverpool John Moores University School of Law, UK University of Utah, Salt Lake City, USA Dilip K. Das Providing the perspective required to understand and International Police Executive Symposium, New York, USA anticipate terrorism, this book presents an accessible, cross-disciplinary approach Series: Interviews with Global Leaders in Policing, Courts, and Prisons to understanding terrorism on local and global scales. The authors articulate the role of physical and human geography in terrorist ideology, operations, and This is the seventh publication in the Interviews with Global Leaders in Policing, haven formation and control. They supply a blend of concepts and techniques to Courts, and Prisons series. The book gathers empirical data from judges and support policy development within the governing counter terrorist community. justices from different legal systems through interviews that cover practitioners’ To assist reader assimilation, the book includes maps, images, and graphics to views and their interpretations of current legal developments and judicial issues support the text. in criminal law. Each interview is conducted according to strict guidelines and Print ISBN: 978-1-4398-8686-1 a standardized format for consistency. This structure allows readers to easily eBook ISBN: 978-1-4398-8688-5 compare the views of judges and to see both the similarities, the differences, and 116 April 2013, 6-1/8 x 9-1/4, 258 pp. the uniqueness of the different legal models and systems. Suggested Price: $83.95 / £53.99 Print ISBN: 978-1-4822-1916-6 December 2014, 6-1/8 x 9-1/4, 360 pp. Suggested Price: $99.95 / £63.99
Trends in Corrections Using the “Narcotrafico” Threat Interviews with Corrections Leaders to Build Public Administration Around the World, Volume Two Capacity between the Edited by US and Mexico Martha Henderson Hurley Edited by The Citadel, The Military College of South Carolina, Charleston, USA Donald E. Klingner and Roberto Moreno Espinosa Dilip K. Das ASPA Series in Public Administration and Public Policy International Police Executive Symposium, New York, USA This book collects chapters written by leading experts Series: Interviews with Global Leaders in Policing, Courts, and Prisons working in the trenches of U.S.-Mexico policy issues. Topics covered include This second corrections interview book is based on the premise that comparing immigration, drug flow and conflict, gun-running, money-laundering, and the countries around the world and getting “inside” information about each country’s economic and cultural impacts on both sides. The book shows how the current correctional system can be best derived by having people who are seasoned situation of drug trafficking and violence, on top of the other existing perceptions practitioners in each country share their views, experiences, philosophies, and and conditions, create a real opportunity for the U.S. to build relationships with ideas. It includes fifteen interviews by corrections scholars and researchers in a its Mexican counterparts at state, local, national, and NGO levels. variety of countries. The current book will focus on Eastern and Western Europe Print ISBN: 978-1-4665-7109-9 and Latin American countries. eBook ISBN: 978-1-4665-7110-5 Print ISBN: 978-1-4665-9156-1 February 2014, 6-1/8 x 9-1/4, 280 pp. December 2014, 6-1/8 x 9-1/4, 304 pp. Suggested Price: $59.95 / £38.99 Suggested Price: $129.95 / £82.00
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: July 2014,5-1/4x7-3/4,251pp.,Soft Cover eBook ISBN:978-1-4822-1742-1 Print ISBN:978-1-4822-1739-1 for understandingtheintersectionoflaw, ethicsandtherightsofpatient. clear outlines of the essential legal precedent, the author lays a solid foundation disabled andend-of-lifedecisions.Focusingonprinciplesoflawincluding examines confidentiality, informedconsent,casesofabuse,therights yet pocket-sized,thisbookfornurses,midwivesandalliedhealthprofessionals daynursingandalliedhealthpractice. Comprehensive in thecontextofevery health carelawandethicsinrelationtopatientrights This secondeditionofthisacclaimedtextintegrates University ofWest London,UK Paul Buka Second Edition for Nurses Patients’ Rights,LawandEthics Textbook Suggested Price: August 2015,6-1/8x9-1/4,216pp. Print ISBN:978-1-4665-9356-5 Japan, Indonesia,Korea,Mongolia,IndiaandThailand. collects casestudiesfromanumberofAsiancountriesincludingChina,Taiwan, emitted asaresultofrapidindustrialization.Thisbook on mentalhealth,duetoexposureairpollutants disease,increasedmortality,respiratory andimpacts health problems,includingcardiovasculardisease, This bookcoversAsiancountriesfacingseverepublic Dong-Chun Shin Edited by Case StudiesfromAsia Hazardous AirPollutants Suggested Price: April 2015,7-1/2x9-3/4,256pp.,SoftCover Print ISBN:978-1-4822-2755-0 professionals, includingphysiotherapistsandoccupationalhealthpractitioners. for nursingstudentsatalllevelsandisausefulreferencealliedhealth pharmacological challengesandendoflifecare.Thebookisessentialreading number ofoverarching topics,includingpsychologicalproblems,depression, cardiovascular problems,aswelldiabetesanddementia.Italsoexploresa caring for adults with long-term conditions discusses respiratory, renal and by clinicians,thiscomprehensiveintroductionto Focusing particularlyonissuesmostcommonlyseen University ofSheffield,UK Michael MacintoshandSallyUnderwood Edited by of LongTerm Conditions Clinical CareandManagement Textbook $31.95 /£19.99 $139.95 /£89.00 $39.95 /£26.99
For more informationand acompletelistof titles,visitusat www.crcpress.com
Health DisparityAssessment Public HealthDatafor Smart UseofState Suggested Price: June 2015,7-1/2x9-3/4,384pp.,SoftCover Print ISBN:978-1-4822-2748-2 learning andteaching. written byexpertsinthefieldandtakeapracticalapproachordertosupport challenges ofthesesignificantstructuralandfunctionalchanges.Chaptersare Italsoexploresthe who providecare,preventionandhealthpromotionservices. examines theimplicationsforchildrenandyoungadultsaswellthose radical changesinpublichealthprovision,thiskeytext expanded toincludechildrenofallages.Following and theSchool-agePopulationhasbeenupdated This re-titled new edition of UK Norwich, Diane DeBell Second Edition Public HealthforChildren Textbook Suggested Price: May 2014,6x9,304 pp. eBook ISBN:978-981-4463-27-0 Print ISBN:978-981-4463-26-3 simultaneously createsandexploresnew ground. computer modelinginboththehumanities andthesocialsciences,thus, ofqualitative methods.Thisisthefirstbookofitskindthatdealswith purview humanities andsocialsciencephenomena thathavebeenhistoricallythe This bookoffersatourofquantitative analyses,models,andsimulationsof volume, quantitativemethodsinthehumanitiesarebecomingmorecommon. and politicalscience,tonameonlyafewsocialscientificfieldshighlighted in this With theincreasedadoptionofnaturalsciencetoolsineconomics,anthropology, University ofNorthCarolinaatCharlotte,USA Mirsad Hadzikadic Washington andLeeUniversity, Lexington,Virginia, USA Paul A.Youngman Edited by Humanities andSocialSciences Modeling Complexityinthe Human Experience Complexity andthe Suggested Price: June 2015,7x10,500pp. Print ISBN:978-1-4822-0531-2 management insight,andlessonslearned. advice onstatepublichealthdatause,theirstrengthsandweaknesses, assessing healthdisparityandfordiseaseprevention.Theauthorsofferpractical how to maximize the use of various datasets from state health departments for capability willbecome essentialforhealthcarepractitioners.Thisbookexplain disparities through enhancedpublic health data infrastructure and analytical affirmation ofthePatientProtectionandAffordableCareAct,reducinghealth costs.Withhealthcare systemandthereforeaccountforunnecessary the Disparities representalackofefficiencywithinthe Nebraska DepartmentofHealth&HumanServices Administrator, PublicHealthSupportUnit, Ming Qu University ofNebraskaMedicalCenter, Omaha Ge Lin $49.95 /£29.99 $149.95 /£95.00 $89.95 /£57.99
Public Health Practice Public HealthPractice
117 Public Health / General References Emerging Technologies Using the Biological Literature Socio-Behavioral Life Cycle Approaches A Practical Guide, Fourth Edition Edited by Diane Schmidt Nora Savage, Michael E. Gorman, and Anita Street University of Illinois, Urbana, USA Traditional Life Cycle Analysis (LCA) methodologies affect The new edition of the highly praised book, Using the the public health and environmental impacts from a Biological Literature: A Practical Guide, is an annotated material, product, process or activity. The authors of guide to selected resources in the biological sciences, this book suggest that a more holistic approach that presenting a wide-ranging list of important sources. incorporates societal and behavioral dimensions will create This completely revised edition contains numerous new better results. They discuss how to develop an adaptive framework that would resources and descriptions of all entries including textbooks. It covers both print include a wider range of perspectives and disciplines. The book will also include and electronic resources including monographs, journals, databases, indexes discussions about “Technological Black Swans,” trading zones, ethics, behavioral and abstracting tools, websites, and associations. It provides users with listings nanotechnology, governance, risk, green design, tools for practitioners, and of authoritative informational resources of both classical and recently published General References conclude with a chapter presenting a “strategic outlook.” works. Print ISBN: 978-981-4411-00-4 Print ISBN: 978-1-4665-5857-1 eBook ISBN: 978-981-4411-01-1 eBook ISBN: 978-1-4665-5858-8 May 2013, 6 x 9, 342 pp. April 2014, 6-1/8 x 9-1/4, 412 pp. Suggested Price: $149.95 / £95.00 Suggested Price: $99.95 / £63.99
Encyclopedia of Library and Information Sciences Third Edition (Print Version) Edited by Marcia J. Bates and Mary Niles Maack University of California, Los Angeles, USA
Composed of the contributions of major researchers and practitioners, this third edition of the Encyclopedia of Library and Information Sciences reflects the growing convergence among the several disciplines that concern themselves with information and the cultural record. This work addresses these related disciplines in a way that demonstrates the unities across the fields and also recognizes their uniquely distinguishing characteristics. It presents hundreds of entries extensively reviewed for accuracy. Containing more than 70 percent new material, it also includes classic articles of historical or theoretical importance from prior editions. The Encyclopedia explores the cultural institutions of more than 30 countries to 118 offer a resource that is worldwide in scope. Print ISBN: 978-0-8493-9712-7 December 2009, 8-1/2 x 11, 6856 pp. Suggested Price: $3647.00 / £2322.00
Networks in Society Links and Language Edited by Robert Stocker University of New South Wales at ADFA, Canberra, Australia Terry Bossomaier Charles Sturt University, Bathurst, Australia
This book covers technical fundamentals, complexity and social networks, and communication and language. It raises readers’ interest in social networks, the importance of language in the emergence and maintenance of networks, the integral patterns of interconnectivity, and the means to measure and model social structure. It presents a broad range of ideas from several fields of research endeavor. It also explores social networks and their integration with communication and language, thereby providing a discussion of relevant theory, modeling, metrics, and application to business, natural resource management, and technology. Print ISBN: 978-981-4316-28-6 eBook ISBN: 978-981-4364-82-9 February 2014, 6 x 9, 226 pp. Suggested Price: $99.95 / £63.99
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 20 Keys to Workplace Improvement...... 27 Bodyspace: Anthropometry, Ergonomics and the Customer and Business Analytics: Applied Data Mining 21st Century Security and CPTED: Designing for Critical Design of Work, Third Edition...... 70 for Business Decision Making Using R...... 6 Infrastructure Protection and Crime Prevention, Second Edition...... 50 Boiler Operator’s Handbook, Second Edition...... 70 Cyber Power: Crime, Conflict and Security in Cyberspace...... 102 5 Pillars of the Visual Workplace...... 66 Boiler Plant and Distribution System Optimization Manual, Cybersecurity for Industrial Control Systems: 5S for Healthcare...... 16 Third Edition...... 70 SCADA, DCS, PLC, HMI, and SIS...... 51 5S for Operators: 5 Pillars of the Visual Workplace...... 67 Bringing Jobs Back to the USA: Rebuilding America’s Cybervetting: Internet Searches for Vetting, Investigations, 7 Fundamentals of an Operationally Excellent Manufacturing through Reshoring...... 5 and Open-Source Intelligence, Second Edition...... 25 Management System...... 76 Building a Global Learning Organization: Using TWI to Succeed with Strategic Workforce Expansion in the LEGO Group...... 73 D A Building Network Capabilities in Turbulent Competitive Environments: Business Success Stories from the BRICs...... 5 Data Mining Mobile Devices...... 49 A Comprehensive Look at Fraud Identification and Prevention...... 50 Building Quality Management Systems: Data Privacy for the Smart Grid...... 51 A Factory of One: Applying Lean Principles to Banish Waste Selecting the Right Methods and Tools...... 67 Democracy and Civil Society in a Global Era...... 102 and Improve Your Personal Performance...... 66 Bursting the Big Data Bubble: The Case for Intuition-Based Democracy and Public Administration in Pakistan...... 103 A First Course in Quality Engineering: Integrating Statistical Decision Making...... 6 Dependence Modeling with Copulas...... 33 and Management Methods of Quality, Second Edition...... 84 Business Analytics: An Introduction...... 6 Design for Manufacturability: How to Use Concurrent A Guide to Human Factors and Ergonomics, Second Edition...... 79 Business Continuity Planning: A Project Management Approach.....40 Engineering to Rapidly Develop Low-Cost, High-Quality A Guide to IT Contracting: Checklists, Tools, and Techniques...... 8 Business Process Modeling, Simulation and Design, Second Edition...78 Products for Lean Production...... 65 A Leadership Journey in Health Care: Virginia Mason’s Story...... 16 Design of Enterprise Systems: Theory, Architecture, and Methods.....41 A Practical Guide to Facilities Management...... 73 C Designing Complex Products with Systems Engineering A Revolution in Manufacturing: The SMED System...... 69 Processes and Techniques...... 84 C2 Re-envisioned: The Future of the Enterprise...... 97 A Study of the Toyota Production System: From an Industrial Designing Enterprise Architecture Frameworks: Engineering Viewpoint...... 58 Canadian Public Administration in the 21st Century...... 102 Integrating Business Processes with IT Infrastructure...... 3 A3 Problem Solving for Healthcare: A Practical Method for Capitalizing on Lean Production Systems to Win New Business: Designing Food Safety and Equipment Reliability Through Eliminating Waste...... 16 Creating a Lean and Profitable New Product Portfolio...... 92 Maintenance Engineering...... 92 Above Ground Storage Tanks: Practical Guide to Construction, Case Studies in Disaster Response and Emergency Management...108 Designing Service Excellence: People and Technology...... 103 Inspection, and Testing...... 82 Case Studies in System of Systems, Enterprise Systems, Developing Windows-Based and Web-Enabled Information Systems.....3 Accelerating Health Care Transformation with Lean and and Complex Systems Engineering...... 3 Development and the Politics of Human Rights...... 103 Innovation: The Virginia Mason Experience...... 16 Cellular Manufacturing: Mitigating Risk and Uncertainty...... 81 Dictionary of 21st Century Energy Technologies, Financing Accountable Care Organizations: Value Metrics and Capital Cellular Manufacturing: One-Piece Flow for Workteams...... 81 and Sustainability...... 12 Formation...... 13 Challenges in City Management: A Case Study Approach...... 106 Digital Divides: The New Challenges and Opportunities Accounting in the Lean Enterprise: Providing Simple, Practical, Chance or Choice: Unlocking Innovation Success...... 6 of e-Inclusion...... 112 and Decision-Relevant Information...... 39 Digital Humanitarians: How Big Data Is Changing the Face Citizen Participation at the Local Level in China and Canada...... 102 Index Title of Humanitarian Response...... 108 Achieving HR Excellence through Six Sigma...... 62 City Logistics: Mapping The Future...... 92 Direct Pay: A Simpler Way to Practice Medicine...... 17 Achieving Patient (aka Customer) Experience Excellence: Clausewitz Talks Business: An Executive’s Guide to Thinking Lessons From a Successful Cultural Transformation in a Hospital...... 17 Like a Strategist...... 27 Directing the ERP Implementation: A Best Practice Guide to Avoiding Program Failure Traps While Tuning System Performance...3 Achieving STEEEP Health Care: Baylor Health Care System’s Clinical Care and Management of Long Term Conditions...... 117 Quality Improvement Journey...... 17 Disaster and Recovery Planning: A Guide for Facility Managers, Clinical Problem Lists in the Electronic Health Record...... 13 Acting Strategically Using Drama Theory...... 5 Sixth Edition...... 51 Closing the Communication Gap: An Effective Method Active Risk Management: Financial Models and Statistical Methods...31 Disaster Recovery, Second Edition...... 98 for Achieving Desired Results...... 28 Active Shooter Events and Response...... 50 Disaster’s Impact on Livelihood and Cultural Survival: Losses, Collaborative Policing: Police, Academics, Professionals, and Opportunities, and Mitigation...... 98 Actuarial Models: The Mathematics of Insurance, Second Edition....32 Communities Working Together for Education, Training, and Discovering the Intersections of Innovation and Quality...... 65 Adapting to Sea Level Rise in the Coastal Zone: Program Implementation...... 111 Discrete and Continuous Simulation: Theory and Practice...... 78 Law and Policy Considerations...... 108 Commodities...... 32 DOE Simplified: Practical Tools for Effective Experimentation, Advances in Crisis and Emergency Management: Communication for Continuous Improvement Projects...... 41 Theory and Practice ...... 101 Third Edition...... 79 Community Policing in Indigenous Communities...... 111 Adversarial Risk Analysis...... 32 Driving Risk and Spend Out of the Global Supply Chain...... 92 Comparing Environmental Policies in 16 Countries...... 111 Affordable Reliability Engineering...... 82 Drought, Risk Management, and Policy: Decision-Making Competitive Innovation and Improvement: Statistical Design Agile for Project Managers...... 40 Under Uncertainty...... 108 and Control...... 84 Agile Strategy Management: Techniques for Complexity and the Human Experience: Modeling Complexity Continuous Alignment and Improvement...... 75 E in the Humanities and Social Sciences...... 117 Agribusiness Supply Chain Management...... 91 Comprehensive Financial Planning Strategies for Doctors and Economic and Financial Analysis for Air Cargo Management...... 92 Advisors: Best Practices from Leading Consultants and Certified Criminal Justice Organizations...... 103 American Environmentalism: Philosophy, History, Medical Planners™...... 15 Economic Development, Crime, and Policing: Global Perspectives...112 and Public Policy...... 111 Computational Actuarial Science with R...... 32 Economic-Mathematical Methods and Models under Uncertainty...33 American Volunteer Police: Mobilizing for Security...... 97 Computational Business Analytics...... 6 Educating Scientists and Engineers for Academic An Introduction to Comparative Legal Models of Criminal Justice.....106 Computational Methods in Finance...... 33 and Non-Academic Career Success...... 106 Analyzing Sensory Data with R...... 83 Computer System Reliability: Safety and Usability...... 84 Effect of Culture on Crisis Management Decision Making: What Every Organization Needs to Know...... 7 119 Andy & Me, Second Edition: Crisis & Transformation Conflict and Cooperation in Cyberspace: on the Lean Journey...... 56 The Challenge to National Security...... 50 Effective Opportunity Management for Projects: Antipatterns: Managing Software Organizations and People, Exploiting Positive Risk...... 41 Consider a Spherical Patent: Second Edition...... 40 IP and Patenting in Technology Business...... 6 Eliminating Serious Injury and Death from Road Transport: Antiterrorism and Threat Response: Planning and Implementation.....50 A Crisis of Complacency...... 103 Construction Program Management...... 41 Applied Reliability, Third Edition...... 83 Emergency Management: The American Experience 1900-2010, Continuous Flow for Healthcare...... 17 Applied Time Series Modelling with Unobserved Components...... 32 Second Edition...... 98 Cop Culture: Why Good Cops Go Bad...... 111 Applying Analytics: A Practical Introduction...... 78 Emergency Planning Guide for Utilities, Second Edition...... 98 Corporate Security Intelligence and Strategic Decision-Making...... 50 Applying Guiding Principles of Effective Program Delivery...... 40 Emerging Technologies in Healthcare...... 13 Counterparty Risk and Funding: A Tale of Two Puzzles...... 33 Around the Patient Bed: Human Factors and Safety in Health Care....83 Emerging Technologies: Socio-Behavioral Life Cycle Approaches...118 Creating a Lean and Green Business System: Empowering Project Teams: Using Project Followership Artificial Intelligence Tools: Decision Support Systems Techniques for Improving Profits and Sustainability...... 71 in Condition Monitoring and DIagnosis...... 83 to Improve Performance...... 42 Creating a Lean Culture: Tools to Sustain Lean Conversions, Authenticity of Foods of Animal Origin...... 83 Encyclopedia of Information Assurance (Online Version)...... 51 Third Edition...... 63 Automated Diagnostics and Analytics for Buildings...... 70 Encyclopedia of Library and Information Sciences, Creating a Strategic Energy Reduction Plan...... 71 Autonomous Maintenance for Operators...... 67 Third Edition (Print Version)...... 118 Creating and Marketing New Products and Services...... 49 Autonomous Maintenance in Seven Steps: Encyclopedia of Supply Chain Management (Online Version)...... 93 Creating Mixed Model Value Streams: Practical Lean Techniques Implementing TPM on the Shop Floor...... 67 Energy Management Handbook, Eighth Edition...... 71 for Building to Demand, Second Edition...... 69 Engineering Patient Safety in Radiation Oncology: B Creating Public Value in Practice: Advancing the Common Good University of North Carolina’s Pursuit for High Reliability in a Multi-Sector, Shared-Power, No-One-Wholly-in-Charge and Value Creation...... 18 Baldrige Award Winning Quality -- 18th Edition: How to World...... 102 Engineering Solutions to America’s Healthcare Challenges...... 18 Interpret the Baldrige Criteria for Performance Excellence...... 67 Creative, Efficient, and Effective Project Management...... 41 Engineering Systems Integration: Theory, Metrics, and Methods...... 3 Best Practices for Transportation Agency Use of Social Media...... 92 Crime Prevention: Theory and Practice, Second Edition...... 112 Engineering Textiles: Research Methodologies, Concepts, Beyond Lean Production: Emphasizing Speed and Innovation Criminal Financial Investigations: The Use of Forensic Accounting and Modern Applications...... 84 to Beat the Competition...... 27 Techniques and Indirect Methods of Proof, Second Edition...... 11 ENOVALE: How to Unlock Sustained Innovation Project Success...... 7 Beyond the Days of the Giants: Solving the Crisis of Growth Crisis and Emergency Management: Theory and Practice, Enterprise Dynamics Sourcebook...... 4 and Succession in Today’s CPA Firms...... 39 Second Edition...... 102 Enterprise Integration and Information Architecture: Beyond the Lean Office: Progressing from Lean Tools Critical Incident Management: A Complete Response Guide, A Systems Perspective on Industrial Information Integration...... 7 to Operational Excellence...... 60 Second Edition...... 97 Environmental Law from the Policy Perspective: Understanding Big Data and Business Analytics...... 5 Critical Infrastructure System Security and Resiliency...... 97 How Legal Frameworks Influence Environmental Problem Solving....112 Big Data and Health Analytics...... 13 Critical Infrastructure: Homeland Security and Emergency Environmental Policymaking and Stakeholder Collaboration: Big Data Computing...... 3 Preparedness, Third Edition...... 97 Theory and Practice...... 112 Big Data: A Business and Legal Guide...... 5 Critical Urban Infrastructure Handbook...... 98 Equivalence and Noninferiority Tests for Quality, Manufacturing Biology of Foodborne Parasites...... 83 Culture and Trust in Technology-Driven Organizations...... 81 and Test Engineers...... 84
For more information and a complete list of titles, visit us at www.crcpress.com Essential Management Skills for Pharmacy and Business Managers....13 Handbook of Surveillance Technologies, Third Edition...... 52 J/K Essentials of Multivariate Data Analysis...... 33 Hazardous Air Pollutants: Case Studies from Asia...... 117 EU Annex 11 Guide to Computer Validation Compliance Hazards Analysis: Reducing the Impact of Disasters, Second Edition...99 Just-in-Time for Healthcare...... 20 for the Worldwide Health Agency GMP...... 14 Health IT as a Tool for Prevention in Public Health Policies...... 19 Juvenile Justice: International Perspectives, Models and Trends...... 114 Examining Political Violence: Studies of Terrorism, Healthcare Analytics: An Introduction to the Role of Kaizen for the Shop Floor: A Zero-Waste Environment Counterterrorism, and Internal War...... 113 Data Analytics in Transforming Care...... 19 with Process Automation...... 63 Expanding the Capacity to Care...... 18 Healthcare Hazard Control and Safety Management, Kaizen Workshops for Lean Healthcare...... 20 Second Edition...... 19 F Kamishibai Boards: A Lean Visual Management System Healthcare Informatics: Improving Efficiency and Productivity...... 14 That Supports Layered Audits...... 66 Healthcare Kaizen: Engaging Front-Line Staff in Sustainable Facilitating Deep Learning: Pathways to Success for University Kanban for the Shopfloor...... 94 Continuous Improvements...... 19 and College Teachers...... 106 Kanban for the Supply Chain: Fundamental Practices for Healthcare Process Redesign Methods and Approaches...... 19 Facilities Design, Third Edition...... 71 Manufacturing Management, Second Edition...... 94 High-Performance Buildings: A Guide for Owners & Managers...... 72 Far from the Factory: Lean for the Information Age, Kansei Innovation: Practical Design Applications for Product Second Edition...... 61 Hoshin Kanri for the Lean Enterprise: Developing Competitive Capabilities and Managing Profit...... 28 and Service Development...... 80 Finance Policy for Renewable Energy and a Key Engineering Materials, Volume 1: Current State-of-the-Art Sustainable Environment...... 12 Hospital Emergency Management...... 99 on Novel Materials...... 75 Financial Investigation and Forensic Accounting, Third Edition...... 12 How to Outthink, Outmaneuver, and Outperform Your Competitors: Lessons from the Masters of Strategy...... 28 Key Engineering Materials, Volume 2: Interdisciplinary Concepts Financial Management Strategies for Hospitals and Healthcare and Research...... 75 Organizations: Tools, Techniques, Checklists and Case Studies...... 15 Human Factors of a Global Society: A System of Systems Perspective...... 80 Knowledge Discovery Process and Methods to Enhance Financial Mathematics: A Comprehensive Treatment...... 33 Human Work Productivity: A Global Perspective...... 81 Organizational Performance...... 63 Financial Modelling with Jump Processes, Second Edition...... 34 Hurricane Mitigation for the Built Environment...... 99 FISMA Principles and Best Practices: Beyond Compliance...... 51 Identifying Waste on the Shopfloor...... 56 L Food Analysis by HPLC, Third Edition...... 85
Title Index Impact Analytics: Making Every Decision Count...... 8 Food Insecurity and Public Health...... 113 Labor Relations in the Public Sector, Fifth Edition...... 103 Impact of Healthcare Informatics on Quality of Patient Care Food Plant Sanitation: Design, Maintenance, and Good Land Use and Land Cover Semantics: Principles, Best Practices and Health Services...... 14 Manufacturing Practices, Second Edition...... 85 and Prospects...... 109 Food Policy: Looking Forward from the Past...... 113 I Land-Use Planning for Sustainable Development, Second Edition.....109 Food Safety Chemistry: Toxicant Occurrence, Analysis Leadership and Management in Pharmacy Practice, and Mitigation...... 85 Implementing Program Management: Templates and Forms Second Edition...... 14 Food Safety in China: A Comprehensive Review...... 85 Aligned with the Standard for Program Management, Leadership Basics for Frontline Managers: Food Safety Management Programs: Applications, Best Practices, Third Edition (2013) and Other Best Practices...... 42 Tips for Raising Your Level of Effectiveness and Communication...... 29 and Compliance...... 85 Implementing SAP® CRM: The Guide for Business Leadership in the Open: A New Paradigm in Food Safety: Interpreting and Applying the Various Agency and Technology Managers...... 8 Emergency Management...... 100 Regulations...... 85 Implementing Standardized Work: Process Analysis...... 57 Leading Healthcare Transformation: A Primer for Clinical Leaders....20 Food Safety: Researching the Hazard in Hazardous Foods...... 24 Implementing Standardized Work: Process Improvement...... 57 Leading the Lean Enterprise Transformation, Second Edition...... 29 Foodborne Viral Pathogens...... 86 Implementing Standardized Work: Training Operators Leading the Lean Healthcare Journey: Driving Culture Change Forensic Laboratory Management: Applying Business Principles...... 7 and Sustaining Standardized Work...... 57 to Increase Value...... 20 Foundations of Psychological Profiling: Terrorism, Espionage, Implementing Standardized Work: Writing Standardized Leading Virtual Project Teams: Adapting Leadership Theories and Deception...... 52 Work Forms...... 57 and Communications Techniques to 21st Century Organizations....42 Four-Cornered Leadership: A Framework for Making Decisions...... 7 Implementing TWI: Creating and Managing a Skills-Based Culture....74 Lean Basics for R&D: Developing Innovative and Fraud Prevention and Detection: Warning Signs and the Improving Food Quality with Novel Food Processing Technologies...86 Profitable Products with Operational Excellence...... 65 Lean Design Handbook for Healthcare Facilities...... 20 Red Flag System...... 52 Incidental Trainer: A Reference Guide for Training Design, Freedom from Command and Control: Rethinking Management Development, and Delivery...... 26 Lean for Banks: Improving Quality, Productivity, and Morale in Financial Offices...... 61 for Lean Service...... 28 Industrial Engineering Applications in Emerging Countries...... 93 Lean for Sales: Bringing the Science of Lean to the Art of Selling.....49 From Business Strategy to Information Technology Roadmap: Industrial Engineering Non-Traditional Applications in A Practical Guide for Executives and Board Members ...... 7 International Settings...... 93 Lean for the Long Term: Maintaining a Continuous Improvement Culture After a Management Change...... 63 From Lean to Operational Excellence in the Office: Industrial Engineering: Management, Tools, and Applications...... 93 A Practical Guide for Intelligent Flow in Business Processes...... 61 Lean Higher Education: Increasing the Value and Performance Industrial Espionage: Developing a Counterespionage Program...... 52 From Projects to Programs: A Project Manager’s Journey...... 42 of University Processes...... 61 Information Needs for Water Management...... 108 Fundamental Food Microbiology, Fifth Edition...... 86 Lean Hospitals: Improving Quality, Patient Safety, Information Security Management Handbook, and Employee Engagement, Second Edition...... 21 Fundamentals of Manufacturing For Engineers...... 77 2013 CD-ROM Edition...... 52 Lean Human Performance Improvement...... 64 G Information Security Policy Development for Compliance: Lean Human Resources: Redesigning HR Processes ISO/IEC 27001, NIST SP 800-53, HIPAA Standard, PCI DSS V2.0, for a Culture of Continuous Improvement...... 61 and AUP V5.0...... 4 Gay, Lesbian, Bisexual, and Transgender Civil Rights: Lean Innovation: Understanding What’s Next in Today’s Economy....9 Information Systems: What Every Business Student Needs to Know..9 A Public Policy Agenda for Uniting a Divided America...... 114 Lean IT: Enabling and Sustaining Your Lean Transformation...... 61 Innovation, Commercialization, and Start-Ups in Life Sciences...... 9 Geographic Information Systems (GIS) for Disaster Management....98 Lean Leadership for Healthcare: 120 Getting Started with Business Analytics: Insightful Decision-Making ....8 Innovations in Healthcare Management: Cost-Effective and Approaches to Lean Transformation...... 21 Sustainable Solutions...... 19 Getting to Standard Work in Health Care: Using TWI to Lean Logistics: The Nuts and Bolts of Delivering Materials Create a Foundation for Quality Care...... 18 Instrumentation for Process Measurement and Control, and Goods...... 94 Third Editon...... 72 Getting Unstuck: Using Leadership Paradox to Execute with Lean Mapping for the Process Industries: Confidence...... 67 Integrated Reliability: Condition Monitoring and Maintenance Optimizing Process Flow Using Value Stream Maps...... 69 of Equipment...... 86 GIS for Critical Infrastructure Protection...... 99 Lean Office and Service Simplified: The Definitive How-To Guide....62 Global Issues in Contemporary Policing...... 114 Intelligent Manufacturing: Reviving U.S. Manufacturing Including Lean Production for Competitive Advantage: A Comprehensive Global Logistics Management...... 93 Lessons Learned from Delphi Packard Electric and General Motors....29 Guide to Lean Methodologies and Management Practices...... 29 Global Production Networks: Operations Design and Intelligent Network Video: Understanding Modern Video Lean Production Simplified, Second Edition: A Plain-Language Management, Second Edition...... 81 Surveillance Systems...... 53 Guide to the World’s Most Powerful Production System...... 57 Global Supply Chain Quality Management: Product Recalls Introduction to Business Analytics...... 9 Lean RFS (Repetitive Flexible Supply): Putting the Pieces Together....94 and Their Impact...... 93 Introduction to Credit Risk Modeling, Second Edition...... 34 Lean Safety Gemba Walks: A Methodology for Workforce Governance Networks in Public Administration and Public Policy.....107 Introduction to Emergency Management...... 99 Engagement and Culture Change...... 74 Government Anti-Corruption Strategies: Introduction to Intelligence Studies...... 53 Lean Safety: Transforming your Safety Culture with A Cross-Cultural Perspective...... 107 Introduction to Process Control, Second Edition...... 77 Lean Management...... 74 Green Design, Materials and Manufacturing Processes...... 77 Introduction to Risk and Failures: Tools and Methodologies...... 87 Lean Six Sigma for Engineers and Managers: Green Power: Perspectives on Sustainable Electricity Generation.....73 Introduction to Risk Parity and Budgeting...... 34 With Applied Case Studies...... 87 Grid Parity: The Art of Financing Renewable Energy Projects Introduction to Software Project Management...... 42 Lean Supply Chain Management Essentials: A Framework for Materials Managers...... 94 in the U.S...... 12 Introduction to Spatial Econometrics...... 34 LEAN Supply Chain Planning: The New Supply Chain Management Grow Your Factory, Grow Your Profits: Lean for Small Introduction to Statistical Process Control...... 87 and Medium-Sized Manufacturing Enterprises...... 74 Paradigm for Process Industries to Master Today’s VUCA World...... 95 Introduction to Stochastic Calculus with Applications...... 34 Lean Systems: Applications and Case Studies in Manufacturing, H Introduction to Stochastic Processes, Second Edition...... 35 Service, and Healthcare...... 87 Introduction to Stock Portfolio Management...... 35 Lean Today, Rich Tomorrow: Succeeding in Today’s Handbook of Concierge Medical Practice Design...... 14 Introduction to Supply Chain Management Technologies, Globalization Chaos...... 74 Second Edition...... 94 Handbook of Design and Analysis of Experiments...... 75 Lean Waste Stream: Reducing Material Use and Garbage Handbook of Discrete-Valued Time Series...... 34 Introduction to Transportation Security...... 108 Using Lean Principles...... 62 Handbook of Energy Audits, Ninth Edition...... 71 Inverting the Paradox of Excellence: How Companies Use Lean-Led Hospital Design: Creating the Efficient Hospital Handbook of Energy Engineering, Seventh Edition...... 71 Variations for Business Excellence and How Enterprise Variations of the Future...... 21 Handbook of Food Analysis, Third Edition - Two Volume Set...... 86 Are Enabled by SAP...... 9 Learning with Lean: Unleashing the Potential for Handbook of Human Factors and Ergonomics in Health Care Investigations in the Workplace, Second Edition...... 53 Sustainable Competitive Advantage...... 64 and Patient Safety, Second Edition...... 86 Investigative Interviewing: Psychology, Method and Practice...... 53 Leveraging Lean in Ancillary Hospital Services: Creating a Cost Handbook of Industrial and Systems Engineering, Second Edition...75 Investment and Employment Opportunities in China...... 12 Effective, Standardized, High Quality, Patient-Focused Operation....21 Handbook of Public Policy Analysis: Theory, Politics, and Methods...114 It’s About Time: The Competitive Advantage of Leveraging Lean in Medical Laboratories: Creating a Cost Handbook of SCADA/Control Systems Security...... 99 Quick Response Manufacturing...... 29 Effective, Standardized, High Quality, Patient-Focused Operation....21
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Leveraging Lean in Surgical Services: Creating a Cost Effective, Navigating Strategic Decisions: The Power of Sound Analysis Project Management Case Studies and Lessons Learned: Standardized, High Quality, Patient-Focused Operation...... 22 and Forecasting...... 10 Stakeholder, Scope, Knowledge, Schedule, Resource Lighting & Controls: Transitioning to the Future...... 72 Network and Adaptive Sampling...... 35 and Team Management...... 45 Liquid Lean: Developing Lean Culture in the Process Industries...... 82 Networks in Society: Links and Language...... 118 Project Management for Healthcare...... 45 Living Legends and Full Agency: Implications of Repealing New JIT, New Management Technology Principle...... 68 Project Management for Research and Development: Guiding the Combat Exclusion Policy...... 114 Nonlinear Option Pricing...... 35 Innovation for Positive R&D Outcomes...... 46 Local Economic Development and the Environment: Nonlinear Systems Stability Analysis: Lyapunov-Based Approach.....88 Project Management for the Oil and Gas Industry: A World System Approach...... 46 Finding Common Ground...... 109 Nonlinear Time Series: Theory, Methods and Applications with Local Food Environments: Food Access in America...... 114 R Examples...... 35 Project Management in Extreme Situations: Lessons from Polar Expeditions, Miltary and Rescue Operations, Logistics and Transportation Security: A Strategic, Tactical, Novel Food Preservation and Microbial Assessment Techniques...... 89 and Wilderness Explorations...... 46 and Operational Guide to Resilience...... 53 Novel Techniques in Sensory Characterization and Consumer Project Management Maturity Model, Third Edition...... 46 Long-Term Community Recovery from Natural Disasters...... 100 Profiling...... 89 Project Management Theory and Practice, Second Edition...... 46 M O/P Project Management Tools and Techniques: A Practical Guide...... 46 Project Planning and Project Success: The 25% Solution...... 47 Made-to-Order Lean: Excelling in a High-Mix, Low-Volume OEE for Operators: Overall Equipment Effectiveness...... 72 Project Scope Management: A Practical Guide to Requirements Environment...... 68 Operations Planning: Mixed Integer Optimization Models...... 79 for Engineering, Product, Construction, IT and Enterprise Projects..47 Maintenance, Replacement, and Reliability: Organizational Assessment and Improvement in the Public Administration and Disability: Community Services Theory and Applications, Second Edition...... 87 Public Sector Workbook...... 107 Administration in the US...... 104 Make No Mistake!: An Outcome-Based Approach Organizational Resilience: Managing the Risks of Public Administration and Policy in the Caribbean...... 104 to Mistake-Proofing...... 59 Disruptive Events - A Practitioner’s Guide...... 100 Public Administration in Africa: Performance and Challenges...... 115 Make Your Business a Lean Business: Out of the Box Thinking for Successful Managers...... 10 How to Create Enduring Market Leadership...... 30 Public Administration in Post-Communist Countries: Former Paradox and Imperatives in Health Care: Redirecting Reform for Soviet Union, Central and Eastern Europe, and Mongolia...... 104 Making Multilevel Public Management Work: Efficiency and Effectiveness, Revised Edition...... 22 Stories of Success and Failure from Europe and North America...... 107 Public Administration in South Asia: India, Bangladesh, Patient-Focused Network Integration in BioPharma: and Pakistan...... 106 Making Projects Work: Effective Stakeholder Management Strategic Imperatives for the Years Ahead...... 95 and Communication...... 43 Public Administration Training in Africa: Patients’ Rights, Law and Ethics for Nurses, Second Edition...... 117 Competencies in Development Management...... 107 Making the Case for Change: Using Effective Business Cases People, Process, and Culture: Lean Manufacturing in the to Minimize Project and Innovation Failures...... 30 Public Health for Children, Second Edition...... 117 Real World...... 64 Management Engineering: A Guide to Best Practices Public Sector Ethics: Theory and Applications...... 104 Performance Acceleration Management (PAM): for Industrial Engineering in Health Care...... 22 Public Transport Planning and Management in Rapid Improvement to Your Key Performance Drivers...... 30 Management Science Applications in Hospitality and Tourism...... 24 Developing Countries...... 110 Personal Security: A Guide for International Travelers...... 54 Managing Emotion in Design Innovation...... 80 Pump User’s Handbook: Life Extension, Fourth Edition...... 73
Personnel Management in Government: Politics and Process, Index Title Managing Food Safety Risks in the Agri-Food Industries...... 87 Seventh Edition...... 104 Q Managing Professional Service Delivery: 9 Rules for Success...... 43 PfMP® Exam Practice Tests and Study Guide...... 43 Managing Projects as Investments: Earned Value to Business Value....43 PgMP® Exam Challenge!...... 43 Quality by Experimental Design, Fourth Edition...... 90 Managing Risk and Security in Outsourcing IT Services: PgMP® Exam Practice Test and Study Guide, Fourth Edition...... 43 Quality Engineering: Off-Line Methods and Applications...... 90 Onshore, Offshore and the Cloud...... 53 Physical Security and Environmental Protection...... 100 Quality Management for Organizations Using Managing Sustainability in the Hospitality and Tourism Industry: Lean Six Sigma Techniques...... 90 Physical Security and Safety: A Field Guide for the Practitioner...... 54 Paradigms and Directions for the Future...... 24 Quality Tools for Managing Construction Projects...... 90 Plant Sanitation for Food Processing and Food Service, Managing Workers’ Compensation: A Guide to Injury Reduction Second Edition ...... 89 Quantitative Equity Portfolio Management: and Effective Claim Management...... 26 Modern Techniques and Applications...... 36 P-M Analysis: AN ADVANCED STEP IN TPM IMPLEMENTATION...... 68 Manufacturing Facilities: Location, Planning, and Design, Quantitative Finance: A Simulation-Based Introduction Using Excel....36 PMP® Exam Challenge!, Sixth Edition...... 44 Third Edition...... 78 Quantitative Finance: An Object-Oriented Approach in C++...... 36 PMP® Exam Practice Test and Study Guide, Ninth Edition...... 44 Manufacturing Operations Management...... 82 Quantitative Methods and Socio-Economic Applications in Poka-Yoke: Improving Product Quality by Preventing Defects...... 59 Manufacturing Technology Transfer: A Japanese Monozukuri GIS, Second Edition...... 110 Police Liability and Risk Management: Torts, Civil Rights, and View of Needs and Strategies...... 74 Quick Changeover Concepts Applied: Dramatically Reduce Employment Law...... 115 Mapping Clinical Value Streams...... 22 Set-Up Time and Increase Production Flexibility with SMED...... 68 Policing Major Events: Perspectives from Around the World...... 100 Mapping the Total Value Stream: A Comprehensive Guide for Quick Changeover for Operators: The SMED System...... 68 Politics of Preference: India, United States, and South Africa...... 104 Production and Transactional Processes...... 70 Quick Response Manufacturing: A Companywide Approach Mastering Complexity: Adding Coherence Throughout Your Business Popular Manufacturing Myths: Eliminating Widely Held Beliefs That to Reducing Lead Times...... 30 with Dependency Structure Matrices...... 66 Reduce Competitiveness...... 58 Mastering International Negotiation Skill Sets...... 95 Port Management and Operations...... 109 R Mastering the Business of Global Trade: Negotiating Competitive Port Security Management, Second Edition...... 54 Advantage Contractual Best Practices, Incoterms, and Leveraging Portable Biosensing of Food Toxicants and Random Dynamical Systems in Finance...... 37 Supply Chain Options...... 95 Environmental Pollutants...... 89 Ready Technology: Fast-Tracking New Business Technologies...... 10 Maternity Leave: Policy and Practice...... 115 Portfolio Management: A Strategic Approach...... 44 Reliability Engineering and Risk Analysis: Mathematical Statistics for Applied Econometrics...... 35 Practical Lean Accounting: A Proven System for Measuring A Practical Guide, Second Edition...... 90 Maximizing Value Propositions to Increase Project Success Rates.....30 and Managing the Lean Enterprise, Second Edition...... 40 Remote Sensing of Impervious Surfaces in Tropical 121 Meat Quality: Genetic and Environmental Factors...... 88 Practical Plant Failure Analysis: A Guide to Understanding and Subtropical Areas...... 110 Mechanical Tolerance Stackup and Analysis, Second Edition...... 72 Machinery Deterioration and Improving Equipment Reliability...... 73 Removing the Barriers to Efficient Manufacturing: Real-World Applications of Lean Productivity...... 60 Medical Informatics: An Introduction to Information Systems and PRAGMATIC Security Metrics: Applying Metametrics to Software in Medicine and Health...... 14 Information Security...... 54 Responsive Security: Be Ready to Be Secure...... 54 Medical Staff Integration: Transactions and Transformation...... 15 Preparedness and Response for Catastrophic Disasters...... 101 Restaurant Franchising: Concepts, Regulations and Practices, Third Edition...... 25 Methods in Food Analysis...... 88 Preparing for Continuous Quality Improvement for Healthcare: Sustainability through Functional Tree Structures...... 23 Return On Process (ROP): Getting Real Performance Results Methods in Product Design: New Strategies in Reengineering...... 80 Pricing in General Insurance...... 36 from Process Improvement...... 66 Metrics-Based Process Mapping: Identifying and Revenue Cycle Management in Healthcare...... 16 Eliminating Waste in Office and Service Processes...... 62 Principles of Copula Theory...... 36 Reverse Supply Chains: Issues and Analysis...... 95 mHealth Multidisciplinary Verticals...... 22 Principles of Emergency Management and Emergency Operations Centers (EOC), Second Edition...... 101 Reversing Urban Decline: Why and How Sports, Entertainment, Microbial Food Safety and Preservation Techniques...... 88 Principles of Risk Analysis: Decision Making Under Uncertainty...... 89 and Culture Turn Cities into Major League Winners, Microbiological Examination Methods of Food and Water: Second Edition...... 110 A Laboratory Manual...... 88 Principles of Supply Chain Management, Second Edition...... 95 Principles of Total Quality, Third Edition...... 90 Reviving Citizen Engagement: Policies to Mistake Proofing for Lean Healthcare...... 22 Renew National Community...... 105 Probability Foundations for Engineers...... 79 Mistake-Proofing for Operators: The ZQC System...... 59 Risk Analysis in Engineering and Economics, Second Edition...... 37 Probability Models in Operations Research...... 79 Model-Driven Engineering of Information Systems: Risk Analysis in Engineering: Techniques, Tools, and Trends...... 91 Principles, Techniques, and Practice...... 4 Probability, Statistics, and Reliability for Engineers and Risk Assessment and Decision Analysis with Bayesian Networks...... 37 Modeling and Simulation-Based Systems Engineering Handbook....75 Scientists, Third Edition...... 36 Problem Solving for Engineers...... 44 Risk Assessment and Security for Pipelines, Tunnels, and Modern Construction: Lean Project Delivery and Underground Rail and Transit Operations...... 110 Integrated Practices...... 82 Process Safety Management: Leveraging Networks and Communities of Practice for Continuous Improvement...... 77 Risk Intelligent Supply Chains: How Leading Turkish Companies Modern Geopolitics and Security: Strategies for Thrive in the Age of Fragility...... 96 Unwinnable Conflicts...... 54 Process Techniques for Engineering High-Performance Materials.....77 Risk Management and Simulation...... 37 Molecular Biology of Food and Water Borne Mycotoxigenic Product Design for Manufacture and Assembly, Third Edition...... 77 Risk Management: Concepts and Guidance, Fifth Edition...... 47 and Mycotic Fungi...... 88 Production and Operations Management...... 73 Risk Management: Concepts and Guidance, Fourth Edition...... 11 Money Laundering: A Guide for Criminal Investigators, Production and Operations Management Systems...... 76 Robust Response Surfaces, Regression, and Positive Data Analyses..91 Third Edition...... 12 Program Governance...... 44 Roll Forming Handbook...... 78 MOST Work Measurement Systems, Third Edition,...... 72 Program Management in Defense and High Tech Environments.....45 Root Cause Analysis: A Step-By-Step Guide to Using the Program Management Leadership: Creating Successful Right Tool at the Right Time...... 58 N Team Dynamics...... 45 Root Cause Analysis: Improving Performance for Project Health Assessment...... 45 Nanotechnology Commercialization...... 10 Bottom-Line Results, Fourth Edition...... 91 Project Identification: Capturing Great Ideas to Nation-Building in the Baltic States: Transforming Governance, RSM Simplified: Optimizing Processes Using Response Surface Dramatically Improve Your Organization...... 45 Social Welfare, and Security in Northern Europe...... 109 Methods for Design of Experiments...... 58 Project Leadership: Creating Value with an Natural Hazard Mitigation...... 100 Run Grow Transform: Integrating Business and Lean IT...... 62 Adaptive Project Organization...... 10
For more information and a complete list of titles, visit us at www.crcpress.com Russia’s Imperial Revival: The Revanchist Foreign Policy The Art of Consultative Selling: Taking Blue Ocean Strategy The Product Wheel Handbook: Creating Balanced Flow of Vladimir Putin...... 115 a Step Further...... 49 in High-Mix Process Operations...... 30 The Art of Systems Architecting, Third Edition...... 40 The Results Facilitator: Expert, Manager, Mentor...... 31 S The Asia-Pacific Century: Challenges and Opportunities...... 111 The SAP Materials Management Handbook...... 4 The Basics of Achieving Professional Certification: The Science of Footwear...... 80 Safety Management in a Competitive Business Environment...... 76 Enhancing Your Credentials...... 56 The Security Risk Assessment Handbook: A Complete Guide Safety, Health, and Environmental Auditing: A Practical Guide...... 91 The Basics of Hoshin Kanri...... 27 for Performing Security Risk Assessments, Second Edition...... 55 Satellite Marketing: Using Social Media for Improving Customer The Basics of Process Mapping, 2nd Edition...... 17 The Self-Made Program Leader: Participation and Engagement...... 49 The Basics of Project Evaluation and Lessons Learned, Taking Charge in Matrix Organizations...... 47 Scalable Innovation: A Guide for Inventors, Entrepreneurs, Second Edition...... 65 The Semantic Turn: A New Foundation for Design...... 81 and IP Professionals...... 31 The Clinical Co-Management Workbook: A Guide to Designing The Strategic CIO: Changing the Dynamics of the Second Victim: Error, Guilt, Trauma, and Resilience...... 23 and Implementing a Compliant, Centralized, Co-Management Business Enterprise...... 11 Security Management for Occupational Safety...... 26 Structure...... 15 The Strategic Project Leader: Mastering Service-Based Security Management: A Critical Thinking Approach...... 55 The Complete Lean Enterprise: Value Stream Mapping for Project Leadership, Second Edition...... 48 Security without Obscurity: A Guide to Confidentiality, Administrative and Office Processes, Second Edition...... 60 The Strategic Project Office, Second Edition...... 48 Authentication, and Integrity...... 55 The Complete Project Management Office Handbook, The Terrorist-Criminal Nexus: An Alliance of International Sensory Evaluation Techniques, Fifth Edition...... 91 Third Edition...... 41 Drug Cartels, Organized Crime, and Terror Groups...... 55 ® Six Sigma Case Studies with Minitab ...... 82 The Constitutional School of American Public Administration...... 105 The Toyota Product Development System: Integrating Six Sigma for Powerful Improvement: A Green Belt DMAIC The CRC Press Terrorism Reader...... 51 People, Process, and Technology...... 65 Training System with Software Tools and a 25-Lesson Course...... 26 The Customer-Driven Organization: Employing the Kano Model.....60 The TWI Workbook: Essential Skills for Supervisors...... 59 Smart Use of State Public Health Data for Health Disparity The Definitive Guide to Emergency Department Operational Time Series: Modeling, Computation, and Inference...... 39 Assessment...... 117 Improvement: Employing Lean Principles with Current ED Best Tourism in Central Asia: Cultural Potential and Challenges...... 25 Soccermetrics: Science of Soccer Statistics...... 37 Practices to Create the “No Wait” Department...... 17 Toyota Production System: An Integrated Approach to Social Computing...... 4 The Economic Viability of Micropolitan America...... 112 Just-In-Time, 4th Edition...... 59 Title Index Social Vulnerability to Disasters, Second Edition...... 101 The Ethics of Cultural Competence in Higher Education...... 106 Toyota Production System: Beyond Large-Scale Production...... 58 Software and Systems Architecture in Action...... 47 The Evolution of Policing: Worldwide Innovations and Insights...... 113 TPM for Every Operator...... 69 Software Testing and Continuous Quality Improvement, The Exchange: A Bold and Proven Approach to Resolving TPM in Process Industries...... 69 Third Edition...... 47 Workplace Conflict...... 25 Trade Secret Theft, Industrial Espionage, and the China Threat...... 55 Sports Finance and Management: Real Estate, Entertainment, The Executive Guide to Healthcare Kaizen: Leadership for a Traffic Simulation and Data: Validation Methods and Applications....110 and the Remaking of the Business...... 11 Continuously Learning and Improving Organization...... 18 Training Within Industry: The Foundation of Lean...... 59 Stakeholder Engagement: The Game Changer for The Expanded and Annotated My Life and Work: Henry Ford’s Transforming Business with Program Management: Program Management...... 48 Universal Code for World-Class Success...... 28 Integrating Strategy, People, Process, Technology, Structure, Standard Work for Lean Healthcare...... 23 The Fiscal Health of U.S. Cities...... 105 and Measurement...... 48 Standard Work for the Shopfloor...... 58 The Foundations of Communication in Criminal Justice Systems...113 Transforming Health Care: Virginia Mason Medical Center’s State Failure Around the World: Fractured Justice The Four Components of a Fast-Paced Organization: Pursuit of the Perfect Patient Experience...... 23 and Fierce Reprisal...... 115 Going Beyond Lean Sigma Tools...... 28 Trends in Corrections: Interviews with Corrections Leaders Statistical and Machine-Learning Data Mining: Techniques for The Four Stages of Highly Effective Crisis Management: Around the World, Volume Two...... 116 Better Predictive Modeling and Analysis of Big Data, How to Manage the Media in the Digital Age...... 113 Trends in Policing: Interviews with Police Leaders Across the Second Edition...... 49 The Frugal CISO: Using Innovation and Smart Approaches Globe, Volume Five...... 116 Statistical Methods for Financial Engineering...... 37 to Maximize Your Security Posture...... 52 Trends in Policing: Interviews with Police Leaders Across the Statistical Methods with Applications to Demography and The Geography of International Terrorism: An Introduction Globe, Volume Four...... 107 Life Insurance...... 38 to Spaces and Places of Violent Non-State Groups...... 116 Trends in the Judiciary: Interviews with Judges Across the Statistical Studies of Income, Poverty and Inequality in Europe: The Guide to Achieving STEEEP™ Health Care: Globe, Volume One...... 105 Computing and Graphics in R using EU-SILC...... 38 Baylor Scott & White Health’s Quality Improvement Journey...... 18 Trends in the Judiciary: Interviews with Judges Across the Statistics for Finance...... 38 The Guide to Entrepreneurship: How to Create Wealth Globe, Volume Two...... 116 Stochastic Cauchy Problems in Infinite Dimensions: for Your Company and Stakeholders...... 8 Generalized and Regularized Solutions...... 38 The Human Side of Disaster, Second Edition...... 101 U Stochastic Finance: An Introduction with Market Examples...... 38 The Independent Professional: Stochastic Processes with Applications to Finance, Second Edition...38 A Roadmap for Self-Employment Success...... 8 Understanding A3 Thinking: A Critical Component of Stochastic Volatilty with Jumps: Models, Algorithms and The Influential Project Manager: Winning Over Team Members Toyota’s PDCA Management System...... 31 Implementation...... 39 and Stakeholders...... 42 Understanding Healthcare Economics: Managing Your Career Strategic Finance for Criminal Justice Organizations...... 56 The Innovative Lean Enterprise: Using the Principles of Lean in an Evolving Healthcare System...... 15 Strategic Management for the Plastics Industry: Dealing to Create and Deliver Innovation to Customers...... 80 Understanding the Modern Russian Police...... 105 with Globalization and Sustainability, Second Edition...... 11 The Innovative Lean Machine: Synchronizing People, Branding, Unlocking Sustained Innovation Success in Healthcare...... 24 Strategic Planning, Execution, and Measurement (SPEM): and Strategy to Win in the Marketplace...... 63 Upgrading Leadership’s Crystal Ball: Five Reasons Why Forecasting A Powerful Tool for CEOs...... 31 The International Manager: A Guide for Communicating, Must Replace Predicting and How to Make the Strategic Change Strategic Winery Tourism and Management: Building Competitive Cooperating, and Negotiating with Worldwide Colleagues...... 9 in Business and Public Policy...... 11 Winery Tourism and Winery Management Strategy...... 25 The Kaizen Event Planner: Achieving Rapid Improvement Uptime: Strategies for Excellence in Maintenance Management, 122 Strategy + Teamwork = Great Products: Management Techniques in Office, Service, and Technical Environments...... 63 Third Edition...... 69 for Manufacturing Companies...... 66 The Lean Anthology: A Practical Primer in Continual Improvement....57 Urban Transportation and Logistics: Health, Safety, and Successful Program Management: Complexity Theory, The Lean CFO: Architect of the Lean Management System...... 39 Security Concerns...... 97 Communication, and Leadership...... 48 The Lean Expert: Educating and Elevating Lean Practitioners Using Data Management Techniques to Modernize Healthcare...... 15 Supply Chain Engineering: Models and Applications...... 96 Throughout Your Organization...... 29 Using the “Narcotrafico” Threat to Build Public Administration Supply Chain Management for Engineers...... 96 The Lean Healthcare Dictionary: An Illustrated Guide to Using Capacity between the US and Mexico...... 116 Supply Chain Optimization through Segmentation and Analytics....96 the Language of Lean Management in Healthcare...... 20 Using the Biological Literature: A Practical Guide, Fourth Edition...118 Supply Chain Risk Management: An Emerging Discipline...... 96 The Lean Leader: A Personal Journey of Transformation...... 64 V Supply Chain Security: A Comprehensive Approach...... 96 The Lean Management Systems Handbook...... 5 Sustainability, Social Responsibility and Innovations in the The Lean Practitioner’s Field Book: Proven, Practical, Profitable Value Stream Management for the Lean Office: Eight Steps Hospitality Industry...... 25 and Powerful Technigues for Making Lean Really Work...... 64 to Planning, Mapping, & Sustaining Lean Improvements in Sustainable Development and Human Security in Africa: The Lean Prescription: Powerful Medicine for Administrative Areas...... 62 Governance as the Missing Link...... 116 Our Ailing Healthcare System...... 21 Value Stream Management: Eight Steps to Planning, Mapping, Sustainable Lean: The Story of a Cultural Transformation...... 65 The Lean Six Sigma Black Belt Handbook: and Sustaining Lean Improvements...... 70 Sustainable Manufacturing...... 78 Tools and Methods for Process Acceleration...... 10 Value Stream Mapping for Healthcare Made Easy...... 24 Sustainable Program Management...... 48 The New York City Police Department: The Impact of Its Policies Value-Added Decision Making for Managers...... 79 Sustaining the States: The Fiscal Viability of American and Practices...... 115 Vanishing Boundaries: How Integrating Manufacturing State Governments...... 105 The Objective is Quality: An Introduction to Performance and Services Creates Customer Value, Second Edition...... 76 Systems Engineering Simplified...... 76 and Sustainability Management Systems...... 89 Systems Engineering: Design Principles and Models...... 76 The Performance Mapping and Measurement Handbook...... 39 W/Z The Pittsburgh Way to Efficient Healthcare: Improving Patient Care Using Toyota Based Methods...... 23 Warranty Claims Reduction: A Modern Approach with T Continuous Improvement Techniques...... 60 The Pocket Guide to the Baldrige Award Criteria (5-Pack), Technical Analysis of Stock Trends, Tenth Edition...... 13 17th Edition...... 68 Web Security: A WhiteHat Perspective...... 56 Techniques and Sample Outputs...... 31 The Portable PMP® Exam Prep: Conversations on Passing What Every Engineer Should Know About Cyber Security Terrorist Recognition Handbook: A Practitioner’s Manual for the PMP® Exam, Fourth Edition...... 44 and Digital Forensics...... 4 Predicting and Identifying Terrorist Activities, Third Edition...... 55 The Power of Ideas to Transform Healthcare: Engaging Staff Workplace Safety and Health: Assessing Current Practices and The “Success or Die” Ultimatum: Saving Companies with by Building Daily Lean Management Systems...... 23 Promoting Change in the Profession...... 26 Blended, Long-Term Improvement Formulas...... 26 The Practical Guide to HIPAA Privacy and Security Compliance, Workplace Violence and the Facility Manager...... 56 The 12 Principles of Manufacturing Excellence: A Leader’s Second Edition...... 16 Zero Quality Control: Source Inspection and the Poka-Yoke System...60 Guide to Achieving and Sustaining Excellence...... 27 The Practice of International Development...... 109 The 21st Century Meeting and Event Technologies: The Private Sector’s Role in Disasters: Leveraging the Powerful Tools for Better Planning, Marketing, and Evaluation...... 24 Private Sector in Emergency Management...... 101 The A3 Workbook: Unlock Your Problem-Solving Mind...... 27 The Process Mind: New Thoughtware® for Designing The Analysis of Time Series: An Introduction, Sixth Edition...... 32 Your Business on Purpose...... 64
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 A Biringer; Betty...... 97 Crandall; William R...... 76, 95 Bissell; Rick...... 101 Crane, MD, MBA; Jody...... 17 Ababio; Ernest Peprah ...... 115 Blair; John P...... 50 Craveiro; Flávio...... 77 Adams; Robert ...... 18 Blank; Ronald...... 60 Crawford; J. Kent...... 46, 48 Adibi; Sasan...... 22 Bloch; Heinz P...... 73 Crépey; Stéphane...... 33 Agre; Jonathan Russell...... 97 Bloom; Daniel...... 62 Cretu; Liviu Gabriel...... 3, 4 Agustiady; Tina...... 41 Bloom; Richard...... 52 Crosby; Barbara C...... 102 Ahlqvist; Ola...... 109 Bloomberg; Laura...... 102 Cross; Barry L...... 9, 10 Ahmed; Ashfaque...... 4 Bluhm; Christian...... 34 Crowe; Adam...... 100 Ahmed; Syed M...... 82 Bojeun; Mark C...... 45 Crowther; Samuel...... 28 Akerkar; Rajendra...... 3 Bologna, MBA; James S...... 23 Crump; Justin...... 50 Al-Ahmari; Abdulrahman M...... 80 Bone; Mary Alice...... 76 Cruz; Rui M. S...... 88 Alberts; David S...... 97 Boothroyd; Geoffrey...... 77 Cudney; Elizabeth A...... 87 Albrecht; James F...... 100 Borris; Daniel...... 26 Curlee; Wanda...... 48 Alesch; Daniel J...... 100 Borris; Steven...... 26 Curley; Michael...... 12 Aliaga; Jesus M. Rios...... 32 Boshnakova; Dessislava...... 24 Curnutt; John R...... 50 Aliyev; A. G...... 33 Bossomaier; Terry...... 118 Almanza; Barbara...... 24 Botterill; Linda Courtenay...... 108 D Almeida; Henrique Amorim...... 77 Bourne; Lynda...... 43 D. Erickson; Gregory...... 17 Alston; Frances...... 81 Boziaris; Ioannis S...... 89 da Silva; Neusely...... 88 Alvarez; Ricardo A...... 99 Brambley, Ph.D.; Michael R...... 70 Daamen; Winnie...... 110 Alves; Nuno Manuel Fernandes...... 77 Bregman; Susan...... 92 Dale; W. Mark...... 7 Amasaka; Kakuro...... 68 Brigo; Damiano...... 33 D’Ambrogio; Andrea...... 75 Anderson; David M...... 65 Brodsky; Jacob...... 99 Damelio; Robert...... 17 Anderson; Kerry Ann...... 52 Brohman; M. Kathryn...... 10 Dar; Eazaz A...... 103 Anderson; Mark J...... 58, 79 Brooks; Talbot J...... 99 Das; Aiedeo Mintie...... 113, 114 Anderson; Norman A...... 72 Brotby; W. Krag...... 54 Das; Dilip K...... 100, 105, 107, 112, 113, 114, 116 Andreasson; Kim ...... 112 Brown; Mark Graham...... 67, 68 Das; Rabindra Nath...... 91 Andriole; Stephen J...... 10 Brumfield; Ken J...... 7 Das; Subrata...... 6 Appel; Edward J...... 25 Bryant; James J...... 26 Davis; David Howard...... 111 Arendt; Lucy A...... 100 Bryant; James William...... 5 Davis; Richard A...... 34 Ares; Gastón...... 89 Author Index Bryson; John M...... 102 Davison; Matt...... 36 Arvanitoyannis; Ioannis Sotirios...... 83 Bucero,MSc,PMP, PMI-RMP, PMI F; Alfonso...... 42 de Guzman; Melchor C...... 113 Arvonio; David R...... 65 Budris; Allan R...... 73 De Silva; Titus...... 13 Arway; Arthur G...... 96 Buisson; Christine...... 110 Dean; Dr Angela...... 75 Atesmen; M. Kemal...... 45 Buka; Paul...... 117 DeBell; Diane...... 117 Atlas; Randall I...... 50 Bunting; William J...... 4 DeFranco; Joanna F...... 4, 40 Aubry; Monique...... 46 Burge; Ryan...... 8, 18 Dekker; Sidney...... 23 Austin; Robert F...... 99 Burnell; Beverly A...... 106 Delaney; Joseph...... 41 Axis; Communications...... 53 Burns; David...... 50 Deller; Steven C...... 105 Ayers; James B...... 93 Burns; Maria G...... 53, 109 Dempster; M. A. H...... 32 Ayyub; Bilal M...... 36, 37 Buss; Terry F...... 116 den Heyer; Garth...... 112 Azimi; Maryam...... 80 C Denker; Stephen...... 66 B Dennis; Pascal...... 56, 57 Cady; Anne ...... 4 Devaux; Stephen A...... 43 Badiru; Adedeji B...... 46, 75 Camp; Robert B...... 64 Dewhurst; Peter...... 77 Baggaley; Bruce...... 40 Camp; Robert B...... 65 Dey; Kieron...... 84 Bai; Jamuna A...... 88 Campbell; John D...... 69 Dhillon; B.S...... 84 Baines; Richard...... 87 Campolieti; Giuseppe ...... 33 Dibeehi; Qaalfa...... 17 Baird; Robert...... 28 Canbolat; Yavuz Burak...... 79 Dietrich; David...... 87 Baker, Jr.; William H...... 63 Canty; Denise...... 40 Dillon; Andrew P...... 58, 69 Baker; Bruce...... 116 Capehart, Ph.D., C.E.M.; Barney L...... 70 Dinero; Donald...... 59 Baker; Bruce F...... 107 Caraballo; Vinny ...... 6, 7 Dingle; Jeffrey...... 54 Baldwin; Clifton...... 76 Carayon; Pascale...... 86 Dinkin; Steven...... 25 123 Balköse; Devrim...... 75 Carmichael; David G...... 44 DiSera; David P...... 99 Ballard, MD, PhD, MSPH, FACP; David J...... 17, 18 Carr; B. Thomas...... 91 Dishongh; Rhonda...... 17 Balzer; William K...... 61 Carroll; Charles T...... 26 do Nascimento; Maristela da Silva...... 88 Bandyopadhyay; Susmita...... 78 Carstens; Deborah Sater...... 46 Donchin; Yoel...... 83 Banks; David L...... 32 Cassady; C. Richard...... 79 Doro-on; Anna M...... 110 Barclay; Corlane...... 63 Castro e Costa; Eduardo...... 77 Doss; Daniel Adrian...... 56, 103, 113 Barker; Ian C...... 73 Cepiku; Denita...... 107 Doty; Steve...... 71 Barker; Thomas B...... 90 Chandrasekaran; N...... 91 Douc; Randal...... 35 Barsalou; Matthew A...... 58 Chang; Yoon Seok...... 92 Dow; Martha Christine...... 100 Bartolo; Helena ...... 77 Charpentier; Arthur...... 32 Drabek; Thomas E...... 101 Bartolo; Paulo Jorge Da Silva...... 77 Charron; Rich...... 5, 10 Dreckshage; Brian J...... 94 Bassetti; W.H.C...... 13 Chatfield; Chris...... 32 Duarte; José Pinto...... 77 Bates; Marcia J...... 118 Chaudhuri; Arijit...... 35 Duggan; Kevin J...... 60, 61, 69 Baudin; Michel...... 94 Chelst; Kenneth...... 79 Dumitriu; Florin...... 4 Bauer; Jeffrey C...... 11, 22 Chen; Charlie C...... 95 Durante; Fabrizio...... 36 Baugh; Amy...... 48 Chera; Bhishamjit ...... 18 Durão; Lina...... 77 Beaver; Kevin...... 16 Childs; Tom...... 74 Beck CEM, CLP; Gene...... 12 Christopher; Kenneth...... 54 E/F Becker; Wendy S...... 7 Chuin; Lau Hoong...... 9 Edelbacher; Maximilian...... 111 Bell; Steven C...... 61 Cimasi; Robert James...... 13 Edwards; Frances L...... 108 Bell; Steven C...... 62 Cimorelli; Stephen...... 94 Edwards; Robert D...... 13 Benny; Daniel J...... 52 Civille; Gail Vance...... 91 Egan Jr.; Stephen D...... 43 Bercaw; Ronald G...... 21 Cloutier; Robert...... 76 Erdem; Arzum...... 89 Berlin; Alexandr A...... 84 Cockfield; Geoff...... 108 Errasti; Ander ...... 81 Berman; Evan...... 104, 106 Coleman, Sr.; Lance B...... 60 Eterno; John A...... 114, 115 Bhattacharya; Ranjan...... 78 Companion; Michele...... 98 Evans; Douglas ...... 76, 77 Bhise; Vivek D...... 84 Condrey; Stephen E...... 104 Fagel; Michael J...... 101 Bhunia; Arun...... 86 Cont; Rama...... 34 Faggiano; Vincent ...... 97 Bichai; Joe...... 74 Conteh; Charles...... 102 Farazmand; Ali...... 101, 102 Bidanda; Bopaya...... 93 Cook; Thomas A...... 92, 95 Fast; Larry E...... 27 Bielecki; Tomasz R...... 33 Cramer; Michael M...... 85 Felbur; Marek...... 61 Bingham; Derek...... 75 Crandall; Richard E...... 76, 95
For more information and a complete list of titles, visit us at www.crcpress.com Feng; Yaoyu...... 83 Hagood; Charles...... 21 Jordan; James F...... 9 Fenton; Norman ...... 37 Haksöz; Çagˇrı...... 96 Jordan-Meier; Jane...... 113 Ferguson; Daniel L...... 60 Halmos; George T...... 78 Joshi; Maulik...... 20 Ferraro (CPP, SPHR); Eugene F...... 53 Hamilton; Jerome...... 30 Joswik; Roman...... 84 Ferraro; Eugene F...... 53 Handfield; Robert...... 95 Junqueira; Valéria Christina...... 88 Ferraro; Jack...... 48 Hansman; Grant...... 86 Ferreira; Telma...... 77 Harbour; Jerry L...... 39, 64 K Filinkov; Alexei...... 38 Hardoon; David Roi...... 8 Kajzar; François...... 75 Filner; Barbara...... 25 Harrington; H. James...... 5, 10, 28, 30, 31 Kale; Vivek...... 8, 9 Fischer; Bryan R...... 72 Harris; Chris...... 92 Kalyvas; James R...... 5 Fischer; Frank...... 114 Harris; G.L.A...... 114 Kaminskiy; Mark...... 90 Fisher; Paul D...... 39 Harris; Rick...... 92 Kamrani; Ali K...... 80 Floyd; Raymond C...... 82 Haruna; Peter Fuseini...... 107 Kaneda; Mitsugu...... 68 Flynn; Barbara B...... 93 Haslegrave; Christine M...... 70 Kang; Meng-Chow...... 54 Forbes; Lincoln H...... 82 Haugan; Gregory T...... 48 Kantarci; Kemal...... 25 Ford; Henry...... 28 Hayette; Gatfaoui...... 35 Kantola; Jussi ...... 80 Forrest; Jeffrey Yi-Lin...... 12 Helander; Martin...... 79 Kara; Bahar Y...... 93 Fothergill; Alice...... 101 Henry-Labordere; Pierre...... 35 Karlyn; Matthew A...... 8 Franchetti; Matthew John...... 87 Hepner; George F...... 116 Karwowski; Waldemar...... 80 Frankowicz; Marek...... 80 Heragu; Sunderesh S...... 71 Katko; Nicholas S...... 39 Freyss; Siegrun Fox...... 104 Hermida; Julian...... 106 Kearney; Richard C...... 103 Author Index Fullerton; Rosemary...... 39 Herold; Rebecca...... 16, 51 Keilson; Jerrold...... 109 Furterer; Sandra...... 87 Herr; Karsten...... 68 Kelly; William N...... 14 Fwa; Tien Fang...... 97 Hertico; Hope Rachel ...... 15 Kennedy; Frances...... 39 Hertzog; Christine...... 51 G Kenney; Charles ...... 16 Heselton, PE; Kenneth E...... 70 Kenney; Charles ...... 23 Gabow; Patricia A...... 21 Hesterman; Jennifer L...... 55 Kerber; Bill...... 94 Galar Pascual; Diego...... 83 Hetico; Hope Rachel...... 15 Kerpchar; Joyce ...... 21, 22, 64 Hill; Gerard M...... 41 Gandhi; S. Jimmy...... 3 Kesterson; Randy K...... 27 Hillson; David...... 41 Garabelli; Claudia Birkenshaw...... 16 Keyte; Beau...... 60 Hinckley; C. Martin...... 59 Garcia; Rosanna...... 49 Khan; Mahmood A...... 24, 25 Hines; Peter...... 71 Garten BV; Frank...... 9 Khan; Muhammad Ehsan...... 44 Hinson; Gary...... 54 Garza-Reyes; Jose Arturo...... 67 Khmaladze; Estáte V...... 38 Hirano; Hiroyuki...... 66, 67 Gerston; Larry N...... 105 Khmelinskii; Igor...... 88 Hirotomi Taniwaki; Marta...... 88 Geunes; Joseph...... 79 Khurana; Vijay Kumar...... 73 Hirsa; Ali ...... 33 Ghanem; Waddah...... 76 Kiefer, Ph.D.; John J...... 101 Hoeft; Steven E...... 23 Ghernaouti-Helie; Solange...... 102 Kiefer; John J...... 100 Hoffman; Kenneth C...... 4 Ghiselli; Richard...... 24 Kijima; Masaaki...... 38 Hogan; Michael...... 20 Giachetti; Ronald E...... 41 Kimbrough; Steven Orla...... 9 Holan; Scott H...... 34 Gianni; Daniele...... 75 Kimura; Yoshifumi...... 68 Hong; Paul...... 5 Gillespie; Sean A...... 49 King; Gundar J...... 109 Hoogendoorn; Serge P...... 110 Gillespie; Thomas T...... 97 King; Jennifer S...... 30, 69 Hopkins, PhD; David...... 88 Girod; Robert J...... 115 King; Peter L...... 30, 69 Hopper; Anthony Matthew...... 15 Glazner; Christopher G...... 4 Kirby; Philip...... 64 Horak; Daniel...... 75 Glenday; Ian Fraser...... 94 Kliem; Ralph L...... 40, 41 Howard; Eric William...... 103 Glover, Jr.; William H...... 113 Klingner; Donald E...... 116 Howard; Patrick D...... 51 Goldberg; Rebecca...... 57 Knight; Winston A...... 77 Howell; Marvin T...... 31 Goldblatt; Joe...... 24 Kobayashi; Iwao...... 27 Hua; Ronald H...... 36 Goncharov; Dmitry...... 104 Koenigsaecker; George...... 29 Huang; Samuel H...... 96 Gonzalez-Rivas; George...... 61 Koike; Takeshi...... 98 Hui; Y. H...... 89 Koliba; Christopher...... 107 Goodman; Philip L...... 21 Hunt; Brian...... 103 Goodrich; Daniel C...... 108 Koven; Steven G...... 104 Hurley; Martha Henderson...... 116 Kratcoski; Peter C...... 111 Goonetilleke; Ravindra S...... 80 Husby; Paul C...... 30 124 Gopher; Daniel...... 83 Krider; Robert E...... 6 Hutzel; Tim...... 5 Krippendorff; Klaus...... 81 Gordon; Gerald L...... 112 Krishnamoorthi; K.S...... 84 Gordon; Robert Lee...... 48 I/J Krishnamoorthi; V. Ram...... 84 Gordon; Victoria...... 115 Imam; Amna...... 103 Krivtsov; Vasiliy...... 90 Gorman; Michael E...... 118 Immordino; Kathleen M...... 107 Kudyba; Stephan P...... 14 Gorod; Alex...... 3 Ireland; Vernon...... 3 Kull, PhD; Thomas J...... 64 Gortych; Joseph E...... 6 Islam; Shafiqul ...... 37 Kumar; Shrawan...... 81 Gotoh; Fumio...... 67 Ivanovich; Vatin Nikolai...... 84 Kumar; Vikas...... 67 Gould; Laurie A...... 115 Ivergard; Toni...... 103 Kunio; Shirose...... 68 Goza; Rebecca A...... 113 Ivers; Louise...... 113 Graban; Mark...... 18, 19, 21 Jaccard; Michel...... 89 L Grasso; Larry...... 40 Jackson; Thomas L...... 16, 17, 29, 22, 23, 28 Graupp; Patrick...... 18, 59, 73, 74 La Penna; A. Michael...... 15 Jacobson; Ralph...... 67 Graves; Melissa...... 53 Laguna; Manuel...... 78 Jakhotiya; Girish P...... 31 Green; Allen R...... 42 Lai; Tze Leung...... 31 Jakobsen; Gitte...... 73 Greenberg; Martin Alan...... 97 Land; Michael...... 26, 55 Janevska; Kalina...... 17 Grounds; Patrick...... 64 Landoll; Douglas...... 55 Japan Institute of Plant Maintenance...... 69 Grunden; Naida...... 21 Lane; Greg...... 68 Jardine; Andrew K.S...... 87 Grunden; Naida...... 23 Langford; Gary O...... 3 Jauhari; Vinnie...... 24 Gubser; Michael...... 109 Laplante; Philip A...... 40 Jeffries; Howard...... 20 Guillén; Mauro F...... 73 Larson; Jean Ann...... 19, 22 Jekiel; Cheryl M...... 61 Guiora; Amos N...... 54 Larsson; Linus...... 61 Jensen, III; Carl J...... 53 Latino; Kenneth C...... 91 Gupta; Aparna...... 37 Jensen; Marc ...... 62 Latino; Mark A...... 91 Gupta; Surendra M...... 82, 95 Jerolleman; Alessandra...... 100, 101 Latino; Robert J...... 91 Gupta; Sushil...... 76 Jesuit; David K...... 107 Laur; John K...... 20 Gustin; Joseph F...... 51, 56 Jimmerson; Cindy...... 16, 24 Lavena; Cecilia...... 107 Guyon; Julien...... 35 Joe; Harry...... 33 Lawler; Gregory F...... 34, 35 Johnson; Ross...... 50 H Le; Sebastien...... 83 Johnston; Ian Ronald...... 103 Lee; Kyuho...... 25 Hadzikadic; Mirsad...... 117 Jones; Don W...... 56, 103 Lee; Margaret R...... 42 Hafey; Robert...... 74 Jones; Erick...... 90 Lee; Seungwon “Shawn”...... 24 Hagan; Pat...... 20 Jones; Roger F...... 11
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Leflar; James J...... 100 Medina; Richard M...... 116 Pain; Simon Watson...... 91 Lehmann; Harold...... 13 Meek; Jack W...... 107 Palazoglu; Ahmet...... 77 Lelei; Macrina...... 116 Mehta; D. Paul...... 71 Paley; Norton...... 27, 28 Lemieux; Frederic...... 112 Meier; Patrick...... 108 Pardo; Scott...... 84 Lemos; Ana Cristina Soares...... 77 Melnikova; Irina V...... 38 Park; YoungWon...... 5 LeSage; James...... 34 Mena; Jesus...... 49 Parker; Frederick...... 66 Lesser; R. Bick...... 29 Mignosa; Chuck...... 10, 31 Parodi; Pietro...... 36 Levin, PMP, PgMP; Ginger...... 43, 44 Mijatovic; Aleksandar ...... 39 Parsa; H. G...... 25 Levin; Ginger...... 42, 43, 44 Milivojevich; Andrija...... 90 Pasco; Gregory A...... 11 Levine; E. S...... 78 Miller; Gerald J...... 114 Patchong; Alain...... 57 Levinson; William A...... 28 Mills; Brian M...... 11 Pate; Stephen Matthew...... 115 Lewandowski; Christopher...... 64 Minto-Coy; Indianna D...... 104 Paterson; Robert Russell Monteith ...... 88 Lewandowski; Roger G...... 27 Mital; Anil...... 81 Pearce; Eli M...... 75 Lewis; Robert...... 28 Modarres; Mohammad...... 90, 91 Pelagatti; Matteo Maria...... 32 Lewis; William E...... 47 Monden; Yasuhiro...... 59 Pelphrey; Michael W...... 3 Liebert; Saltanat...... 104 Moreno Espinosa; Roberto...... 116 Penkar; Samir...... 42 Liebowitz; Jay...... 5, 6 Morgan; James...... 65 Pennathur; Arunkumar...... 81 Lievre; Pascal ...... 46 Morland; Kimberly B...... 114 Perdikaris; John...... 100 Liker; Jeffrey K...... 65 Morris; Max...... 75 Petersen; J.K...... 52 Lillrank; Paul...... 19 Moss; Charles B...... 35 Peterson; Andrew M...... 14 Lin; Ge...... 117 Moulines; Eric...... 35 Pham; Andrew...... 7 Lin; Hui...... 110 Moustafaev; Jamal...... 47 Pham; David K...... 7 Lindström; Erik...... 38 Muir; Carlyn...... 103 Pham; Tiffany...... 7 Lippert; Dave...... 5 Mukbaniani; Omari V...... 75 Pheasant; Stephen...... 70 Liu; Dahai...... 76 Mullen; Samuel...... 98 Phillips; Brenda D...... 98, 99, 101 Lixin; Tao ...... 12 Muller, M.D.; Robert J...... 99 Picard; Louis A...... 116 Locher; Drew...... 60, 62 Mulligan; Perry...... 64 Pine; John C...... 99 Lokman; Anitawati Mohd...... 80 Mundt; Barry M...... 43 Pistorius; Martijn...... 39 Longford; Nicholas T...... 38 Murer; Cherilyn G...... 15 Plecas; Darryl...... 100 Lopez; Orlando...... 14 Murugesan; San...... 4 Plenert; Gerhard J...... 96 Lovekamp; William E...... 101 Plsek; Paul E...... 16 Lovins; Hunter...... 71 N Pochampally; Kishore K...... 82 Author Index Lowe; David...... 113, 116 Nachlas; Joel A...... 79 Poling; Sheila R...... 70 Lowther; Adam B...... 50, 111 Naff; Katherine C...... 104 Popovic; Kevin...... 49 Lubliner; David J...... 14 Nagamachi; Mitsuo...... 80 Possamai; Mario...... 52 Lund; Robert ...... 34 Nalla; Mahesh K...... 111 Prado; Raquel...... 39 Lutchman; Chitram...... 76, 77 Nambiar; Arun N...... 78 Prescott; Beryl K...... 7 Luyster; Tom...... 70 Nance; Malcolm W...... 55 Pritchard, PMP, PMI-RMP, EVP; Carl L...... 47 Lyngso; Soren...... 75 Narapareddy; Vijaya (Vi)...... 25 Pritchard; Carl L...... 11, 44 Privault; Nicolas...... 38 M Nash; Mark A...... 70 Neal; David M...... 99 Productivity Press Development Team...... 56,58, 59, 63,74. 81, 94 Maack; Mary Niles...... 118 Neil; Martin...... 37 Protzman; Charles...... 21, 22, 64 Macaulay; Tyson...... 51 Neill; Colin J...... 40 Pryor; Robert W...... 23 Macintosh; Michael...... 117 Neiva de Figueiredo; Joao...... 73 Przybylski, PhD; Wieslaw...... 88 Madinger; John...... 12 Neves; João Paulouro...... 77 Pullarcot; Sunil ...... 82 Madsen; Henrik...... 38 Newbold; Stephanie...... 105 Purrier; Martha...... 18 Magee; John...... 13 Newman; Graeme R...... 111 Putler; Daniel S...... 6 Magnini; Vincent P...... 25 Newslow; Debby...... 85 Q/R Maharaj; Rohanie ...... 76, 77 Nicholas; John...... 29 Maher; Craig S...... 105 Nichols; Terry...... 50 Qian; Edward E...... 36 Maier; Mark W...... 40 Niederstadt; Joseph...... 29, 66 Qiu; Peihua...... 87 Majerus; Norbert...... 65 Niehus; Terry...... 71 Qu; Ming...... 117 Makarov; Roman N...... 33 Nielsen; Jan Nygaard...... 38 Quaresma; Filipe...... 77 Mallach; Efrem G...... 9 Nikkan Kogyo Shimbun...... 59 Racino; Julie Ann...... 104 125 Mann; David...... 63 Nikoleli; Georgia-Paraskevi...... 89 Radvanovsky; Robert...... 97, 99 Manning, Ph.D, CFE, EA; George A...... 12 Nikolelis; Dimitrios P...... 89 Raghuram; G...... 91 Maras; Marie-Helen...... 51 Nikravesh; Seyed Kamaleddin Yadavar...... 88 Rai; V Ravishankar...... 88 Marcinko; David Edward...... 15 Nilsson; Fredrik...... 53 Ramakrishnan; Sreekanth...... 49 Marconi; Katherine...... 13 Nollet; Leo M.L...... 85, 86 Ramanayya; T.V...... 110 Marek; Tadeusz...... 80 Noon, PHD; Chuck...... 17 Ramos; Carina...... 77 Mareschal; Patrice M...... 103 Ratner; Bruce...... 49 Marklund; Johan ...... 78 O Ravindran; A. Ravi...... 96 Markovitz; Daniel ...... 66 Obenchain; Janel...... 113 Ravishanker; Nalini...... 34 Marks; Lawrence...... 18 Oberle; Tim...... 77 Ray; Bibek...... 86 Marlin; Marguerite...... 102, 103 O’Donohue, PHD; William...... 15 Reis; Igor...... 77 Marschdorf; Hans J...... 52 Offermann, CEM, CFM, MBIFM; Scott...... 71 Relyea; Douglas B...... 58 Martin; Karen...... 62, 63 O’Hanley; Rich...... 52 Remillard; Bruno...... 37 Martinez; J. Michael...... 111 Ohno; Taiichi...... 58 Reyes-Picknell; James V...... 69 Maser; Chris...... 109 Omachonu; Vincent K...... 90 Reynolds; Kenneth Michael...... 105 Maskell; Brian H...... 40 Ono; Takehiko...... 98 Riccetti; Sauro...... 92 Mateus; Artur Jorge...... 77 Opp; Susan M...... 109 Riccucci; Norma M...... 104 Matthews; Daniel D...... 27 Oppenheim; Bohdan W...... 61 Richardson; Gary L...... 46 Maxwell; Lisa...... 25 Orr; Shannon K...... 112 Richie; Gregg D...... 40 Mayzell, MD, MBA, FACP; George...... 21, 22 Orzen; Michael A...... 61 Richins; Suzanne...... 24 Mazur; Lukasz...... 18 Osarenren; John...... 86 Richins; Suzanne Moss...... 13, 19 McCarthy; Charles Christopher...... 45 Osei-Bryson; Kweku-Muata...... 63 Ricks; Bobby...... 54, 55 McCuen; Richard H...... 36 Osgood, Jr.; Jeffery L...... 109 Ricks; Truett...... 54, 55 McDougall; Allan...... 97 Osisanya; Samuel O...... 46 Rios Insua; David...... 32 McElreath; David H...... 53, 103 Osterling; Mike...... 62, 63 Roberge; Ian...... 102 McGuire; Chad J...... 108, 112 Overbeck; Ludger...... 34 Roberge; Ian...... 107 McLaughlin; Greg...... 6, 7, 24 Overly; Michael R...... 5, 8 Roberson; Cliff...... 105, 106 McLean; Timothy ...... 74 Robinson, MS; Anthony ...... 72 McNabb; David E...... 109, 115 P Rocha-Lona; Luis...... 67 McNall; John...... 97 Rogers; Marcus K...... 51 McVay; Gloria...... 39 Pace; Robert Kelley...... 34 Rolfes; Kenneth...... 63 Mead; William J...... 85 Packowski; Josef...... 95 Romagnoli; Jose A...... 77
For more information and a complete list of titles, visit us at www.crcpress.com Romaniuk; Scott Nicholas...... 102, 103 Stoffer; David ...... 35 Ward; J. LeRoy...... 43, 44 Romeiro Gomes; Renato Abeilar ...... 88 Story, MPHM; Pierce...... 18 Warren; Drake ...... 97 Rona Consulting Group...... 20 Street; Anita...... 118 Warsing, Jr.; Donald P...... 96 Roncalli; Thierry...... 34 Stufken; John...... 75 Waters; T F...... 77 Roper; Carl...... 55 Su; Chao-Ton...... 90 Watkins; Kari Edison...... 92 Rosenbloom; David H...... 105 Subramanian; Satish P...... 48 Webb; Gary...... 99 Rosentraub; Mark S...... 11, 110 Sule; Dileep R...... 78 Weinzimer; Philip ...... 11 Roseta; Filipa...... 77 Sumrall III; William H...... 56, 103 Weiss; Elliott N...... 57 Ross; David Frederick...... 94 Sun; Bao-Guo...... 85 Wellman; Joan...... 20 Ross; Joel E...... 90 Suri; Rajan...... 29 Wendel, PHD; Jeanne...... 15 Rotar; Vladimir I...... 32 Suri; Rajan...... 30 Weng; Qihao...... 110 Roth; William F...... 10 Suzuki; Tokutaro...... 69 Wertz; Keith...... 26 Royer, PMP; Paul S...... 45 Swan; Wallace...... 114 Wessels; William R...... 82 Rubin; Claire B...... 98 Swanson; Barry G...... 86 West; Michael...... 66 Rubin; Marilyn Marks...... 105 Swartz; Joseph E...... 18, 19 West; Mike...... 39 Rumane; Abdul Razzak...... 90 Swishchuk; Anatoliy ...... 37 Whitcomb; Patrick J...... 79 Ryan; Una...... 83 Szycher, Ph.D; Michael...... 8 White; Brian E...... 3 White; Peter...... 86 S T Whiton; Fred...... 64 Sabharwal; Meghna...... 106 Tajiri; Masaji...... 67 Wiggin; Hal...... 5 Sabuncuoglu; Ihsan...... 93 Tang; Ke...... 32 Wigginton, Jr.; Michael...... 113 Author Index Sabuwala; Adnar H...... 78 Taniguchi; Eiichi...... 92, 97 Williams; Barry L...... 4 Sachs; Neville W...... 73 Taninecz; George...... 65 Willoughby; Katherine G...... 105 Sampietro; Marco...... 42 Tankov; Peter...... 34 Wills; Kerry R...... 40 Sancton; Andrew...... 102 Taplin, Jr., P.E.; Harry R...... 70 Wincel; Jeffrey P...... 64 Sangwan; Raghvinder S...... 47 Tapping; Don...... 62, 70 Winfree; Jason A...... 11 Sather; Rick...... 94 Templeman; Bill...... 29 Wingate; Lory Mitchell...... 46 Sauser; Brian...... 3 Testani, Sr.; Michael V...... 49 Winterdyk; John A...... 114 Savage; Nora...... 118 Thomas; Deborah S.K...... 101 Wojcik; Leonard A...... 4 Schlegel; Gregory L...... 96 Thomas; Willis H...... 56, 65 Wood; Andy...... 71 Schlogl; Erik...... 36 Thompson; Russell G...... 92, 97 Worch; Thierry...... 83 Schmidt; Diane...... 118 Thumann; Albert...... 71 Wright; Adam...... 13 Schnackenberg; Heidi...... 106 Tiller; James S...... 52 Wrona; Robert J...... 59, 74 Schneid; Thomas D...... 26 Timmerman; Jos G...... 108 Wu; Hanqing...... 56 Schneider; Stephen...... 112 Tkalcevich; Steve...... 47 Wu; Linhai...... 85 Schultz; John Roland...... 7 Tobias; Paul A...... 83 Wu; Teresa...... 3 Schwartz; Zvi...... 24 Todd; Maria K...... 14 Wyzalek, PfMP; John...... 44 Seddon; John...... 28 Tokuşoğlu; Özlem...... 86 X/Y/Z Sempi; Carlo...... 36 Toldra; Fidel...... 85, 86 Semukhina; Olga B...... 105 Tolk; Andreas...... 75 Xiao; Lihua...... 83 Serrador; Pedro...... 47 Tomaszewski; Brian...... 98 Xing; Haipeng...... 31 Serratt, PHD, RN; Teresa D...... 15 Tracy; Paul E...... 108 Xu; Li Da...... 7 Seybolt; Taylor B...... 116 Trent; Robert J...... 96 Yamane; Yasuo...... 74 Sgroi, Jr.; Anthony...... 63 Triantis; John E...... 10 Yannakogeorgos; Panayotis A...... 50 Sgroi, Jr.; Anthony...... 80 Trindade; David...... 83 Ye; Nong...... 3 Sharma; Ramesh...... 77 Trusko; Brett...... 30 Yoe; Charles ...... 89 Sharma; Sanjay...... 82 Tryon, Jr.; Charles A...... 45 Youngblood; James R...... 50 Shin; Dong-Chun...... 117 Tsang; Albert H.C...... 87 Younger; William J...... 71 Shingo; Shigeo...... 58, 60, 68 Tshombe; Lukamba-Muhiya...... 115 Youngman; Paul A...... 117 Shirley; David...... 45 Tsuzuki; Takuya...... 10 Yu; Liangli (Lucy)...... 85 Shmueli; Galit...... 8 Tummala, Ph.D; Krishna K...... 104 Zandin; K. B...... 72 Shtein; Max...... 31 Turk; Austin T...... 113 Zgaga; Pavel...... 80 Shteyn; Eugene...... 31 Turner; Wayne C...... 71 Zhang; Hongsheng...... 110 126 Shuker; Tom...... 62 Turovskij; Nikolai A...... 75 Zhang; Yahong...... 107 Shuker; Tom...... 70 Tweedy; James T...... 19 Zhang; Yuanzhi...... 110 Siegel; Marc H...... 100 Tynan; Katy...... 8 Zhao; Liz...... 56 Siepmann; Frank...... 53 Zhao; Xiande...... 93 Sikka; Rishi...... 20 U/V Zhenming; Chen...... 102 Silberstein, M.A.; Jane...... 109 Underwood; Sally...... 117 Zhu; Dian...... 85 Sillivant; Daniel...... 82 Upadrista; Venkatesh...... 49 Zia; Asim...... 107 Silveira; Neliane...... 88 Uysal; Muzaffer...... 24 Ziaee, MA, MSE, PhD, FHIMSS; Reza...... 23 Silverii, PhD; L. Scott...... 111 Uysal; Muzaffer...... 25 Zokaei; Keivan...... 71 Sinay; Juraj...... 76 Valcik; Nicolas A...... 108 Zurn; James...... 64 Singer; Bryan L...... 51 Varela; Paula...... 89 Singh; Amitoj...... 80 Varzakas; Theodoros ...... 89 Singh; Vijai Kumar...... 19 Vassiliou; Marius S...... 97 Smalley; Art...... 31 Vecer; Jan ...... 37 Smith; Francis J...... 43 Vellema; John...... 73 Smith; Ronald B...... 46 Verma; Ashish...... 110 Sobek II.; Durward K...... 31 Vieira; Margarida...... 88 Šoltés; Ladislav...... 75 Villa; Tiziano...... 42 Soon; Jan Mei...... 87 Villafiorita; Adolfo...... 42 Sorensen; Eric H...... 36 Voehl; Christopher F...... 30 Spark; Arlene...... 113 Voehl; Frank...... 5, 10, 30 Speight; James...... 106 Vugrin; Eric...... 97 Spencer; Neil H...... 33 Vyas-Doorgapersad; Shikha ...... 107, 115 Spencer; Tanya...... 54 Sridhar; Divya Srinivasan...... 17, 19 W Srinivasan Sridhar; Divya...... 14 Stamatis; D. H...... 87 Wagner; Christoph...... 34 Stamler; Rodney T...... 52 Walerczyk, CLEP, HCLP, LC; Stan...... 72 Stapleton; J.J...... 55 Wan; Margaret...... 26 Starnes; Becky J...... 106 Wang; Fahui...... 110 Starr; Martin...... 76 Wang; John X...... 81 Stenberg; Steve...... 64 Wang; Shuo...... 85 Stocker; Robert...... 118 Ward, PMP, PgMP; J. LeRoy...... 43, 44
www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 e-mail: [email protected] Fax: 561-361-6049 Tel: 561-998-2538 Susie Carlisle CRC PressTextbookSales [email protected] e-mail: Fax: 800-374-3401 Tel: 800-272-7737ext.6091 Customer Service/SalesOperations e-mail: [email protected] Fax: +18022236824 Tel: +18022236565 Montpelier, VT05602,USA 7 ClarendonAve,Suite2 Cranbury InternationalLLC Ethan E.Atkin(ExcludingBrazil) [email protected] e-mail: Fax: 561-361-6049 Tel: 561-998-2582 300, BocaRaton,FL33487,USA 6000 BrokenSoundParkway,NW,Suite & Francis Taylor Sales Office,BocaRaton,FL Michael Dulisse Mexico Central andSouthAmerica Angela Williams e-mail: [email protected] Fax: +44(0)2070176732 Tel: +44(0)2070176191 Jude Sermon UK SalesSupport e-mail: [email protected] Fax: +44(0)2070176732 Tel: +44(0)2070176273 Alfred Lea Corporate andInstitutionalSales e-mail: [email protected] Fax: +44(0)2070176732 Tel: +44(0)2070176132 Nick Perry Head ofUKSales e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176048 Graham Crossley International SalesDirector e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176194 Christoph Chesher Group SalesDirector
Outside theContinentalUSA- Within theContinentalUSA- e-mail: [email protected] Tel: +44(0)2033773656 International SalesSupportCoordinator David Mann Europe Enquiries e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176149 International SalesSupportCoordinator Hannah Dolton Japan andKoreaEnquiries e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176053 (Books) International SalesSupportManager Joanne Blackford International Enquiries e-mail: [email protected] Tel: +44(0)1235400524 Higher EducationSalesManager Tim Page Academic Representatives(UK) e-mail: [email protected] Tel: +44(0)70177365 Lindsey Binks UK SalesSupport e-mail: [email protected] AUSTRALIA Victoria Melbourne Level 2,11QueensRoad Taylor andFrancisBooks Australasia e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176187 Milton ParkSalesOffice Area SalesManager Jasmina Basic Caribbean andTheWestIndies 01415-000 –SãoPauloSP. Rua BelaCintra,967–11and. Tel: (11)3017-6941/97486-8236 [email protected] Renata Zanzini–DeptoComercial Taylor &FrancisGroupBrazil [email protected] e-mail: Fax: 561-361-6049 Tel: 561-998-2582 Michael Dulisse Latin AmericanSales [email protected] e-mail: Fax: 561-361-6049 Tel: 561-361-6010 Evelyn Elias Sales Director;LibraryMarket Milton ParkSalesOffice-Taylor&
6000 BrokenSoundParkway,NW,Suite300,BocaRaton,FL33487,U.S.A. 2 ParkSquare,MiltonPark,Abingdon,Oxon,OX144RN,UK Visit usonlineat In theAmericasSalesOffice-CRC Tel: 561-994-0555 • Fax: 561-361-6018 • [email protected] • 561-361-6018 Fax: • 561-994-0555 Tel: Tel: 800-272-7737 • Fax: 800-374-3401 • [email protected] • 800-374-3401 Fax: • 800-272-7737 Tel:
www.crcpress.com e-mail: [email protected] Adele Parker Foreign Rights [email protected] Tel: 8610–82503061 China Haidian District,Beijing100872,P.R. Zhongguancun St. Room 1108B,CultureSquare,No.59Jia, Taylor &FrancisGroup,BeijingOffice Senior Manager-AcademicPublishing Leo Li China LiaisonOffice e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176114 Coordinator International SeniorSalesSupport Adrian Riddock Enquiries South Asia,MiddleEastandAfrica e-mail: [email protected] Fax: 561-361-6049 Tel: 561-998-2539 Christina M.Taranto Subsidiary RightsSales [email protected] e-mail: Fax: (212)244-1563 Tel: (212)2167899 Sean Concannon Bookstores Website: http://www.ipsme.com e-mail: [email protected] Fax: +97142384005 Tel: +97142384001 Dubai, UAE P.O. Box27533 IPS (MiddleEast)Ltd Zoe Kaviani e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176187 Milton ParkSalesOffice Middle EastandSouthAfrica Area SalesManager– Jasmina Basic Middle EastandSouthAfrica Francis Group(BooksLtd)
Press e-mail (international):[email protected] e-mail (UK):[email protected] Fax: +44(0)1235400525 Tel: +44(0)1235400524 Abingdon, OxonOX144SE 130 ParkDrive,Milton Bookpoint Taylor &Francis Bookpoint: overseas agentortheCustomerServiceDepartmentat Book ordersshouldbeaddressedtotheappropriate Customer Services your areamanagerorCustomerServicesDepartment. have furtherinformationaboutthisservice,pleasecontact selective standingordersystem,orifyouwouldliketo If youwouldliketoreceivebooksonourimprovedpre- Standing Orders e-mail: [email protected] Fax: 561-998-2580 Tel: 561-998-2510 Dennis Weiss Senior VicePresidentofSales [email protected] e-mail: Fax: (212)244-1563 Tel: (212)2167899 Sean Concannon Premium/Custom Sales e-mail: [email protected] Fax: +44(0)1865517999 Tel: +44(0)1865553606 OX2 6TR Oxford Aristotle Lane Aristotle House Tula PublishingLtd Julian Russ South AfricaandBotswana) Sub-Saharan Africa(excluding e-mail: [email protected] Coordinator International SeniorSalesSupport Adrian Riddock Rest ofAfrica
127 Sales Agents Botswana East and Southeast Asia Malaysia and Brunei Spain, Portugal, Italy, and Greece Arthur Oageng For all Taylor & Francis Group imprints Taylor & Francis Publishing Services Philip Veysey Book Promotions/Horizon Books Botswana please order from our Singapore Sales Office Taylor & Francis Asia Pacific Area Sales Manager No. 23-2, Jalan PJS 8/18 Gaborone International Finance Park Singapore Sales Office Príncipe de Vergara 109, Plot 113-114, Unit 33, Kgale Mews 2, Suite 3 Dataran Mentari 28002 Madrid, Spain Taylor & Francis Asia Pacific 46150 Petaling Jaya Gaborone, Botswana 60 MacPherson Road Tel: +34 91 700 0688 Tel: +267 393 1194 Selangor Darul Ehsan Fax: +34 91 141 2304 Block 1 #06-09 Siemens Centre Malaysia Fax: +267 392 4908 Singapore 348615 Mobile: +34 68 777 3678 e-mail: [email protected] Tel: +60 (3) 5630 1361 e-mail: [email protected] Tel: +65 6508 2888 Fax: +60 (3) 5630 1732 South Africa, Namibia, Lesotho and Fax: +65 6742 9356 David Yeong Eastern Europe Swaziland e-mail: [email protected] General Manager Marek Lewinson Sales Agents Sales Agents Tracy Whitaker Hong Kong Mobile: +60 (0)16 331 9923 (Humanities and Social Sciences) Book Promotions/Horizon Books Taylor & Francis Asia Pacific e-mail: [email protected] Bohaterewicza 3/45 PO Box 6836 Suite 153, Somptueux Central Taiwan 03-982 Warsaw, Poland Roggebaai 52-54 Wellington Street Taylor & Francis Asia Pacific Tel/fax: +48 (0) 22 6714819 8012 Central Room 629, 6F, No. 6, Sec. 4, Hsinyi Road Mobile: +48 (0) 602 707 037 South Africa Hong Kong Da-an District e-mail: [email protected] Tel: +27 21 469 8900 Tel: +852 3752 0625 / 3752 0626 Taipei 106 Radek Janousek Fax: +27 21 469 8903 Jeffrey Lim Taiwan (R.O.C.) (Science and Technology) Fax2Email: 0865314387 Books Sales Director Jeffrey Lim Pod Nouzovem 972/21 e-mail: [email protected] Singapore Sales Office Books Sales Director 197 00 Prague, Czech Republic e-mail: [email protected] South Asia Singapore Sales Office Tel: +42 (0) 28 658 49888 Andrew Kwan e-mail: [email protected] Mobile: +42 (0) 602294014 Ryan Cooper Manager Jason Lin e-mail: [email protected] International Sales Manager e-mail: [email protected] Sales Manager Milton Park Sales Office China Tel: +886 (2) 5551 1266 ext. 6291 England and Wales Tel: +44 (0) 20 7017 6113 Taylor & Francis Asia Pacific e-mail: [email protected] Fax: +44 (0) 20 7017 6748 London and Eastern England Room 1108B, Culture Square e-mail: [email protected] Philippines, Vietnam and Indo-China No. 59 Jia, Zhongguancun St. James Whittle India Haidian District Jeffrey Lim Area Representative Books Sales Director Mobile: 07802 536233 Taylor & Francis Books India Pvt Ltd. Beijing 100872 P.R. China Singapore Sales Office e-mail: [email protected] 2nd & 3rd floor | The National Council of e-mail: [email protected] YMCAs of India Tel: +86 10 82502670 West Midlands, Southern England, 1, Jai Singh Road| New Delhi 110001| India Fax: +86 10 82502566 Israel and the Palestinian the South West and South Wales Jeffrey Lim Tel: +91 (11) 43155100 | 23712131|34|35 John Blake Books Sales Director Territories Fax: 91 (11) 23712132 Area Representative Singapore Sales Office Emily Legge e-mail: [email protected] Mobile: 07889 263 857 e-mail: [email protected] International Sales Executive Website: www.taylorandfrancis.com e-mail: [email protected] Cynthia Ji Milton Park Sales Office Pakistan Sales Manager Tel: +44 (0) 20 7017 3783 North and Northwest England, M. Anwer Iqbal e-mail: [email protected] e-mail: [email protected] East Midlands and North Wales Book Bird Shanghai Region Europe Lucy Pink 128 Mian Chambers, 3 Temple Road Area Representative PO Box 518, Lahore, Pakistan Chris Ye Belgium, The Netherlands, France Account Manager Mobile: 07860 633156 Tel: +92 42 636 7275 and Luxembourg e-mail: [email protected] Fax: +92 42 636 1370 Room 2201& 2204 e-mail: [email protected] Hong Kong New World Tower Vera Piena No. 300 Huaihai Road Middle Area Sales Manager (Maternity Cover) North of England, Scotland, Ireland and Northern Ireland Japan Shanghai 200021 Taylor & Francis P.R. China P.O. Box 447 Nick Pepper United Publishers Services Limited Tel: +86 21 23263671 2300 AK Leiden Area Representative 1-32-5 Higashi-shinagawa e-mail: [email protected] The Netherlands Mobile: 07825 748476 Shinagawa-ku, Tokyo 140-0002 Tel. 0031 (0) 715243084 e-mail: [email protected] Tel: +81 (0) 3 5479 7251 Guangdong Region F: 0031 (0) 71 523 4571 Fax: +81 (0) 3 5479 7307 Cherry Wang Mobile: +31 (0)6 194 709 42 Library Supply e-mail: [email protected] Sales Executive e-mail: [email protected] e-mail: [email protected] Nigel Berkeley Editorial Office Nordic Countries Library Supply and London Key Singapore and Indonesia Accounts Manager Eva Nyika Korea Mobile: 07795 968206 Mohamed Feroz Sales Representative Se-Yung Jun e-mail: [email protected] Assistant Sales Manager Taylor & Francis Scandinavia ICK (Information & Culture Korea) Singapore Sales Office Kungsbroplan 3 A, 1st Floor 473-19 Seokyo-dong, Mapo-ku Online Retailers e-mail: [email protected] P.O Box 3255 Seoul, Korea 121-896 SE-103 65 Stockholm, Sweden Rod Abraham Tel: +82 2 3141-4791 Thailand Taylor & Francis Asia Pacific e-Mail [email protected] Assistant UK Sales Manager Fax: +82 2 3141-7733 Mobile: 07860 380 814 e-mail: [email protected] Jeffrey Lim Germany, Austria and Switzerland Fax: 01372 273 744 Books Sales Director e-mail: [email protected] Singapore Sales Office Gabriela Mauch e-mail: [email protected] Area Sales Manager Taylor & Francis Group (Books Ltd) Nonglak Sawaithong Karlshofstr. 22 Account Manager 70599 Stuttgart, Germany Tel : +66 2 639 1333 ext. 3612 Tel: +49 (0)711 7207231 e-mail: [email protected] Fax: +49 (0)711 7220668 Mobile +49 (0)173 9059469 e-mail: [email protected] The following subject catalogs are also available from CRC Press. Visit www.crcpress.com/catalogs or contact your local sales representative for copies.
www.crcpress.com/catalogs Science, Technology, and Medical
4 Agriculture & Life Sciences 4 Environmental Science & Engineering Knowledge for the Next Generation
4 Biomedical Sciences 4 Ergonomics & Human Factors, Industrial Engineering & Manufacturing 4 Business, Management, & Public Administration 4 Food Science & Nutrition
4 Chemistry & Chemical Engineering 4 Forensic Science, Law Enforcement, & Homeland Security 4 Civil & Mechanical Engineering 4 Mathematics & Statistics 4 Computer Science, Information Technology, & Game Development 4 Medicine & Veterinary Medicine
4 Electrical Engineering 4 Physics & Materials Science
Discover More at www.crcpress.com
• Related titles, tables of contents, and new and With more than a century of publishing excellence, forthcoming publications as science evolves, so do we. • Book reviews by industry influencers and thought leaders • Authoritative STM references that cover the latest developments •Our Featured Authors community with detailed author bios, and emerging trends news about their work, and the latest research • Textbooks with ancillary materials that make teaching easier
• Digital content delivery that provides anywhere, anytime access in multiple formats
CRC Press CRC Press Go to www.crcpress.com for detailed information on every book. Taylor & Francis Group Go to www.crcpress.com to find out more. Taylor & Francis Group Premium Science, Technology, and Medical eBook Collections
Ask about Free Trials
✦ More than 12,000 references in over 350 subject areas ✦ Comprehensive, customizable, and cost-effective ✦ Up-to-date information with new titles added monthly
Take a Video Tour at www.CRCnetBASE.com [email protected] 1-888-318-2367 [email protected] 44 (0) 203-377-3680