DOCSLIB.ORG

Toxines Et Transferts Ioniques Ttoooxxxiiinnnsss Aannnddd Iiooonnn Ttrrraaannnsssfffeeerrrss

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Toxines Et Transferts Ioniques Ttoooxxxiiinnnsss Aannnddd Iiooonnn Ttrrraaannnsssfffeeerrrss Collection Rencontres en Toxinologie Collection Meetings on Toxinology TTooxxiinneess eett TTrraannssffeerrttss iioonniiqquueess Crude venom 350mAU 300 250 200 150 100 50 0 peptides 0. 0 5.0 10 .0 15.0 20 .0 25.0 30 .0 35.0 40 .0 45.0 50. 0 55.0 60 .0 65.0min Venom fractionation bioactive of All 1 2 3 4 5 6 7 8 9 101112131415161718192021222324 A B C D E F G H I J K Isolation L M N O P High throughput screening & hit identification ACSKKWEYCIVPILGFVYCCPGLICGPFVCV Sequence determination TTooxxiinnss aanndd IIoonn ttrraannssffeerrss Comité d’édition – Editorial committee : Julien BARBIER, Evelyne BENOIT, Nicolas GILLES, Daniel LADANT, Marie-France MARTIN-EAUCLAIRE, César MATTEI, Jordi MOLGÓ, Michel R. POPOFF, Denis SERVENT Société Française pour l'Etude des Toxines French Society of Toxinology Illustration de couverture – Cover picture : Application d'une analyse à haut débit pour Nav1.7, basée sur la méthode FLIPR, pour la découverte d'inhibiteurs de canaux Na+. L'identification et la séquence obtenue pour MrVIB du venin brut de Conus marmoreus sont illustrées ici. De Richard LEWIS, Ching-I Anderson WANG, Sébastien DUTERTRE et Irina VETTER (ce volume). + Application of a FLIPR-based high throughput assay for Nav1.7 for the discovery of Na channel inhibitors. Illustrated is the identification and sequence obtained for MrVIB identified in the crude venom of Conus marmoreus. From Richard LEWIS, Ching-I Anderson WANG, Sébastien DUTERTRE and Irina VETTER (this volume). Collection Rencontres en Toxinologie Collection Meetings on Toxinology La collection « Rencontres en Toxinologie » est publiée à l’occasion des colloques annuels « Rencontres en Toxinologie » organisés par la Société Française pour l’Etude des Toxines (SFET). Les ouvrages imprimés parus de 2001 à 2007 ont été édités par Elsevier (Paris, France) puis la Librairie Lavoisier (Cachan, France). Depuis 2008, ils sont édités par la SFET et diffusés sur le site http://www.sfet.asso.fr, en libre accès pour les auteurs et les lecteurs. The series « Rencontres en Toxinologie » is published on the occasion of the annual Meetings on Toxinology organized by the French Society of Toxinology (SFET). The printed books of the series, from 2001 to 2007, were edited by Elsevier (Paris, France) and then the Librairie Lavoisier (Cachan, France). Since 2008, they are edited by the SFET and are available on-line on the site http://www.sfet.asso.fr, with free access for authors and readers. Titres parus – Previous titles Explorer, exploiter les toxines et maîtriser les organismes producteurs Cassian Bon, Françoise Goudey-Perrière, Bernard Poulain, Simone Puiseux-Dao Elsevier, Paris, 2001 ISBN : 2-84299-359-4 Toxines et recherches biomédicales Françoise Goudey-Perrière, Cassian Bon, Simone Puiseux-Dao, Martin-Pierre Sauviat Elsevier, Paris, 2002 ISBN : 2-84299-445-0 Toxinogenèse – Biosynthèse, ingénierie, polymorphisme et neutralisation des toxines Françoise Goudey-Perrière, Cassian Bon, André Ménez, Simone Puiseux-Dao Elsevier, Paris, 2003 ISBN : 2-84299-481-7 Envenimations, intoxinations Françoise Goudey-Perrière, Evelyne Benoit, Simone Puiseux-Dao, Cassian Bon Librairie Lavoisier, Cachan, 2004 ISBN : 2-7430-0749-4 Toxines et douleur Cassian Bon, Françoise Goudey-Perrière, Max Goyffon, Martin-Pierre Sauviat Librairie Lavoisier, Cachan, 2005 ISBN : 2-7430-0849-0 Toxines et cancer Françoise Goudey-Perrière, Evelyne Benoit, Max Goyffon, Pascale Marchot Librairie Lavoisier, Cachan, 2006 ISBN : 2-7430-0958-6 Toxines émergentes : nouveaux risques Françoise Goudey-Perrière, Evelyne Benoit, Pascale Marchot, Michel R. Popoff Librairie Lavoisier, Cachan, 2007 ISBN : 978-2-7430-1037-9 Toxines et fonctions cholinergiques neuronales et non neuronales Evelyne Benoit, Françoise Goudey-Perrière, Pascale Marchot, Denis Servent Publications de la SFET, Châtenay-Malabry, France, 2008 Epub on http://www.sfet.asso.fr - ISSN 1760-6004 Toxines et Signalisation - Toxins and Signalling Evelyne Benoit, Françoise Goudey-Perrière, Pascale Marchot, Denis Servent Publicat ions de la SFET – SFET Editions, Châtenay-Malabry, France, 2009 Epub on http://www.sfet.asso.fr - ISSN 1760-6004 Avancées et nouvelles technologies en Toxinologie - Advances and new technologies in Toxinology Julien Barbier, Evelyne Benoit, Pascale Marchot, César Mattéi, Denis Servent Publicat ions de la SFET – SFET Editions, Gif-sur-Yvette, France, 2010 Epub on http://www.sfet.asso.fr - ISSN 1760-6004 Cet ouvrage est publié à l’occasion du colloque « 19èmes Rencontres en Toxinologie », organisé par la Société Française pour l’Etude des Toxines (SFET) les 28 et 29 novembre 2011 à Paris. This book is published on the occasion of the 19th Meeting on Toxinology, organized by the French Society of Toxinology (SFET) on November 28th and 29th, 2011, in Paris. Le comité d’organisation est constitué de – The organizing committee is constituted of : Julien Barbier, Evelyne Benoit, Nathalie Hatchi, Daniel Ladant, Michel R. Popoff & Denis Servent. Le comité scientifique est constitué de – The scientific committee is constituted of : Julien Barbier, Evelyne Benoit, Nicolas Gilles, Max Goyffon, Daniel Ladant, Pascale Marchot, Marie-France Martin- Eauclaire, César Mattéi, Jordi Molgó, Michel R. Popoff & Denis Servent. Le comité de rédaction est constitué de – The redaction committee is constituted of : Julien Barbier, Adriana Rolim Campos Barros, Evelyne Benoit, Nicolas Gilles, Max Goyffon, Marie-France Martin- Eauclaire, César Mattéi, Jordi Molgó, Michel R. Popoff & Denis Servent. Sommaire - Content Pages Toxines et canaux ioniques – Toxins and ion channels Animal toxins targeting voltage-activated sodium (NaV1.9) channels 7-10 Frank BOSMANS Overview of the small voltage-gated K+ channels blockers from Androctonus venoms 11-13 Marie-France MARTIN-EAUCLAI RE, Pierre E. BOUGIS Toxicity of sea anemone toxins related to their pharmacological activities 15-27 on ion channels Sylvie DIOCHOT, Emmanuel DEVAL, Jacques NOEL, Laszlo BERESS, Michel LAZDUNSKI, Eric LINGUEGLIA Tools for studying peptide toxin modulation of voltage-gated sodium channels 29-37 Stefan H. HEINEMANN, Enrico LEIPOLD An overview of the ion channel modulation and neurocellular disorders induced by 39-42 ciguatoxins César MATTEI , Jordi MOLGÓ, Evelyne BENOIT Pinnatoxins : an emergent family of marine phycotoxins targeting nicotinic 43-47 acetylcholine receptors with high affinity Rómulo ARÁOZ, Denis SERVENT, Jordi MOLGÓ, Bogdan I. IORGA, Carole FRUCHART-GAILLARD, Evelyne BENOIT, Zhenhua GU, Craig STIVALA, Armen ZAKARIAN Insights into the interaction of pinnatoxin A with nicotinic acetylcholine receptors 49-54 using molecular modeling Rómulo ARÁOZ, Armen ZAKARIAN, Jordi MOLGÓ, Bogdan I. IORGA Toxines formant des pores – Pore-forming toxins VacA from Helicobacter pylori : journey and action mechanism in epithelial cells 55-60 Vittorio RICCI, Patrice BOQUET Known and unknown mitochondrial targeting signals 61-66 Joachim RASSOW Clostridium perfringens epsilon toxin : a fascinating toxin 67-71 Michel R. POPOFF Binding partners of protective antigen from Bacillus anthracis share certain 73-79 common motives Christoph BEITZINGER, Angelika KRONHARDT, Roland BENZ Ways for partial and total inhibition of staphylococcal bicomponent leucotoxins 81-88 Gilles PREVOST, Mira TAWK, Mauro DALLA SERRA, Bernard POULAIN, Sarah CIANFERANI, Benoît-Joseph LAVENTIE, Emmanuel JOVER The cholesterol-dependent cytolysins : molecular mechanism to vaccine development 89-94 Rodney TWETEN Heat-stable enterotoxin b produced by Escherichia coli induces apoptosis in rat 95-97 intestinal epithelial cells H. Claudia SYED, J. Daniel DUBREUIL On the mode of entry of clostridial neurotoxins into the cytosol of nerve terminals 99-101 Paolo BOLOGNESE, Fulvio BORDI N, Cesare MONT ECUCCO, Marco PI RAZZINI , Ornella ROSSETTO, Clifford C. SHONE Pages Toxines comme outils et thérapeutiques – Toxins as tools and therapeutics Tethering peptide toxins for neurocircuitry, cell-based therapies and drug discovery 103-110 Ines IBAÑEZ-TALLON New aspects on membrane translocation of the pore-forming Clostridium botulinum 111-113 C2 toxin Eva KAISER, Katharina ERNST, Claudia KROLL, Natalie BÖHM, Holger BARTH Ion channel toxins for drug discovery and development 115-120 Richard LEWIS, Ching-I Anderson WANG, Sébastien DUTERTRE, Irina VETTER G protein-coupled receptors, an unexploited family of animal toxins targets: 121-125 exploration of green mamba venom for novel ligands on adrenoceptors Arhamatoulaye MAÏGA, Gilles MOURIER, Loic QUINTON, Céline ROUGET, Philippe LLUEL, Stefano PALEA, Denis SERVENT, Nicolas GILLES Anti-tumor snake venoms peptides 127-132 Sameh SARRAY, Raoudha ZOUARI, Jed JEBALI, Ines LIMAM, Amine BAZAA, Maram MORJANE, Zeineb ABDELKAFI, Olfa ZIRI, Najet SRAIRI, Salma DAOUED, Jose LUIS, Mohamed EL AYEB, Naziha MARRAKCHI Effect of Dinoponera quadriceps venom on chemical-induced seizures models in mice 133-136 Kamila LOPES, Emiliano RIOS, Rodrigo DANTAS, Camila LIMA, Maria LINHARES, Alba TORRES, Ramon MENEZES, Yves QUINET, Alexandre HAVT, Marta FONTELES, Alice MARTINS Effect of L-amino acid oxidase isolated from Bothrops marajoensis snake venom on 137-140 the epimastigote forms of Trypanosoma cruzi Ticiana PEREIRA, Rodrigo DANTAS, Alba TORRES, Clarissa MELLO, Danya LIMA, Marcus Felipe COSTA, Marcos TOYAMA, Maria de Fátima OLIVEIRA, Helena MONTEIRO, Alice MARTINS Divers – Miscellaneous Neurotoxicity of Staphylococcus aureus leucotoxins : interaction with the store 141-145 operated calcium entry complex in central and sensory neurons Emmanuel
Load more

Recommended publications
  • The Role of Streptococcal and Staphylococcal Exotoxins and Proteases in Human Necrotizing Soft Tissue Infections
    toxins Review The Role of Streptococcal and Staphylococcal Exotoxins and Proteases in Human Necrotizing Soft Tissue Infections Patience Shumba 1, Srikanth Mairpady Shambat 2 and Nikolai Siemens 1,* 1 Center for Functional Genomics of Microbes, Department of Molecular Genetics and Infection Biology, University of Greifswald, D-17489 Greifswald, Germany; [email protected] 2 Division of Infectious Diseases and Hospital Epidemiology, University Hospital Zurich, University of Zurich, CH-8091 Zurich, Switzerland; [email protected] * Correspondence: [email protected]; Tel.: +49-3834-420-5711 Received: 20 May 2019; Accepted: 10 June 2019; Published: 11 June 2019 Abstract: Necrotizing soft tissue infections (NSTIs) are critical clinical conditions characterized by extensive necrosis of any layer of the soft tissue and systemic toxicity. Group A streptococci (GAS) and Staphylococcus aureus are two major pathogens associated with monomicrobial NSTIs. In the tissue environment, both Gram-positive bacteria secrete a variety of molecules, including pore-forming exotoxins, superantigens, and proteases with cytolytic and immunomodulatory functions. The present review summarizes the current knowledge about streptococcal and staphylococcal toxins in NSTIs with a special focus on their contribution to disease progression, tissue pathology, and immune evasion strategies. Keywords: Streptococcus pyogenes; group A streptococcus; Staphylococcus aureus; skin infections; necrotizing soft tissue infections; pore-forming toxins; superantigens; immunomodulatory proteases; immune responses Key Contribution: Group A streptococcal and Staphylococcus aureus toxins manipulate host physiological and immunological responses to promote disease severity and progression. 1. Introduction Necrotizing soft tissue infections (NSTIs) are rare and represent a more severe rapidly progressing form of soft tissue infections that account for significant morbidity and mortality [1].
    [Show full text]
  • Report from the 26Th Meeting on Toxinology,“Bioengineering Of
    toxins Meeting Report Report from the 26th Meeting on Toxinology, “Bioengineering of Toxins”, Organized by the French Society of Toxinology (SFET) and Held in Paris, France, 4–5 December 2019 Pascale Marchot 1,* , Sylvie Diochot 2, Michel R. Popoff 3 and Evelyne Benoit 4 1 Laboratoire ‘Architecture et Fonction des Macromolécules Biologiques’, CNRS/Aix-Marseille Université, Faculté des Sciences-Campus Luminy, 13288 Marseille CEDEX 09, France 2 Institut de Pharmacologie Moléculaire et Cellulaire, Université Côte d’Azur, CNRS, Sophia Antipolis, 06550 Valbonne, France; [email protected] 3 Bacterial Toxins, Institut Pasteur, 75015 Paris, France; michel-robert.popoff@pasteur.fr 4 Service d’Ingénierie Moléculaire des Protéines (SIMOPRO), CEA de Saclay, Université Paris-Saclay, 91191 Gif-sur-Yvette, France; [email protected] * Correspondence: [email protected]; Tel.: +33-4-9182-5579 Received: 18 December 2019; Accepted: 27 December 2019; Published: 3 January 2020 1. Preface This 26th edition of the annual Meeting on Toxinology (RT26) of the SFET (http://sfet.asso.fr/ international) was held at the Institut Pasteur of Paris on 4–5 December 2019. The central theme selected for this meeting, “Bioengineering of Toxins”, gave rise to two thematic sessions: one on animal and plant toxins (one of our “core” themes), and a second one on bacterial toxins in honour of Dr. Michel R. Popoff (Institut Pasteur, Paris, France), both sessions being aimed at emphasizing the latest findings on their respective topics. Nine speakers from eight countries (Belgium, Denmark, France, Germany, Russia, Singapore, the United Kingdom, and the United States of America) were invited as international experts to present their work, and other researchers and students presented theirs through 23 shorter lectures and 27 posters.
    [Show full text]
  • Ion Channels 3 1
    r r r Cell Signalling Biology Michael J. Berridge Module 3 Ion Channels 3 1 Module 3 Ion Channels Synopsis Ion channels have two main signalling functions: either they can generate second messengers or they can function as effectors by responding to such messengers. Their role in signal generation is mainly centred on the Ca2 + signalling pathway, which has a large number of Ca2+ entry channels and internal Ca2+ release channels, both of which contribute to the generation of Ca2 + signals. Ion channels are also important effectors in that they mediate the action of different intracellular signalling pathways. There are a large number of K+ channels and many of these function in different + aspects of cell signalling. The voltage-dependent K (KV) channels regulate membrane potential and + excitability. The inward rectifier K (Kir) channel family has a number of important groups of channels + + such as the G protein-gated inward rectifier K (GIRK) channels and the ATP-sensitive K (KATP) + + channels. The two-pore domain K (K2P) channels are responsible for the large background K current. Some of the actions of Ca2 + are carried out by Ca2+-sensitive K+ channels and Ca2+-sensitive Cl − channels. The latter are members of a large group of chloride channels and transporters with multiple functions. There is a large family of ATP-binding cassette (ABC) transporters some of which have a signalling role in that they extrude signalling components from the cell. One of the ABC transporters is the cystic − − fibrosis transmembrane conductance regulator (CFTR) that conducts anions (Cl and HCO3 )and contributes to the osmotic gradient for the parallel flow of water in various transporting epithelia.
    [Show full text]
  • Hemolysin CB with Human C5a Receptors Γ Valentine Leukocidin
    Differential Interaction of the Staphylococcal Toxins Panton−Valentine Leukocidin and γ -Hemolysin CB with Human C5a Receptors This information is current as András N. Spaan, Ariën Schiepers, Carla J. C. de Haas, of October 1, 2021. Davy D. J. J. van Hooijdonk, Cédric Badiou, Hugues Contamin, François Vandenesch, Gérard Lina, Norma P. Gerard, Craig Gerard, Kok P. M. van Kessel, Thomas Henry and Jos A. G. van Strijp J Immunol 2015; 195:1034-1043; Prepublished online 19 June 2015; Downloaded from doi: 10.4049/jimmunol.1500604 http://www.jimmunol.org/content/195/3/1034 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2015/06/19/jimmunol.150060 Material 4.DCSupplemental References This article cites 46 articles, 14 of which you can access for free at: http://www.jimmunol.org/content/195/3/1034.full#ref-list-1 Why The JI? Submit online. by guest on October 1, 2021 • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2015 by The American Association of Immunologists, Inc.
    [Show full text]
  • Androctonus Mauretanicus Mauretanicus
    Hindawi Publishing Corporation Journal of Toxicology Volume 2012, Article ID 103608, 9 pages doi:10.1155/2012/103608 Review Article Potassium Channels Blockers from the Venom of Androctonus mauretanicus mauretanicus Marie-France Martin-Eauclaire and Pierre E. Bougis Aix-Marseille University, CNRS, UMR 7286, CRN2M, Facult´edeM´edecine secteur Nord, CS80011, Boulevard Pierre Dramard, 13344 Marseille Cedex 15, France Correspondence should be addressed to Marie-France Martin-Eauclaire, [email protected] and Pierre E. Bougis, [email protected] Received 2 February 2012; Accepted 16 March 2012 Academic Editor: Maria Elena de Lima Copyright © 2012 M.-F. Martin-Eauclaire and P. E. Bougis. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. K+ channels selectively transport K+ ions across cell membranes and play a key role in regulating the physiology of excitable and nonexcitable cells. Their activation allows the cell to repolarize after action potential firing and reduces excitability, whereas channel inhibition increases excitability. In eukaryotes, the pharmacology and pore topology of several structural classes of K+ channels have been well characterized in the past two decades. This information has come about through the extensive use of scorpion toxins. We have participated in the isolation and in the characterization of several structurally distinct families of scorpion toxin peptides exhibiting different K+ channel blocking functions. In particular, the venom from the Moroccan scorpion Androctonus ffi + + mauretanicus mauretanicus provided several high-a nity blockers selective for diverse K channels (SKCa,Kv4.x, and Kv1.x K channel families).
    [Show full text]
  • Panton-Valentine Leukocidin: a Review
    Reprinted from www.antimicrobe.org Panton-Valentine Leukocidin: A Review Marina Morgan F.R.C.Path. Venkata Meka, M.D. Panton-Valentine leukocidin (PVL) is a bi-component, pore-forming exotoxin produced by some strains of Staphylococcus aureus. Also termed a synergohymenotropic toxin (i.e. acts on membranes through the synergistic activity of 2 non-associated secretory proteins, component S and component F) (9), PVL toxin components assemble into heptamers on the neutrophil membrane, resulting in lytic pores and membrane damage. Injection of purified PVL induces histamine release from human basophilic granulocytes, enzymes (such as β-glucuronidase and lysozyme), chemotactic factors (such as leukotriene B4 and interleukin (IL-) 8), and oxygen metabolites from human neutrophilic granulocytes (5). Intradermal injection of purified PVL in rabbits causes severe inflammatory lesions with capillary dilation, chemotaxis, polymorphonuclear (PMN) infiltration, PMN karyorrhexis, and skin necrosis (17). PVL production is encoded by two contiguous and cotranscribed genes, lukS-PV and lukF-PV, found in a prophage segment integrated in the S. aureus chromosome (9). Traditionally some 2% of S. aureus produce PVL, however in certain groups in close contact with each other, such as military personnel, prisoners, and families of patients with infected skin lesions, skin to skin transmission is common resulting in a far higher carriage rates. Different PVL-positive S. aureus strains carry differing phage sequences, which can move into other strains methicillin and resistant, empowering them with PVl production genes (15). Many patients with PVL-positive necrotizing pneumonia have a preceding illness resembling influenza, with rigors pyrexia and myalgia. Expression of most S.
    [Show full text]
  • Impact of Bacterial Toxins in the Lungs
    toxins Review Impact of Bacterial Toxins in the Lungs 1,2,3, , 4,5, 3 2 Rudolf Lucas * y, Yalda Hadizamani y, Joyce Gonzales , Boris Gorshkov , Thomas Bodmer 6, Yves Berthiaume 7, Ueli Moehrlen 8, Hartmut Lode 9, Hanno Huwer 10, Martina Hudel 11, Mobarak Abu Mraheil 11, Haroldo Alfredo Flores Toque 1,2, 11 4,5,12,13, , Trinad Chakraborty and Jürg Hamacher * y 1 Pharmacology and Toxicology, Medical College of Georgia at Augusta University, Augusta, GA 30912, USA; hfl[email protected] 2 Vascular Biology Center, Medical College of Georgia at Augusta University, Augusta, GA 30912, USA; [email protected] 3 Department of Medicine and Division of Pulmonary Critical Care Medicine, Medical College of Georgia at Augusta University, Augusta, GA 30912, USA; [email protected] 4 Lungen-und Atmungsstiftung, Bern, 3012 Bern, Switzerland; [email protected] 5 Pneumology, Clinic for General Internal Medicine, Lindenhofspital Bern, 3012 Bern, Switzerland 6 Labormedizinisches Zentrum Dr. Risch, Waldeggstr. 37 CH-3097 Liebefeld, Switzerland; [email protected] 7 Department of Medicine, Faculty of Medicine, Université de Montréal, Montréal, QC H3T 1J4, Canada; [email protected] 8 Pediatric Surgery, University Children’s Hospital, Zürich, Steinwiesstrasse 75, CH-8032 Zürch, Switzerland; [email protected] 9 Insitut für klinische Pharmakologie, Charité, Universitätsklinikum Berlin, Reichsstrasse 2, D-14052 Berlin, Germany; [email protected] 10 Department of Cardiothoracic Surgery, Voelklingen Heart Center, 66333
    [Show full text]
  • Multiple Roles of Staphylococcus Aureus Enterotoxins: Pathogenicity, Superantigenic Activity, and Correlation to Antibiotic Resistance
    Toxins 2010, 2, 2117-2131; doi:10.3390/toxins2082117 OPEN ACCESS toxins ISSN 2072-6651 www.mdpi.com/journal/toxins Review Multiple Roles of Staphylococcus aureus Enterotoxins: Pathogenicity, Superantigenic Activity, and Correlation to Antibiotic Resistance Elena Ortega, Hikmate Abriouel, Rosario Lucas and Antonio Gálvez * Area de Microbiología, Departamento de Ciencias de la Salud, Facultad de Ciencias Experimentales, Universidad de Jaén, 23071-Jaén, Spain; E-Mails: [email protected] (E.O.); [email protected] (H.A.); [email protected] (R.L.) * Author to whom correspondence should be addressed: E-Mail: [email protected]; Tel.: +34 953 212160; Fax: +34 953 212943. Received: 3 July 2010 / Accepted: 9 August 2010 / Published: 10 August 2010 Abstract: Heat-stable enterotoxins are the most notable virulence factors associated with Staphylococcus aureus, a common pathogen associated with serious community and hospital acquired diseases. Staphylococcal enterotoxins (SEs) cause toxic shock-like syndromes and have been implicated in food poisoning. But SEs also act as superantigens that stimulate T-cell proliferation, and a high correlation between these activities has been detected. Most of the nosocomial S. aureus infections are caused by methicillin-resistant S. aureus (MRSA) strains, and those resistant to quinolones or multiresistant to other antibiotics are emerging, leaving a limited choice for their control. This review focuses on these diverse roles of SE, their possible correlations and the influence in disease progression and therapy. Keywords: enterotoxins; Staphylococcus aureus; superantigens; MRSA; immune response 1. Introduction Staphylococcus aureus is a common pathogen associated with serious community and hospital acquired diseases and has for a long time been considered as a major problem of Public Health [1].
    [Show full text]
  • Panton-Valentine Leukocidin Exotoxin Found in Intermediate Methicillin Resistant Staphylococcus Aureus Samples on Belmont University’S Campus
    Panton-Valentine Leukocidin Exotoxin Found in Intermediate Methicillin Resistant Staphylococcus aureus Samples on Belmont University’s Campus Jordan D. Helms and Jennifer T. Thomas, Ph.D. Methicillin-Resistant Staphylococcus aureus (MRSA), a pathogenic strain of Staphylococcus aureus, results in thousands of infections and associated deaths each year. A strain of MRSA, USA300, has been identified as the most common cause of skin and soft tissue infections acquired from the community in the United States. The goal of our study is to determine the prevalence of the USA300 strain, responsible for new community-associated MRSA infections, on Belmont University’s campus via PCR detection of the Panton-Valentine Leukocidin (PVL) gene, a bacterial toxin. We collected isolates from different locations on Belmont’s campus, confirmed them as MRSA using Gram staining, coagulase testing, and the use of the Kirby-Bauer disk diffusion assay. Bacterial DNA was isolated and PCR analysis performed to identify the PVL gene. We found PVL in Intermediate Methicillin Resistant Staphylococcus aureus isolates. This is surprising because the presence of PVL causes otherwise harmless Staph infections more severe and lethal if left untreated. In addition, there is very little literature on Intermediate Staphylococcus aureus infections alone, as well as its relationship with PVL. The presence of this exotoxin on Belmont’s campus puts individuals at greater risk of a severe infection and proper preventive protocol needs to be followed to ensure safety. INTRODUCTION Staphylococcus aureus and Staph infections Staphylococcus aureus (S. aureus) is a gram-positive, coccus shaped bacterium. Microscopically, it appears in tetrads and grapelike clusters and forms large, convex, golden colonies on growth plates (aureus is Latin for “gold”).
    [Show full text]
  • (K+) Channels: a Historical Overview of Peptide Bioengineering
    Toxins 2012, 4, 1082-1119; doi:10.3390/toxins4111082 OPEN ACCESS toxins ISSN 2072-6651 www.mdpi.com/journal/toxins Review Scorpion Toxins Specific for Potassium (K+) Channels: A Historical Overview of Peptide Bioengineering Zachary L. Bergeron and Jon-Paul Bingham * Department of Molecular Biosciences and Bioengineering, College of Tropical Agriculture and Human Resources, University of Hawaii at Manoa, Honolulu, HI 96822, USA; E-Mail: [email protected] * Author to whom correspondence should be addressed; E-Mail: [email protected]; Tel.: +1-808-956-4864; Fax: +1-808-956-3542. Received: 14 September 2012; in revised form: 22 October 2012 / Accepted: 23 October 2012 / Published: 1 November 2012 Abstract: Scorpion toxins have been central to the investigation and understanding of the physiological role of potassium (K+) channels and their expansive function in membrane biophysics. As highly specific probes, toxins have revealed a great deal about channel structure and the correlation between mutations, altered regulation and a number of human pathologies. Radio- and fluorescently-labeled toxin isoforms have contributed to localization studies of channel subtypes in expressing cells, and have been further used in competitive displacement assays for the identification of additional novel ligands for use in research and medicine. Chimeric toxins have been designed from multiple peptide scaffolds to probe channel isoform specificity, while advanced epitope chimerization has aided in the development of novel molecular therapeutics. Peptide backbone cyclization has been utilized to enhance therapeutic efficiency by augmenting serum stability and toxin half-life in vivo as a number of K+-channel isoforms have been identified with essential roles in disease states ranging from HIV, T-cell mediated autoimmune disease and hypertension to various cardiac arrhythmias and Malaria.
    [Show full text]
  • Focus on Scorpion Toxins
    ISSN 0006-2979, Biochemistry (Moscow), 2015, Vol. 80, No. 13, pp. 1764-1799. © Pleiades Publishing, Ltd., 2015. Original Russian Text © A. I. Kuzmenkov, E. V. Grishin, A. A. Vassilevski, 2015, published in Uspekhi Biologicheskoi Khimii, 2015, Vol. 55, pp. 289-350. REVIEW Diversity of Potassium Channel Ligands: Focus on Scorpion Toxins A. I. Kuzmenkov*, E. V. Grishin, and A. A. Vassilevski* Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry, Russian Academy of Sciences, 117997 Moscow, Russia; E-mail: [email protected]; [email protected] Received June 16, 2015 Revision received July 21, 2015 Abstract—Potassium (K+) channels are a widespread superfamily of integral membrane proteins that mediate selective transport of K+ ions through the cell membrane. They have been found in all living organisms from bacteria to higher mul- ticellular animals, including humans. Not surprisingly, K+ channels bind ligands of different nature, such as metal ions, low molecular mass compounds, venom-derived peptides, and antibodies. Functionally these substances can be K+ channel pore blockers or modulators. Representatives of the first group occlude the channel pore, like a cork in a bottle, while the second group of ligands alters the operation of channels without physically blocking the ion current. A rich source of K+ channel ligands is venom of different animals: snakes, sea anemones, cone snails, bees, spiders, and scorpions. More than a half of the known K+ channel ligands of polypeptide nature are scorpion toxins (KTx), all of which are pore blockers. These com- pounds have become an indispensable molecular tool for the study of K+ channel structure and function. A recent special interest is the possibility of toxin application as drugs to treat diseases involving K+ channels or related to their dysfunction (channelopathies).
    [Show full text]
  • Role of Tonic Protein Kinase a on SK2 Channel Expression Krithika Abiraman [email protected]
    University of Connecticut OpenCommons@UConn Master's Theses University of Connecticut Graduate School 12-16-2012 Role of Tonic Protein Kinase A on SK2 Channel Expression Krithika Abiraman [email protected] Recommended Citation Abiraman, Krithika, "Role of Tonic Protein Kinase A on SK2 Channel Expression" (2012). Master's Theses. 372. https://opencommons.uconn.edu/gs_theses/372 This work is brought to you for free and open access by the University of Connecticut Graduate School at OpenCommons@UConn. It has been accepted for inclusion in Master's Theses by an authorized administrator of OpenCommons@UConn. For more information, please contact [email protected]. Role of Tonic Protein Kinase A on SK2 Channel Expression Krithika Abiraman B.Tech. Anna University, 2010 A Thesis Submitted in Partial Fulfillment of the Requirements for the Degree of Master of Science at the University of Connecticut 2012 i Approval APPROVAL PAGE Master of Science Thesis Role of Tonic Protein Kinase A on SK2 Channel Expression Presented by Krithika Abiraman, B.Tech. Major Advisor ___________________________________________________ George Lykotrafitis Associate Advisor ________________________________________________ Anastasios V. Tzingounis Associate Advisor ________________________________________________ Wei Sun University of Connecticut 2012 ii Acknowledgements First of all I would like to express my sincere gratitude to my major advisor, Dr. George Lykotrafitis for giving me this opportunity and for his continued support without which this thesis would not have materialized. I am grateful for his mentorship, patience and enthusiasm. Next, I would like to thank my associate advisor Dr. Anastasios Tzingounis whose advice and support has been invaluable. I greatly appreciate his guidance, advice and help on this project.
    [Show full text]