![Toxines Et Transferts Ioniques Ttoooxxxiiinnnsss Aannnddd Iiooonnn Ttrrraaannnsssfffeeerrrss](https://data.docslib.org/img/3a60ab92a6e30910dab9bd827208bcff-1.webp)
Collection Rencontres en Toxinologie Collection Meetings on Toxinology TTooxxiinneess eett TTrraannssffeerrttss iioonniiqquueess Crude venom 350mAU 300 250 200 150 100 50 0 peptides 0. 0 5.0 10 .0 15.0 20 .0 25.0 30 .0 35.0 40 .0 45.0 50. 0 55.0 60 .0 65.0min Venom fractionation bioactive of All 1 2 3 4 5 6 7 8 9 101112131415161718192021222324 A B C D E F G H I J K Isolation L M N O P High throughput screening & hit identification ACSKKWEYCIVPILGFVYCCPGLICGPFVCV Sequence determination TTooxxiinnss aanndd IIoonn ttrraannssffeerrss Comité d’édition – Editorial committee : Julien BARBIER, Evelyne BENOIT, Nicolas GILLES, Daniel LADANT, Marie-France MARTIN-EAUCLAIRE, César MATTEI, Jordi MOLGÓ, Michel R. POPOFF, Denis SERVENT Société Française pour l'Etude des Toxines French Society of Toxinology Illustration de couverture – Cover picture : Application d'une analyse à haut débit pour Nav1.7, basée sur la méthode FLIPR, pour la découverte d'inhibiteurs de canaux Na+. L'identification et la séquence obtenue pour MrVIB du venin brut de Conus marmoreus sont illustrées ici. De Richard LEWIS, Ching-I Anderson WANG, Sébastien DUTERTRE et Irina VETTER (ce volume). + Application of a FLIPR-based high throughput assay for Nav1.7 for the discovery of Na channel inhibitors. Illustrated is the identification and sequence obtained for MrVIB identified in the crude venom of Conus marmoreus. From Richard LEWIS, Ching-I Anderson WANG, Sébastien DUTERTRE and Irina VETTER (this volume). Collection Rencontres en Toxinologie Collection Meetings on Toxinology La collection « Rencontres en Toxinologie » est publiée à l’occasion des colloques annuels « Rencontres en Toxinologie » organisés par la Société Française pour l’Etude des Toxines (SFET). Les ouvrages imprimés parus de 2001 à 2007 ont été édités par Elsevier (Paris, France) puis la Librairie Lavoisier (Cachan, France). Depuis 2008, ils sont édités par la SFET et diffusés sur le site http://www.sfet.asso.fr, en libre accès pour les auteurs et les lecteurs. The series « Rencontres en Toxinologie » is published on the occasion of the annual Meetings on Toxinology organized by the French Society of Toxinology (SFET). The printed books of the series, from 2001 to 2007, were edited by Elsevier (Paris, France) and then the Librairie Lavoisier (Cachan, France). Since 2008, they are edited by the SFET and are available on-line on the site http://www.sfet.asso.fr, with free access for authors and readers. Titres parus – Previous titles Explorer, exploiter les toxines et maîtriser les organismes producteurs Cassian Bon, Françoise Goudey-Perrière, Bernard Poulain, Simone Puiseux-Dao Elsevier, Paris, 2001 ISBN : 2-84299-359-4 Toxines et recherches biomédicales Françoise Goudey-Perrière, Cassian Bon, Simone Puiseux-Dao, Martin-Pierre Sauviat Elsevier, Paris, 2002 ISBN : 2-84299-445-0 Toxinogenèse – Biosynthèse, ingénierie, polymorphisme et neutralisation des toxines Françoise Goudey-Perrière, Cassian Bon, André Ménez, Simone Puiseux-Dao Elsevier, Paris, 2003 ISBN : 2-84299-481-7 Envenimations, intoxinations Françoise Goudey-Perrière, Evelyne Benoit, Simone Puiseux-Dao, Cassian Bon Librairie Lavoisier, Cachan, 2004 ISBN : 2-7430-0749-4 Toxines et douleur Cassian Bon, Françoise Goudey-Perrière, Max Goyffon, Martin-Pierre Sauviat Librairie Lavoisier, Cachan, 2005 ISBN : 2-7430-0849-0 Toxines et cancer Françoise Goudey-Perrière, Evelyne Benoit, Max Goyffon, Pascale Marchot Librairie Lavoisier, Cachan, 2006 ISBN : 2-7430-0958-6 Toxines émergentes : nouveaux risques Françoise Goudey-Perrière, Evelyne Benoit, Pascale Marchot, Michel R. Popoff Librairie Lavoisier, Cachan, 2007 ISBN : 978-2-7430-1037-9 Toxines et fonctions cholinergiques neuronales et non neuronales Evelyne Benoit, Françoise Goudey-Perrière, Pascale Marchot, Denis Servent Publications de la SFET, Châtenay-Malabry, France, 2008 Epub on http://www.sfet.asso.fr - ISSN 1760-6004 Toxines et Signalisation - Toxins and Signalling Evelyne Benoit, Françoise Goudey-Perrière, Pascale Marchot, Denis Servent Publicat ions de la SFET – SFET Editions, Châtenay-Malabry, France, 2009 Epub on http://www.sfet.asso.fr - ISSN 1760-6004 Avancées et nouvelles technologies en Toxinologie - Advances and new technologies in Toxinology Julien Barbier, Evelyne Benoit, Pascale Marchot, César Mattéi, Denis Servent Publicat ions de la SFET – SFET Editions, Gif-sur-Yvette, France, 2010 Epub on http://www.sfet.asso.fr - ISSN 1760-6004 Cet ouvrage est publié à l’occasion du colloque « 19èmes Rencontres en Toxinologie », organisé par la Société Française pour l’Etude des Toxines (SFET) les 28 et 29 novembre 2011 à Paris. This book is published on the occasion of the 19th Meeting on Toxinology, organized by the French Society of Toxinology (SFET) on November 28th and 29th, 2011, in Paris. Le comité d’organisation est constitué de – The organizing committee is constituted of : Julien Barbier, Evelyne Benoit, Nathalie Hatchi, Daniel Ladant, Michel R. Popoff & Denis Servent. Le comité scientifique est constitué de – The scientific committee is constituted of : Julien Barbier, Evelyne Benoit, Nicolas Gilles, Max Goyffon, Daniel Ladant, Pascale Marchot, Marie-France Martin- Eauclaire, César Mattéi, Jordi Molgó, Michel R. Popoff & Denis Servent. Le comité de rédaction est constitué de – The redaction committee is constituted of : Julien Barbier, Adriana Rolim Campos Barros, Evelyne Benoit, Nicolas Gilles, Max Goyffon, Marie-France Martin- Eauclaire, César Mattéi, Jordi Molgó, Michel R. Popoff & Denis Servent. Sommaire - Content Pages Toxines et canaux ioniques – Toxins and ion channels Animal toxins targeting voltage-activated sodium (NaV1.9) channels 7-10 Frank BOSMANS Overview of the small voltage-gated K+ channels blockers from Androctonus venoms 11-13 Marie-France MARTIN-EAUCLAI RE, Pierre E. BOUGIS Toxicity of sea anemone toxins related to their pharmacological activities 15-27 on ion channels Sylvie DIOCHOT, Emmanuel DEVAL, Jacques NOEL, Laszlo BERESS, Michel LAZDUNSKI, Eric LINGUEGLIA Tools for studying peptide toxin modulation of voltage-gated sodium channels 29-37 Stefan H. HEINEMANN, Enrico LEIPOLD An overview of the ion channel modulation and neurocellular disorders induced by 39-42 ciguatoxins César MATTEI , Jordi MOLGÓ, Evelyne BENOIT Pinnatoxins : an emergent family of marine phycotoxins targeting nicotinic 43-47 acetylcholine receptors with high affinity Rómulo ARÁOZ, Denis SERVENT, Jordi MOLGÓ, Bogdan I. IORGA, Carole FRUCHART-GAILLARD, Evelyne BENOIT, Zhenhua GU, Craig STIVALA, Armen ZAKARIAN Insights into the interaction of pinnatoxin A with nicotinic acetylcholine receptors 49-54 using molecular modeling Rómulo ARÁOZ, Armen ZAKARIAN, Jordi MOLGÓ, Bogdan I. IORGA Toxines formant des pores – Pore-forming toxins VacA from Helicobacter pylori : journey and action mechanism in epithelial cells 55-60 Vittorio RICCI, Patrice BOQUET Known and unknown mitochondrial targeting signals 61-66 Joachim RASSOW Clostridium perfringens epsilon toxin : a fascinating toxin 67-71 Michel R. POPOFF Binding partners of protective antigen from Bacillus anthracis share certain 73-79 common motives Christoph BEITZINGER, Angelika KRONHARDT, Roland BENZ Ways for partial and total inhibition of staphylococcal bicomponent leucotoxins 81-88 Gilles PREVOST, Mira TAWK, Mauro DALLA SERRA, Bernard POULAIN, Sarah CIANFERANI, Benoît-Joseph LAVENTIE, Emmanuel JOVER The cholesterol-dependent cytolysins : molecular mechanism to vaccine development 89-94 Rodney TWETEN Heat-stable enterotoxin b produced by Escherichia coli induces apoptosis in rat 95-97 intestinal epithelial cells H. Claudia SYED, J. Daniel DUBREUIL On the mode of entry of clostridial neurotoxins into the cytosol of nerve terminals 99-101 Paolo BOLOGNESE, Fulvio BORDI N, Cesare MONT ECUCCO, Marco PI RAZZINI , Ornella ROSSETTO, Clifford C. SHONE Pages Toxines comme outils et thérapeutiques – Toxins as tools and therapeutics Tethering peptide toxins for neurocircuitry, cell-based therapies and drug discovery 103-110 Ines IBAÑEZ-TALLON New aspects on membrane translocation of the pore-forming Clostridium botulinum 111-113 C2 toxin Eva KAISER, Katharina ERNST, Claudia KROLL, Natalie BÖHM, Holger BARTH Ion channel toxins for drug discovery and development 115-120 Richard LEWIS, Ching-I Anderson WANG, Sébastien DUTERTRE, Irina VETTER G protein-coupled receptors, an unexploited family of animal toxins targets: 121-125 exploration of green mamba venom for novel ligands on adrenoceptors Arhamatoulaye MAÏGA, Gilles MOURIER, Loic QUINTON, Céline ROUGET, Philippe LLUEL, Stefano PALEA, Denis SERVENT, Nicolas GILLES Anti-tumor snake venoms peptides 127-132 Sameh SARRAY, Raoudha ZOUARI, Jed JEBALI, Ines LIMAM, Amine BAZAA, Maram MORJANE, Zeineb ABDELKAFI, Olfa ZIRI, Najet SRAIRI, Salma DAOUED, Jose LUIS, Mohamed EL AYEB, Naziha MARRAKCHI Effect of Dinoponera quadriceps venom on chemical-induced seizures models in mice 133-136 Kamila LOPES, Emiliano RIOS, Rodrigo DANTAS, Camila LIMA, Maria LINHARES, Alba TORRES, Ramon MENEZES, Yves QUINET, Alexandre HAVT, Marta FONTELES, Alice MARTINS Effect of L-amino acid oxidase isolated from Bothrops marajoensis snake venom on 137-140 the epimastigote forms of Trypanosoma cruzi Ticiana PEREIRA, Rodrigo DANTAS, Alba TORRES, Clarissa MELLO, Danya LIMA, Marcus Felipe COSTA, Marcos TOYAMA, Maria de Fátima OLIVEIRA, Helena MONTEIRO, Alice MARTINS Divers – Miscellaneous Neurotoxicity of Staphylococcus aureus leucotoxins : interaction with the store 141-145 operated calcium entry complex in central and sensory neurons Emmanuel
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages180 Page
-
File Size-