on I Don't Wanna
bruh Posted 21 hours ago 21 hours
on I Don't Wanna
fucking huuuuuuge Delete this comment
on paradise
@din-z: do you need me to call a doctor? Posted 23 hours ago 23 hours
on Hit The Ceiling (Zikomo Remix)
righteous Posted 1 day ago 1 day
on Badaboo
super relaxed Posted 1 day ago 1 day
on X Reasons
wonderful Posted 1 day ago 1 day
on X Reasons my oh my Posted 1 day ago 1 day
on Nnaye x oylo - ruin
@zodivk: ;* Posted 1 day ago 1 day
on Both
suave Posted 2 days ago 2 days
on not nice
melō Posted 2 days ago 2 days
on not nice
arm hair standing up rn Posted 2 days ago 2 days
on not nice
wow Posted 2 days ago 2 days
on not nice the break came in like a tin horse Posted 2 days ago 2 days
on not nice
for a second I thought that was your vocal Posted 2 days ago 2 days
on not nice
no way.... Posted 2 days ago 2 days
on esta. - Peache$
@oylo: just kinda stuck... this composition is the nextest level Posted 2 days ago 2 days
on esta. - Peache$
I've listened to this 3 times in a row now Posted 2 days ago 2 days
on Nnaye x oylo - ruin
! Posted 2 days ago 2 days
on paradise
@sundaug: thanks sundaug! Posted 2 days ago 2 days
on THRPY X Soulecist. - No Rules [BTS X Phuture Collective]
@soulecist: but like my daw can't process that kind of data at a high latency, it would take me forever to try and interlock all those tiny sounds together and keep them on beat. any way you can link me to that video? Posted 4 days ago 4 days
on THRPY X Soulecist. - No Rules [BTS X Phuture Collective]
@soulecist: oh word. thanks lol Posted 4 days ago 4 days
on watchers
supa hOT Posted 4 days ago 4 days
on fakeskin
that was mind altering Posted 4 days ago 4 days
on Alive
holy moly this is fresher than subway's 56 ingredients Posted 5 days ago 5 days
on Ocie Elliot - Down By The Water &_& Posted 5 days ago 5 days
on strange
noice noice noice Posted 5 days ago 5 days
on Total Freedom (feat. Inas)
tight Posted 5 days ago 5 days
on @ night
fresh breath of air Posted 5 days ago 5 days
on we don't speak anymore w/ solonely (prod yung skah & cxld blxxd)
ice Posted 5 days ago 5 days
on STACK ME SOME RACKS(remix) freestyle
@user-841883305: no worries. you'd have to record the vocals while listening to the instrumental in headphones Posted 6 days ago 6 days
on paradise @1066state: thanks! Posted 6 days ago 6 days
on paypuh
@1066state: thank you! Posted 6 days ago 6 days
on Demise ft. Abyssus Erigo
god damn Posted 6 days ago 6 days
on DJ Douggpound - We Three Bings
what am I listening to Posted 6 days ago 6 days on Sebastian Ingrosso & Alesso Ft. Ryan Tedder - Calling (Blank x Blush Flip)
nice take Posted 6 days ago 6 days
on WHIPPED CREAM - SHE
thwhack Posted 6 days ago 6 days
on wrist. wriss wriss wriss wriss wriss wriss wriss wriss Posted 6 days ago 6 days
on Starset - Satellite (TRAILS Remix)
huge Posted 6 days ago 6 days
on Røhaan x Hanz - Thorns
y'all all killing it today bless up Posted 6 days ago 6 days
on RoM:ra cigam rion R4 (maintenance)
10 Posted 6 days ago 6 days
on 2 piece w/ KTRL
hefty hefty hefty Posted 6 days ago 6 days
on 2 piece w/ KTRL
tall Posted 6 days ago 6 days
on polaris @clubmedd: bless up Posted 6 days ago 6 days
on sure don't
@shlundee: it's ya boylo Posted 6 days ago 6 days
on Beco w/ VHOOR
so sick Posted 6 days ago 6 days
on Beco w/ VHOOR
yo Posted 6 days ago 6 days
on Escorrega
this got scary fast Posted 6 days ago 6 days
on Escorrega
intriguing chopps Posted 6 days ago 6 days
on Empurra w/ Pep.
fucking naaaaaaasty! Posted 6 days ago 6 days
on Empurra w/ Pep.
seriously vibing on your page rn. super relaxed Posted 6 days ago 6 days
on passa nada
pour up Posted 6 days ago 6 days
on Hibari these keys are going to haunt my dreams tonight Posted 6 days ago 6 days
on Gilka
créme Posted 6 days ago 6 days
on Gilka
@sofasound-beats: damn they are aren't they Posted 6 days ago 6 days
on Gilka
pure milk Posted 6 days ago 6 days
on Relight My Fire(yumeka remix)
work that thang Posted 6 days ago 6 days
on TAP & Sansai - Mlk Bom
@svnsai: <3<3 this tune is super heavy Posted 6 days ago 6 days
on TAP & Sansai - Mlk Bom
@svnsai: oh shucks ☺ Posted 6 days ago 6 days
on STACK ME SOME RACKS(remix) freestyle
@user-841883305: send them both to my e- mail [email protected] Posted 6 days ago 6 days
on paradise
@couch-king-presents: thank you your highness Posted 6 days ago 6 days
on STACK ME SOME RACKS(remix) freestyle
@user-841883305: if you have the vocal track and the instrumental separate I can hook you up Posted 6 days ago 6 days on RS Frawstakwa, JayWalkerBlack, Soundwanderer & the Couch King - The Couch King Sofa Barn
lol Posted 6 days ago 6 days on RS Frawstakwa, JayWalkerBlack, Soundwanderer & the Couch King - The Couch King Sofa Barn
real thump time Posted 6 days ago 6 days on Horace Silver - Song For My Father (Luciole's Alternative Skinny Edit PartII)
majestic trillinitisified Posted 6 days ago 6 days
on Cognition Du Cortex (Final Mix)
warped Posted 6 days ago 6 days
on Cognition Du Cortex (Final Mix)
solid out the gate Posted 6 days ago 6 days on Cognition Du Cortex (Final Mix)
instant boner over here Posted 6 days ago 6 days
on A Battle Under The Sun this the theme that plays when you in the smoke monster's cave from lost Posted 6 days ago 6 days
on A Battle Under The Sun
eerie synth creeping up behing you Posted 6 days ago 6 days
on A Battle Under The Sun
foreign drumwork Posted 6 days ago 6 days
on NEW$HOES - Think (Caedmon Rigby Remix)
dope Posted 6 days ago 6 days
on NEW$HOES - Think (Caedmon Rigby Remix)
okay okay I see you fam Posted 6 days ago 6 days on She's Excited! - Lose My Cool (Caedmon Rigby Remix)
hell yes! familiaaaaaaa aye aye aye aye ayeeeee Posted 6 days ago 6 days
on 1.9 (Say Goodbye)
hopping up and down those keys <3 Posted 6 days ago 6 days
on 1.9 (Say Goodbye)
this could be the score for a variety of holiday plays Posted 6 days ago 6 days
on 1.10 You Stand On The Color Side That I Want
resolved in peace Posted 6 days ago 6 days
on 1.10 You Stand On The Color Side That I Want
I like your style tetsnical, not afraid to do what you like Posted 6 days ago 6 days
on 18.11
that lead is out of this world! Posted 6 days ago 6 days
on 18.11 I appreciate the combination of styles Posted 6 days ago 6 days
on 18.11
gorgeous mashup Posted 6 days ago 6 days
on Just Begun ( ft. Niko G., home-recorded (≈1996 ) this makes me want to pack up my entire life and move to north carolina Posted 6 days ago 6 days
on The World Goes On
love the wiping Posted 6 days ago 6 days
on The World Goes On the world does go on. you captured that nicely with these countermelodies Posted 6 days ago 6 days
on The World Goes On very interesting! I haven't heard anything like this before Posted 6 days ago 6 days on Calaminus Move your Mind, original song , feat, on Bass Luis Reniu
workin' it Posted 6 days ago 6 days
on Jimi meets Miles ---- Big Time
shredding Posted 6 days ago 6 days
on Irina Robert original sound, feat bass Luis Reniu those strings are being mastered right in front of my ears.... they're so compliant Posted 6 days ago 6 days
on Irina Robert original sound, feat bass Luis Reniu
hell yeah!!!!!! not enough scat nowadays! Posted 6 days ago 6 days
on Irina Robert original sound, feat bass Luis Reniu
oh my goodness Posted 6 days ago 6 days
on real muthaphuckkin g's
hot take Posted 6 days ago 6 days on Of Guard hey al, just checking in. it's been a minute. sorry for my abscence Posted 6 days ago 6 days
on Bishu - Eyes Wide Open
good fuck Posted 6 days ago 6 days
on Bishu - Eyes Wide Open
charged as hell Posted 6 days ago 6 days
on Drowning Ft. Fiebs
I'm but a husk now Posted 6 days ago 6 days
on Drowning Ft. Fiebs
but I can't stop listening Posted 6 days ago 6 days
on Drowning Ft. Fiebs
I can feel my brain beeing overridden Posted 6 days ago 6 days on Drowning Ft. Fiebs
wiping my memory Posted 6 days ago 6 days
on bandolero
good fuck that kick is a thickn Posted 6 days ago 6 days on Vassh - Take This With U And Never Let Go... delicate elegant fantastical audial embrace Posted 6 days ago 6 days
on morning ft. snowee
I'm riding Posted 6 days ago 6 days
on morning ft. snowee
sweeet mercy Posted 6 days ago 6 days
on cold
love Posted 6 days ago 6 days
on cold is that shiloh you got back there? Posted 6 days ago 6 days on i made this tinashe remix yesterday just so you know i still make music
wet vox got me creamin Posted 6 days ago 6 days on i made this tinashe remix yesterday just so you know i still make music
I'm on vibe mode Posted 6 days ago 6 days on i made this tinashe remix yesterday just so you know i still make music
fun bump Posted 6 days ago 6 days
on Monte Booker - Don't Panic feat. Kiya Lacey
sway Posted 6 days ago 6 days
on Monte Booker - Don't Panic feat. Kiya Lacey
interesting listen. thoroughly enjoying Posted 6 days ago 6 days on THRPY X Soulecist. - No Rules [BTS X Phuture Collective]
I guess that would work Posted 6 days ago 6 days
on THRPY X Soulecist. - No Rules [BTS X Phuture Collective] do y'all just like quadruple your tempo so you can accurately fit all these tiny sounds in on beat or? Posted 6 days ago 6 days
on Propellor/Nosebleed Feat. Dax & Emily Blue
real shit Posted 6 days ago 6 days
on Propellor/Nosebleed Feat. Dax & Emily Blue
magical musical platform accentuating the perfectly glued vocals Posted 6 days ago 6 days
on Propellor/Nosebleed Feat. Dax & Emily Blue
gumplife yuh Posted 6 days ago 6 days
on Jp Saxe - Anybody Else (Win and Woo Remix)
ooffff Posted 6 days ago 6 days on Jp Saxe - Anybody Else (Win and Woo Remix)
slick movements. I'm in Posted 6 days ago 6 days
on i think its fine w/ j.robb imagine they brought back club penguin and added virtual reality... this would be the song playing the cofee shop Posted 6 days ago 6 days
on Cloyde (ep coming soon)
1k freq whale tryna evacuate his stomach Posted 6 days ago 6 days
on Cloyde (ep coming soon)
pumpyfunkyme Posted 6 days ago 6 days
on SHELL-SHOCK # (w/YSZ & ZENOPHAZE)
my girlfriend just called and asked me to turn it down Posted 6 days ago 6 days
on SHELL-SHOCK # (w/YSZ & ZENOPHAZE)
headphones can't contain this bitch Posted 6 days ago 6 days
on TAP & Sansai - Mlk Bom
t t t BWOOOOOM Posted 6 days ago 6 days
on TAP & Sansai - Mlk Bom
this sample is fantastic Posted 6 days ago 6 days
on TAP & Sansai - Mlk Bom
okay it's final, now I've got make a hard baille banger Posted 6 days ago 6 days
on Blame On Me
righteous Posted 6 days ago 6 days
on Blame On Me
go on!!! Posted 6 days ago 6 days
on Dr. Fresch - The Prescription 029: Sevenn Guest Mix digipump yardland y'all got a needed hand come and play with bands in the sand of the equalization bandaragaland Posted 6 days ago 6 days
on WATER
smoked Posted 6 days ago 6 days
on WATER in july 1995, tlc- waterfalls was #1 on the charts Posted 6 days ago 6 days on Roses & Revolutions - The Pines (Evan Gartner Remix)
without a doubt. big ups Posted 6 days ago 6 days on Roses & Revolutions - The Pines (Evan Gartner Remix)
damn bro you murdered this remix Posted 6 days ago 6 days on Michael Seyer & Bane's World - lookin thru ur win-dow
@banes-world: stay lit Posted 6 days ago 6 days on Michael Seyer & Bane's World - lookin thru ur win-dow
this is exactly what I needed to hear Posted 6 days ago 6 days on like a rockstar w/ thousands of youth
awesome Posted 6 days ago 6 days
on like a rockstar w/ thousands of youth
and bruh the whipping omg Posted 6 days ago 6 days
on like a rockstar w/ thousands of youth
massive... Posted 6 days ago 6 days
on we are stronger together. this song is like a breathing exercise Posted 6 days ago 6 days
on Raw Data [Nest HQ Premiere]
tek Posted 6 days ago 6 days
on chatterbox.2
layers of sweepwave Posted 6 days ago 6 days on chatterbox.2
machine gotta release steam Posted 6 days ago 6 days
on chatterbox.2
dream fireworks Posted 6 days ago 6 days
on me gusta
fam Posted 6 days ago 6 days
on me gusta
lucky for you that's what I like Posted 6 days ago 6 days
on me gusta lightly smacking them keys with the fingertips Posted 6 days ago 6 days
on me gusta
what a tag hahah Posted 6 days ago 6 days on 5.SG TIP - 100 RNDS FT YOUNG BOY(PROD.PIERRE BOURNE)
satanic Posted 6 days ago 6 days
on L*o*J & Jon Casey - Chance The Monopoly Card
sloppin' in the mud dirt gettin' nasty Posted 6 days ago 6 days
on L*o*J & Jon Casey - Chance The Monopoly Card
I wanna do a mad complicated dance to this but I can't whip my chest around fast enough Posted 6 days ago 6 days
on L*o*J & Jon Casey - Chance The Monopoly Card
I wish my body could move faster than it can Posted 6 days ago 6 days
on L*o*J & Jon Casey - Chance The Monopoly Card
awesome tune! nice take on the progression Posted 6 days ago 6 days
on PLANETARIUM (Lyrics)
nice Posted 6 days ago 6 days on PLANETARIUM (Lyrics)
hoardstalkerlife Posted 6 days ago 6 days
on PLANETARIUM (Lyrics)
calm in the mystery Posted 6 days ago 6 days
on BA BA DE BAP - Jamie Rhind / Stephan Lipinski / Scott Nelson / Styrmonix
incredibly relaxing Posted 6 days ago 6 days
on BA BA DE BAP - Jamie Rhind / Stephan Lipinski / Scott Nelson / Styrmonix
stylin' n wildin' Posted 6 days ago 6 days
on CHILLING IN THE 60S BREEZE - STYRMONIX - TOPHONICUS - JOERXWORX the muted melody in the back has me hooked like a perch Posted 6 days ago 6 days
on CHILLING IN THE 60S BREEZE - STYRMONIX - TOPHONICUS - JOERXWORX
magnificent breakdown Posted 6 days ago 6 days on CHILLING IN THE 60S BREEZE - STYRMONIX - TOPHONICUS - JOERXWORX
fill me up with brass Posted 6 days ago 6 days
on R U Ready?
props Posted 6 days ago 6 days
on R U Ready?
I seriously fuck with this Posted 6 days ago 6 days
on Little Me (feat. Karnaboy)
delicate Posted 6 days ago 6 days
on Little Me (feat. Karnaboy)
beautiful Posted 6 days ago 6 days
on who dat boi ft. so loki prod. lentra
damn this goes in Posted 6 days ago 6 days
on brand new (prod. FELD)
blazed Posted 6 days ago 6 days
on Beg For It and don't even get me started on these twisted industrials synths <3 Posted 6 days ago 6 days
on Beg For It
awesome percussion. stayed slapping Posted 6 days ago 6 days
on b e efer
awesome Posted 7 days ago 7 days
on b e efer
100% on board. this train is moving Posted 7 days ago 7 days
on Skating
cool cool c c c c coo cool cool Posted 7 days ago 7 days on Kardashian - JamesJef/YoungSleaze prod by GroveSideWork
mad chill Posted 7 days ago 7 days
on Lost Path
going deep undergound Posted 7 days ago 7 days
on Lost Path
constant bang Posted 7 days ago 7 days
on Lemme Show U (feat. Waldo & Lou Phelps)
they whiny little sub animal wave getting me good Posted 7 days ago 7 days
on Lemme Show U (feat. Waldo & Lou Phelps)
nothin but citrus fam Posted 7 days ago 7 days
on Lemme Show U (feat. Waldo & Lou Phelps)
words Posted 7 days ago 7 days on Only One
$ $ Posted 7 days ago 7 days
on Only One
bumpin in the bando Posted 7 days ago 7 days
on Only One
wispy love lives Posted 7 days ago 7 days
on Money Moves
I make money dance Posted 7 days ago 7 days
on Money Moves that snares sounds like a 6-bit dinosaur gettin' bit Posted 7 days ago 7 days
on Money Moves
this should be the original. easily 100x better Posted 7 days ago 7 days on aUtOdiDakT - Pull Up
twisted as f u c k Posted 7 days ago 7 days
on aUtOdiDakT - Pull Up
feels like I just shat out a toddler Posted 7 days ago 7 days
on Reminisce (Ft. Le Real)
wicked Posted 7 days ago 7 days
on Reminisce (Ft. Le Real)
matrimony Posted 7 days ago 7 days
on Svette
you've created a beautiful piece here by the way, awesome vibes Posted 7 days ago 7 days
on Svette when are they going to invent ear implants that live translate other languages in the same style of the voice speaking? I would pay a lot for that. but come to think of it, the lines probably wouldn't flow/rhyme the same way, so that would never work (musically) across all languages, but a nice thought eh? Posted 7 days ago 7 days
on When We Had Dreams
<3<3<3 I'm about to cry like I did at the end of that new coco movie Posted 7 days ago 7 days
on When We Had Dreams
angelic pads oomf Posted 7 days ago 7 days
on When We Had Dreams
moving mountains with these keys Posted 7 days ago 7 days
on face (prod. iceboi soorma x cruzer)
nothing but dome Posted 7 days ago 7 days
on face (prod. iceboi soorma x cruzer)
awesome composition Posted 7 days ago 7 days on Diamonds Dancing (prod.by Zoowill)
o Posted 7 days ago 7 days
on Diamonds Dancing (prod.by Zoowill)
stay pured Posted 7 days ago 7 days
on STACK ME SOME RACKS(remix) freestyle put your recording on a separate channel man, this song is dope but I can't hear it! Posted 7 days ago 7 days
on Spaceship
mad Posted 7 days ago 7 days
on Spaceship
I don't even speak this language but I'm digging it Posted 7 days ago 7 days
on Spaceship
beat too fire Posted 7 days ago 7 days on Spaceship
damn this is super sick Posted 7 days ago 7 days
on Counting Sheep
nothing but Posted 7 days ago 7 days
on Counting Sheep
@imdkai: I mean neither is yours tbh... Posted 7 days ago 7 days
on Counting Sheep
yo same Posted 7 days ago 7 days
on 21
heaviest Posted 7 days ago 7 days
on 21
slaughterfest Posted 7 days ago 7 days on fame us
@lewiastro: I'm glad you felt something <3 Posted 7 days ago 7 days
on XO TOUR Llif3 // LIL UZI VERT COVER
@silvrstorm: yo let me hop in this bitch, fuck you synx hope your sister gets polio Posted 11 days ago 11 days
on back (prod. by nnaye)
right on Posted 13 days ago 13 days
on back (prod. by nnaye)
very dope Posted 13 days ago 13 days
on i just remembered i made this
hell yeah those ofset percs give a nice build Posted 13 days ago 13 days
on i just remembered i made this
y'all ever had warm ice Posted 13 days ago 13 days on i just remembered i made this
cozy beach time vibe Posted 13 days ago 13 days
on paradise
@aerogene: thanks aero! Posted 14 days ago 14 days
on waittt
swoll Posted 14 days ago 14 days
on Aint Got Time
wow Posted 14 days ago 14 days
on Kiri
yaaah yeeet Posted 14 days ago 14 days
on Mo Vibez - Crumpin
haven't heard this one Posted 14 days ago 14 days on marc - Die, Baby! (prod by JANITOR) [VIDEO IN DESCRIPTION] smooth Posted 14 days ago 14 days
on Relativity (feat. Singularis)
sick Posted 14 days ago 14 days
on Relativity (feat. Singularis)
dancin' on 'em Posted 14 days ago 14 days
on Royal Space ft. Virginia Palms
warm sound design Posted 14 days ago 14 days
on paradise
@s-a-fred: appreciate that homie Posted 17 days ago 17 days
on paypuh
@s-a-fred: damn right!! thanks for listening! Posted 17 days ago 17 days
on would you kindly? @s-a-fred: torturous almost Posted 17 days ago 17 days
on fame us
@s-a-fred: <3 thank you Posted 17 days ago 17 days
on Trans Cerebral Pipeline
@s-a-fred: doing a fine job Posted 17 days ago 17 days
on Steps Will Be Taken
@s-a-fred: diversity is key man... too many people making the same track over and over Posted 17 days ago 17 days
on J Dilla - Donuts Outro (Coastal Conversion)
@coastal: bruh when I was young I would beg my mom to buy me a box of zingers every time we went to the store... ugh good god I just feel the lemon icing peeling of onto my tongue rn... Posted 17 days ago 17 days
on Nocturne Eb The Brighter Side
nothing but joy Posted 17 days ago 17 days on Final Choice - Root Division (1983)
sweet! hearing it again but in a totally new way Posted 17 days ago 17 days
on Final Choice (1981, V1) Root Division album now on Bandcamp - Please see description
so goddamn catchy Posted 17 days ago 17 days
on Final Choice (1981, V1) Root Division album now on Bandcamp - Please see description
my brains like "this is the note that should come next in sequence" and then he sings that note... perfect Posted 17 days ago 17 days
on Final Choice (1981, V1) Root Division album now on Bandcamp - Please see description
really enjoying this ride Posted 17 days ago 17 days
on Pianoteq Grotrian & ME80 - improv ballerina fairies with the smallest brass instruments you've ever seen, ascending into the air on dew drops Posted 17 days ago 17 days
on Playing Amongst The Craters beautiful piece rob Posted 17 days ago 17 days
on Ascension To The Yellow Garden absolutely love these chords. they're filled to the brim with knowledge Posted 17 days ago 17 days
on Trans Cerebral Pipeline
synth is putting in work Posted 17 days ago 17 days
on Trans Cerebral Pipeline
yo you're nuts this music is so creative Posted 17 days ago 17 days
on Trans Cerebral Pipeline
spic n span Posted 17 days ago 17 days
on Fields Of Blue
interdimensional opera. ticket prices are a birhcjbjh Posted 17 days ago 17 days
on Fields Of Blue a spectacle into other dimensions Posted 17 days ago 17 days
on Fields Of Blue
this has me in "ratchet and clank on acid" state of mind Posted 17 days ago 17 days
on Steps Will Be Taken unique set of composition techniques being used here. I appreciate your diversity Posted 17 days ago 17 days
on Bakersfield And One-Night Arms
laid back porch rockin' life Posted 17 days ago 17 days
on Le Faire et le Casser des Monstres
guitar is really intensifying Posted 17 days ago 17 days
on Le Faire et le Casser des Monstres
I don't understand it but I kinda dig it Posted 17 days ago 17 days
on (Cover) Live Like You Were Dying - Tim McGraw couldn't help but sing along the entire time... Posted 17 days ago 17 days
on Age Against The Machine (+ Video Link)
absolutely love these vocals btw Posted 17 days ago 17 days
on Age Against The Machine (+ Video Link) the visuals were awesome... you've helped to inspired me to do more with video Posted 17 days ago 17 days
on Age Against The Machine (+ Video Link)
very interesting.... I may need to watch the video Posted 17 days ago 17 days
on She's So Deadly - EDM
switched up!! yesss Posted 17 days ago 17 days
on She's So Deadly - EDM
cool vocal work. space age vibes Posted 17 days ago 17 days
on She's So Deadly - EDM very interesting!! Posted 17 days ago 17 days
on Rock that train very cool vibe keeps things moving down the track all the while acknowledging industrial predecessor companionship and appreciating it's services and use. an ode to future mechanical revolution development and understanding Posted 17 days ago 17 days
on Solar Storm
they melodies are telling a story together Posted 17 days ago 17 days
on Solar Storm
deep breaths... isolation and invigoration... Posted 17 days ago 17 days
on Middle Street - Gintong Bahghari Music collab
nice Posted 17 days ago 17 days
on Middle Street - Gintong Bahghari Music collab
awesome fingerwork Posted 17 days ago 17 days on Middle Street - Gintong Bahghari Music collab
almost eerie but I'm liking it Posted 17 days ago 17 days
on head games$ (prod. cutnoise)
dumb good mix level damn Posted 17 days ago 17 days
on head games$ (prod. cutnoise)
this pretty hard Posted 17 days ago 17 days
on Jai Wolf - Indian Summer (Kasbo Remix)
incredible drumwork Posted 17 days ago 17 days
on Jai Wolf - Indian Summer (Kasbo Remix)
beautifully charged Posted 17 days ago 17 days
on Jai Wolf - Indian Summer (Kasbo Remix) hi kasbo sorry I've been away for so many years Posted 17 days ago 17 days on hero
these vocals got me haunted Posted 17 days ago 17 days
on Nvrmnd the bass ripping everything to shreds in here... so tight Posted 17 days ago 17 days
on Nvrmnd
IS CYGN PRONOUNCED "SIGN"????? Posted 17 days ago 17 days
on Nvrmnd
WAS THAT A TAG? Posted 17 days ago 17 days
on Nvrmnd
WHOA WIAT Posted 17 days ago 17 days
on 9: Lege Kale - Seasons (feat. Mars Today) every area of this stereo space has something new and interesting for you to hear Posted 17 days ago 17 days on 9: Lege Kale - Seasons (feat. Mars Today)
10 10 10 10 10 Posted 17 days ago 17 days
on Obsession
massive Posted 17 days ago 17 days
on Obsession
well timed Posted 17 days ago 17 days
on Nakala - Paris (AKAY Remix)
yo Posted 17 days ago 17 days
on Nakala - Paris (AKAY Remix)
heavy Posted 17 days ago 17 days
on Nakala - Paris (AKAY Remix)
sassy Posted 17 days ago 17 days on Nakala - Paris (AKAY Remix)
thick Posted 17 days ago 17 days
on Nakala - Paris (AKAY Remix)
hot Posted 17 days ago 17 days
on Dont Think About It Feat. max fry worlds diferent that the last and next 100 songs in my feed. props Posted 17 days ago 17 days
on Fantasy (feat. Dugong Jr)
pretty dope Posted 17 days ago 17 days
on J Dilla - Donuts Outro (Coastal Conversion)
wicked wave Posted 17 days ago 17 days
on J Dilla - Donuts Outro (Coastal Conversion)
my headphones doing to magical shit to my temples rn Posted 17 days ago 17 days on J Dilla - Donuts Outro (Coastal Conversion)
the hop on this shit is surreal Posted 17 days ago 17 days
on J Dilla - Donuts Outro (Coastal Conversion)
I was hungry but I think I might just have this track for dinner instead Posted 17 days ago 17 days
on graves - Blame ft. LocateEmilio (Tim Gunter Remix)
I feel like I just ran half a mile Posted 17 days ago 17 days
on graves - Blame ft. LocateEmilio (Tim Gunter Remix)
so fire Posted 17 days ago 17 days
on graves - Blame ft. LocateEmilio (Tim Gunter Remix)
not gonna lie at first I was a little skeptical but shit bro you don't have to make me feel bad about it Posted 17 days ago 17 days
on graves - Blame ft. LocateEmilio (Tim Gunter Remix)
wow Posted 17 days ago 17 days on graves - Blame ft. LocateEmilio (Tim Gunter Remix)
there it goes Posted 17 days ago 17 days
on graves - Blame ft. LocateEmilio (Tim Gunter Remix)
pump the nut out Posted 17 days ago 17 days
on graves - Blame ft. LocateEmilio (Tim Gunter Remix)
stay hovd Posted 17 days ago 17 days
on Kailee Morgue - Medusa (Manila Killa Remix)
loving the drums Posted 17 days ago 17 days
on Kailee Morgue - Medusa (Manila Killa Remix)
moving them boulders like they're beach balls Posted 17 days ago 17 days
on Louis Futon - Restless Sea (feat. Opia) nice to hear a fresh sound once in a while. all these dudes doing the same shit. this is a dope one guys Posted 17 days ago 17 days on memories of us.
nice one bruh Posted 17 days ago 17 days
on memories of us.
@oylo: two ts? Posted 17 days ago 17 days
on memories of us.
summiting Posted 17 days ago 17 days
on memories of us.
wet glittcher Posted 17 days ago 17 days
on memories of us. giving me a phasce full of love Posted 17 days ago 17 days
on paypuh
@chimmala: <3 Posted 17 days ago 17 days on Day 29: Remix Me
serenity Posted 20 days ago 20 days
on Day 29: Remix Me
where those stems at tho Posted 20 days ago 20 days
on would you kindly?
@jupiterstate1: bless <3 Posted 21 days ago 21 days
on Day 28: Flipt Script
yo this is massive Posted 21 days ago 21 days
on Day 28: Flipt Script charge that shit up hell yeah Posted 21 days ago 21 days
on Day 28: Flipt Script
savaaage Posted 21 days ago 21 days on Day 28: Flipt Script
hahahahaha WHAT Posted 21 days ago 21 days
on Day 27: Kehlani - Gangsta (3lo Remix)
righteous Posted 21 days ago 21 days
on Day 27: Kehlani - Gangsta (3lo Remix)
class Posted 21 days ago 21 days
on Day 27: Kehlani - Gangsta (3lo Remix)
sprinkle in that funk break bruh Posted 21 days ago 21 days
on Day 27: Kehlani - Gangsta (3lo Remix) did you put her voice in a sampler or get some instrument to sound similar?? Posted 21 days ago 21 days
on Day 27: Kehlani - Gangsta (3lo Remix)
showered in mist Posted 21 days ago 21 days on Day 27: Kehlani - Gangsta (3lo Remix)
oh fuck this some produce out the amazon fresh bag Posted 21 days ago 21 days
on Day 27: Kehlani - Gangsta (3lo Remix)
me that is Posted 21 days ago 21 days
on Day 27: Kehlani - Gangsta (3lo Remix)
instantly solid Posted 21 days ago 21 days
on Day 27: Kehlani - Gangsta (3lo Remix)
>>>>>>>>> Posted 21 days ago 21 days
on Day 26: Board Games
round af Posted 21 days ago 21 days
on Day 26: Board Games what's the bpm like 492? so you can fit all this intricate but somehow perfectly timed shit? Posted 21 days ago 21 days on Day 26: Board Games
space jam laser fam got dam Posted 21 days ago 21 days
on Day 26: Board Games
soft tocas Posted 21 days ago 21 days
on Day 26: Board Games
drumforce Posted 21 days ago 21 days
on Day 25: Rockjamparty that synth sounds like stif police tape flailing around from a fixed point Posted 21 days ago 21 days
on Day 25: Rockjamparty
it's like manu chao meets daft punk Posted 21 days ago 21 days
on Day 25: Rockjamparty
those fingers Posted 21 days ago 21 days on Day 25: Rockjamparty
wow Posted 21 days ago 21 days
on Day 25: Rockjamparty
such tiny sounds Posted 21 days ago 21 days
on Day 25: Rockjamparty
goodness gracious this is curious Posted 21 days ago 21 days
on Day 24: Gangtivities (Rough & Abandoned) don't feed hummingbirds stevia. sugar or not at all. it can fuck em up Posted 21 days ago 21 days
on Day 24: Gangtivities (Rough & Abandoned)
these lines hotter than marty's skid marks Posted 21 days ago 21 days
on Day 24: Gangtivities (Rough & Abandoned)
yo Posted 21 days ago 21 days on Day 24: Gangtivities (Rough & Abandoned)
whip ride slip slide Posted 21 days ago 21 days on Day 24: Gangtivities (Rough & Abandoned)
fire as fuck Posted 21 days ago 21 days on Day 24: Gangtivities (Rough & Abandoned)
@oylo: gotta rewind Posted 21 days ago 21 days on Day 24: Gangtivities (Rough & Abandoned)
the pan just fucked. me. up. Posted 21 days ago 21 days on Day 24: Gangtivities (Rough & Abandoned)
gushin Posted 21 days ago 21 days on Day 24: Gangtivities (Rough & Abandoned)
nutbustinbass Posted 21 days ago 21 days on Day 24: Gangtivities (Rough & Abandoned) dk64 Posted 21 days ago 21 days
on Day 24: Gangtivities (Rough & Abandoned)
wet Posted 21 days ago 21 days
on ok2222 x j'san. - my world
i absolutely love this Posted 24 days ago 24 days on Clarity - Gould X Ok2222 Ft. Blayne B. & Peezy
this is mad dope Posted 24 days ago 24 days
on last goodbye
breathy lust Posted 24 days ago 24 days
on harsh
this sound is butter to my ears Posted 24 days ago 24 days
on Fakes (feat. Mo Vibez) tight Posted 25 days ago 25 days
on ADIIDAS | LAKE TAHOE [YOUR EDM PREMIERE]
spooky Posted 25 days ago 25 days
on New Ting feat. Ye Ali (Dabow Remix)
oddly tight Posted 25 days ago 25 days on Day by Day (feat. Sam Hudgens & Omar Apollo)
sweet mercy Posted 25 days ago 25 days
on Day 23: Nightfall
I'll be back Posted 26 days ago 26 days
on Day 23: Nightfall
smug grin at this point Posted 26 days ago 26 days
on Day 23: Nightfall
now I'm fucking cheesing Posted 26 days ago 26 days
on Day 23: Nightfall
I'm just sitting here smiling Posted 26 days ago 26 days
on Day 23: Nightfall
great work my friends Posted 26 days ago 26 days
on Day 23: Nightfall
life's a breeze, living's hard Posted 26 days ago 26 days
on Day 23: Nightfall
summer cyber boating floating and coasting type vibes Posted 26 days ago 26 days
on Day 23: Nightfall
I really fuck with this Posted 26 days ago 26 days
on Day 22: Sudden gorgeous synth, almost like a beautiful alien creature crying out in pain... not to say that would be gorgeous, but I would appreciate its song Posted 26 days ago 26 days
on Day 22: Sudden
are those blip spurts 808s bc damn Posted 26 days ago 26 days
on Day 22: Sudden
brainwashed haunting Posted 26 days ago 26 days
on Day 21: Nightcrawler ft. Seth
elegant ending Posted 26 days ago 26 days
on Day 21: Nightcrawler ft. Seth
awesome pump Posted 26 days ago 26 days
on Day 21: Nightcrawler ft. Seth damn this is really sick! this is the kind of music I listened to when I first discovered electronic music Posted 26 days ago 26 days
on Day 21: Nightcrawler ft. Seth paris grime Posted 26 days ago 26 days
on Day 20 - MJ
so punctual Posted 26 days ago 26 days
on Day 20 - MJ shakers basically massaging my scalp Posted 26 days ago 26 days
on Day 20 - MJ
w- huh Posted 26 days ago 26 days
on Day 20 - MJ
fucking wiiiip Posted 26 days ago 26 days
on Day 20 - MJ
slammajammawhambam Posted 26 days ago 26 days
on Day 20 - MJ
oh Posted 26 days ago 26 days on Day 19: Lost & Awake w/ Hadiya and Naomi the Goddess
bruh these lyrics are deep Posted 26 days ago 26 days on Day 19: Lost & Awake w/ Hadiya and Naomi the Goddess
%_____% " Posted 26 days ago 26 days
on Day 18: Speakeasy
<3 Posted 26 days ago 26 days
on Day 18: Speakeasy
glitch funk farm amirite Posted 26 days ago 26 days
on Day 18: Speakeasy
daring break too, I'm still dug tho Posted 26 days ago 26 days
on Day 18: Speakeasy
majestic sweeping Posted 26 days ago 26 days
on Day 17 : Lost & Found
those keys... you really have a distinct style my man Posted 26 days ago 26 days
on Day 17 : Lost & Found
ss Posted 26 days ago 26 days
on Day 17 : Lost & Found
put a little more ice in my gladd please Posted 26 days ago 26 days
on Day 16: You've Got Your Friends Too
magnificent... Posted 26 days ago 26 days
on Day 16: You've Got Your Friends Too whoa, never thought about underwater fireworks before Posted 26 days ago 26 days
on Day 16: You've Got Your Friends Too
y'all needa dust your record Posted 26 days ago 26 days on Day 15: OT (3lo remix) #2
savagery Posted 26 days ago 26 days
on Day 15: OT (3lo remix) #2
imgur.com/a/kKYcU Posted 26 days ago 26 days
on Day 15: OT (3lo remix) #2
do you want to see the face I just made Posted 26 days ago 26 days
on Day 14: bac|kin|the|day
this is what's going to be playing at the 100 years of 3lo anniversary remembrance parade Posted 26 days ago 26 days
on Day 14: bac|kin|the|day
@jordan-michael-319633832: hanging on is half the ride, loosen your harness man Posted 26 days ago 26 days
on Day 13: After Dark Remix (3lo Bedtime Story)
sick Posted 26 days ago 26 days
on Day 13: After Dark Remix (3lo Bedtime Story) this whole time I thought someone was knocking at the door but now I realize it's part of the song. I was ghostin whoever coulda been at the door lol Posted 26 days ago 26 days
on Day 13: After Dark Remix (3lo Bedtime Story)
he said whoO0ºp Posted 26 days ago 26 days
on Day 13: After Dark Remix (3lo Bedtime Story)
unf Posted 26 days ago 26 days
on Day 13: After Dark Remix (3lo Bedtime Story)
massive tune Posted 26 days ago 26 days
on Day 12: DNA
that tiny little melody sure knows how to be cute Posted 26 days ago 26 days
on Day 12: DNA
here I am, in a $2.50 michael's t-shirt Posted 26 days ago 26 days
on Day 12: DNA
did not expect Posted 26 days ago 26 days
on Day 12: DNA
sanglo Posted 26 days ago 26 days
on Day 11: 3lo & Passport Pronto - 100 Ways
it is that sound Posted 26 days ago 26 days
on Day 11: 3lo & Passport Pronto - 100 Ways
yeaah well done Posted 26 days ago 26 days
on Day 11: 3lo & Passport Pronto - 100 Ways
real talk Posted 26 days ago 26 days on Day 10: On Smash ft. Atlas Greene & Hadiya
this is so tight Posted 26 days ago 26 days
on Day 10: On Smash ft. Atlas Greene & Hadiya
yall allllll got it on smash Posted 26 days ago 26 days
on Day 10: On Smash ft. Atlas Greene & Hadiya
daaaaaaamn they sure do Posted 26 days ago 26 days
on Day 10: On Smash ft. Atlas Greene & Hadiya
!what the he just woke up out the matrix Posted 26 days ago 26 days
on Day 10: On Smash ft. Atlas Greene & Hadiya
$ $ $ Posted 26 days ago 26 days
on Day 10: On Smash ft. Atlas Greene & Hadiya
good god, atlas killing it too Posted 26 days ago 26 days
on Day 10: On Smash ft. Atlas Greene & Hadiya rjFDWHVBIR4WY3V8CF3HWFUIEEu98¥ºzbef Posted 26 days ago 26 days on Day 10: On Smash ft. Atlas Greene & Hadiya
wow Posted 26 days ago 26 days
on Day 10: On Smash ft. Atlas Greene & Hadiya
hadiyaaaaaaaaa Posted 26 days ago 26 days
on Day 9: 1oh3
perfect formula Posted 26 days ago 26 days
on Day 9: 1oh3
<.< it's a little too good...... >.> Posted 26 days ago 26 days
on Day 8: John.k - OT(3lo Remix) here in the jungle we soothe and improve Posted 26 days ago 26 days
on Day 8: John.k - OT(3lo Remix)
unearthly Posted 26 days ago 26 days on Day 8: John.k - OT(3lo Remix)
softly speckled with supernatural movement Posted 26 days ago 26 days
on Day 7: The Day of Rest
them chords are pure juice btw Posted 26 days ago 26 days
on Day 7: The Day of Rest this was the perfect song to unload the dishwasher to. it felt like I was in a disney movie and all of my movements were distinct and exaggerated Posted 26 days ago 26 days
on Day 6: Bird contrary to popular belief eagles don't make the screeching sound they are associated with fun factoid with ur boiylo Posted 26 days ago 26 days
on Day 6: Bird
mountainous Posted 26 days ago 26 days
on Day 6: Bird
the spread... Posted 26 days ago 26 days
on Day 6: Bird
word Posted 26 days ago 26 days
on Day 6: Bird
spicyy Posted 26 days ago 26 days
on Day 5: Navy
picturing the hardest spiderman chase seen rn Posted 26 days ago 26 days
on Day 5: Navy
mob shit Posted 26 days ago 26 days
on Day 4: GK&A
the sponky ones ooh Posted 26 days ago 26 days
on Day 4: GK&A the fucking drum rolls in the background *"mwah!" removes pinched fingers from lips* Posted 26 days ago 26 days
on Day 4: GK&A
sly cooper Posted 26 days ago 26 days
on Day 4: GK&A
slick too Posted 26 days ago 26 days
on Day 4: GK&A
drumwork too sick Posted 26 days ago 26 days
on Day 4: GK&A
no lie Posted 26 days ago 26 days
on Day 4: GK&A these stabs just made me shiver Posted 26 days ago 26 days
on Day 4: GK&A
lol i'm about to get down Posted 26 days ago 26 days
on Day 4: GK&A
o h F U C K Posted 26 days ago 26 days
on Day 3: Move Along ft. Flight Coach
lol feel like I'm bout to rp 20 tunes Posted 26 days ago 26 days
on Day 3: Move Along ft. Flight Coach
unreal amounts of energy Posted 26 days ago 26 days
on Day 3: Move Along ft. Flight Coach
fucking heat yall this track is so thick Posted 26 days ago 26 days
on Day 3: Move Along ft. Flight Coach this should have been the robot unicorn attack song not erasure Posted 26 days ago 26 days
on Day 3: Move Along ft. Flight Coach
rad soundscapes approaching from all directions Posted 26 days ago 26 days
on Day 3: Move Along ft. Flight Coach
inside of my face Posted 26 days ago 26 days
on Day 3: Move Along ft. Flight Coach bahahaha this bassline is literally laughing in my face Posted 26 days ago 26 days
on Day 3: Move Along ft. Flight Coach
throat closed Posted 26 days ago 26 days
on Day 3: Move Along ft. Flight Coach
work that synth good god Posted 26 days ago 26 days
on Day 2: Bad Jane
bb Posted 26 days ago 26 days
on Day 2: Bad Jane
oof Posted 26 days ago 26 days on Day 2: Bad Jane
b o y s what the actual fuck am I listening to Posted 26 days ago 26 days
on Day 2: Bad Jane
when the vocal gets crushed I can feel the prenut Posted 26 days ago 26 days
on Day 2: Bad Jane
this is like magic Posted 26 days ago 26 days
on Day 2: Bad Jane
I just wish I had this kind of understanding of music Posted 26 days ago 26 days
on Day 1: Anna
starlight metro bullet train dazed days Posted 26 days ago 26 days
on Day 1: Anna
wow Posted 26 days ago 26 days on Day 1: Anna
bumpin Posted 26 days ago 26 days
on Day 1: Anna
okay it's time Posted 26 days ago 26 days
on Fiona Coyne - pooldad remix
saint pooldad Posted 1 month ago 1 month
on Skintrest - SOMETHING (pooldad remix)
spanknasty clobberinh Posted 1 month ago 1 month
on Skintrest - SOMETHING (maxwell remix)
@skintrest: will dooo Posted 1 month ago 1 month
on Overload & Powerup - Raid
@weareoverload: jigsaw + dr. octopus + a pavelow Posted 1 month ago 1 month on IGOTSUMDROP
word Posted 1 month ago 1 month
on damn im dying in a vat in the garage
working my ears huh Posted 1 month ago 1 month
on damn im dying in a vat in the garage
u got another vat? Posted 1 month ago 1 month
on damn im dying in a vat in the garage
be right there Posted 1 month ago 1 month
on 011 - A Stranger Things Tribute everybody and their mom made a stranger things track. what was I thinking... I should've done one Posted 1 month ago 1 month
on Preoccupied (prod. tobi lou, Maximilian & Tessellated)
sure do Posted 1 month ago 1 month on lemon - n.e.r.d. & rihanna moedoisnice remix
damn this is hot though Posted 1 month ago 1 month
on - Outro
bruhh Posted 1 month ago 1 month
on - Outro
like I'm bout to drop the potato hot Posted 1 month ago 1 month
on - Outro
this is super hot Posted 1 month ago 1 month
on AWAY - Honest To Gød (feat. Charity)
sick Posted 1 month ago 1 month
on 21212121212
I had suspicions a couple years ago, can you lay them to rest pls Posted 1 month ago 1 month on 21212121212
wait another minute! is wooly cast? Posted 1 month ago 1 month
on 21212121212
wait a minute this is cast music?? Posted 1 month ago 1 month
on 21212121212
unique idea. appreciated Posted 1 month ago 1 month
on Baron Fields - Lindsey Wallace
link mollywhopping mr. meyers Posted 1 month ago 1 month
on no love
great piece of work Posted 1 month ago 1 month
on no love no disrespect bro but are you singing with water in your mouth Posted 1 month ago 1 month
on Mr. Shadowman ft. Faerie elegant fingerwork on them strings goodness Posted 1 month ago 1 month
on Mr. Shadowman ft. Faerie
the clap is so perfect Posted 1 month ago 1 month
on Mr. Shadowman ft. Faerie
hair on my neck just stood up when that harmony hit... Posted 1 month ago 1 month
on Mr. Shadowman ft. Faerie spacious. thick with western exploration at dusk in slow motion Posted 1 month ago 1 month
on Tsuruda - S O S
... ___ ... Posted 1 month ago 1 month
on trappin in the upside down
this kinda makes me wanna play portal Posted 1 month ago 1 month
on trappin in the upside down jinkies! Posted 1 month ago 1 month
on $MilesG the Skee God - 3 Pints (prod. ThatBoySlim)
damn that's a thick as blunt, must be a wood Posted 1 month ago 1 month
on $MilesG the Skee God - 3 Pints (prod. ThatBoySlim)
yit brh ay Posted 1 month ago 1 month
on sufer with me
overclocked Posted 1 month ago 1 month
on Big Party
0o0 Posted 1 month ago 1 month
on San Holo - I Still See Your Face (Lotus Remix)
this part right here... I am gotten wow Posted 1 month ago 1 month on Missy Elliott - WORK IT (Brad Braxton Kuduro Flip) (Audio) [❤ CLICK BUY TO DOWNLOAD ❤] this is funky Posted 1 month ago 1 month
on Skintrest - SOMETHING (maxwell remix) super unique. you've inspired me to do some wonky shit rn, and also to visit skintrests page Posted 1 month ago 1 month
on mutiny. w/ memphis.
@abyssus-erigo: haven't heard it before, but it fit well Posted 1 month ago 1 month
on STARSTRUCK
pretty dope Posted 1 month ago 1 month
on Overload & Powerup - Raid
fuck Posted 1 month ago 1 month
on mutiny. w/ memphis.
awesome lyricism. nice vibe Posted 1 month ago 1 month
on Bodak Black nice work Posted 1 month ago 1 month
on Bodak Black
only time this song has ever been bearable Posted 1 month ago 1 month
on Close gate
I feel it Posted 1 month ago 1 month
on used to know
lol I am blown away every time I listen to this Posted 1 month ago 1 month
on Sanctuary
IT FUCKING WHIPS SO HARD Posted 1 month ago 1 month
on Sanctuary hahahahaahahahahahah WHAT IN THE ACTUAL FUCKING Posted 1 month ago 1 month
on Infrared - Prism %_% Posted 1 month ago 1 month
on Why Did You (Remix)
I need to take a shower Posted 1 month ago 1 month
on Why Did You (Remix) you filthy fucking mud monster Posted 1 month ago 1 month
on Why Did You (Remix)
he protecc he attacc he wobb Posted 1 month ago 1 month
on Why Did You (Remix)
he can dub...... Posted 1 month ago 1 month
on Dusk (feat. Slyleaf)
like it has it's own intelligence Posted 1 month ago 1 month
on Dusk (feat. Slyleaf)
production quality is insane Posted 1 month ago 1 month
on ALL-AMERIKKKAN OPU$
fuck ok time to follow Posted 1 month ago 1 month
on Deathcamp (Shadient Remix [Infrared Edit])
thanks for reposting this @sadkey Posted 1 month ago 1 month
on Deathcamp (Shadient Remix [Infrared Edit])
oh tight Posted 1 month ago 1 month
on Deathcamp (Shadient Remix [Infrared Edit])
I am really fucking digging this Posted 1 month ago 1 month
on Lit Lords - Crowd Control (Original Mix) why do people put original mix in the title? is that not assumed with "(___ remix)" left of? bc I'm pretty sure it is Posted 1 month ago 1 month
on MASK (prod. @prodbySora)
nice nice nice Posted 1 month ago 1 month
on FuckOnMe (prod 4evr)
for life Posted 1 month ago 1 month
on ҰҞҞҤҞҧҝ Ңҧ ҥҚ (w/ AMNYST) is the title made of unicode characters or are they just spaced capital letters Posted 1 month ago 1 month
on Pretense
yo been meaning to ask are you circuit city uk on twitter now Posted 1 month ago 1 month
on Gucci Gang
pu$$y $quad Posted 1 month ago 1 month
on Way Out [album out now]
kuro kuro Posted 1 month ago 1 month
on holding on to memories
I feel this Posted 1 month ago 1 month
on you've damaged me (prod. white shinobi x gin$eng, video in description!)
tormentationified Posted 1 month ago 1 month
on brand new hoe (prod. cor blanco)
I like my baby carrots with raunch Posted 1 month ago 1 month
on Johnny Clouds - Bang (Prod By skullkid & echos)
@thomhannum_skullkid: part of a nutritious breakfast Posted 1 month ago 1 month
on Quiet Friend - Safe
nice one m8 Posted 1 month ago 1 month
on dust never huf keyboard dust spray. that's the fastest way to kill your brain cells kids. the more yoiu0 knooo-000oww Posted 1 month ago 1 month
on R3HAB & Waysons - Shanghai boy i'm gon' need some rehabilitation after this Posted 1 month ago 1 month
on NO TIME
7 7 7 7 7 Posted 1 month ago 1 month
on junglecat/firebyrd
good shit Posted 1 month ago 1 month
on nobody (Prod. false cut)
tight Posted 1 month ago 1 month
on Ekali Triple J Mixup 2.0
yuhhhh Posted 1 month ago 1 month
on BGOTW
I wanna try doing some layered, chopped, pitched vocal work with some middle eastern samples Posted 1 month ago 1 month
on BGOTW I can hear the hats walking across my keyboard (macbook speakers) Posted 1 month ago 1 month
on Yesterday, in Tokyo
reboot Posted 1 month ago 1 month
on Yesterday, in Tokyo
going in, left the atrium Posted 1 month ago 1 month
on Yesterday, in Tokyo
cracking freshies under the palm trees Posted 1 month ago 1 month
on Yesterday, in Tokyo
electric paradise Posted 1 month ago 1 month
on givin me a rush
these chords are chasing my soul around inside my chest Posted 1 month ago 1 month
on Brandon fraser wicked Posted 1 month ago 1 month
on before you know it
good god the stereo spread on this is awful Posted 1 month ago 1 month
on SoundPatrol & oylo - Shimmer
boii @sound-patrol Posted 1 month ago 1 month
on lost symbols [SIDE A]
wonderland Posted 1 month ago 1 month
on It Ate Me Alive
evil Posted 1 month ago 1 month
on see you around
* Posted 1 month ago 1 month
on see you around dope bump. vocal sits pretty nicely in that fluid dent Posted 1 month ago 1 month
on my life is not important here
keep it up olmatri Posted 1 month ago 1 month
on In Paris
right on Posted 1 month ago 1 month
on LOW TAPE - NY CITY SUNRISE someone call the police because this beat is packing heat Posted 1 month ago 1 month
on Shattered Glass (Open for Collab and download)
space age intricacies delicacies and gemsoverseas Posted 1 month ago 1 month
on Mountains
the good stuf Posted 1 month ago 1 month
on SUMMER SOLSTICE - ProgRockDan & Styrmonix
much appreciated. good vibes Posted 1 month ago 1 month
on PAINT
kept me interested. nice work Posted 1 month ago 1 month
on Olu Bliss - Dive in (Johnny Clouds Remix)
smooth, vibrant, relaxing Posted 1 month ago 1 month
on boredom (whereisalex remix)
righteous Posted 1 month ago 1 month
on No Questions (feat. Njomza)
I'm feeling it Posted 1 month ago 1 month
on Sunny D ft. Tony Soul (Prod. Nnaye)
chilly in here? Posted 1 month ago 1 month
on Milk & Cookies
@nnaye: you have some beautiful hands and ears friend Posted 1 month ago 1 month on Milk & Cookies
this is fire as fuck my guy Posted 1 month ago 1 month
on Milk & Cookies surrounded by sass and future and talent and tales being told Posted 1 month ago 1 month
on Milk & Cookies
encroaching on my canal Posted 1 month ago 1 month
on Milk & Cookies
solid piece of work here dude Posted 1 month ago 1 month
on capshun - plex
dunk mafuck Posted 1 month ago 1 month
on overtime
reptilian bassline Posted 1 month ago 1 month on feellikecarmack.
space age ppontan Posted 1 month ago 1 month on Melt (feat. JUSTEND) || VIDEO OUT NOW at DESCRIPTION
real movement Posted 1 month ago 1 month on Melt (feat. JUSTEND) || VIDEO OUT NOW at DESCRIPTION
bless the fuck up Posted 1 month ago 1 month
on Gravity distortion
this part is haunting me Posted 1 month ago 1 month
on Gravity distortion
beautiful kick Posted 1 month ago 1 month
on Gravity distortion
sub fatter than my nutt Posted 1 month ago 1 month on Gravity distortion
icy waves Posted 1 month ago 1 month
on fame us
@user-70495223: thanks! Posted 1 month ago 1 month
on 8900 GULLY
squad up Posted 1 month ago 1 month on Mile A Min- KXYO Ft French Loso(Prod. by Serge Crown)
madness Posted 1 month ago 1 month
on Mo Vibez & Explore - What I Need
fantastic work Posted 1 month ago 1 month
on fame us
@mrclutch3000: <3 Posted 1 month ago 1 month
on fame us @user-262019520: thank you lena! Posted 1 month ago 1 month
on bad sex
unreal Posted 1 month ago 1 month
on ride
waves Posted 1 month ago 1 month
on momma told me
gotta follow Posted 1 month ago 1 month
on 02 03 17
aye Posted 1 month ago 1 month
on i want to go
take me with you Posted 1 month ago 1 month
on something, something. <3 love Posted 1 month ago 1 month
on BRAINFOREST
$ $ $ Posted 1 month ago 1 month on Sapboys - THE SAP IS IT (ache Remix)
^^ Posted 1 month ago 1 month on Sapboys - THE SAP IS IT (ache Remix)
damnnnn Posted 1 month ago 1 month
on sure don't
@v_o_r_d: thanks for listening! Posted 1 month ago 1 month
on rested
@dukeseager: <3 Posted 1 month ago 1 month
on sure don't
@dukeseager: thanks duke! Posted 1 month ago 1 month
on Bic Boi (prod. by Austie A)
@whoiskev: wait a little longer >:) Posted 1 month ago 1 month
on Camo Columbo - Alive
@lamusice: happy to be here Posted 1 month ago 1 month
on sure don't
@sundaug: appreciate the kind words! Posted 1 month ago 1 month
on fame us
@sundaug: thank you! Posted 1 month ago 1 month
on would you kindly?
@sundaug: bless up Posted 1 month ago 1 month
on ҰӁҾӋҾҀӏҾ Ҳӈӎ ҠӈӇҾҘ
cooked Posted 1 month ago 1 month
on jntbts. ~ rainy days
good vibrations Posted 1 month ago 1 month
on Camo Columbo - Alive goodness gracious. incredible tune Posted 1 month ago 1 month
on Slack Bubbling
juicy fruit Posted 1 month ago 1 month
on Slack Bubbling
fruit juice Posted 1 month ago 1 month
on would you kindly?
@evo2raw: much love! Posted 1 month ago 1 month
on knowledge
@juanofcial: thanks! Posted 1 month ago 1 month on sure don't
@whatsandwheres: thank you thank you Posted 1 month ago 1 month
on try (demo)
@trapnshit: sorry man, just had to move on. once I hit that point where I can't work on in any longer I just have to stop. losing inspiration kills a track so fast Posted 1 month ago 1 month
on try (demo)
@trapnshit: soundcloud.com/oylo/try-demo-full-wip/s- JWMwn Posted 2 months ago 2 months
on try (demo)
@trapnshit: yo my fault, I forgot, but I'm doing it now Posted 2 months ago 2 months
on sure don't
@hearteyes: thanks! it's a processed version of my slamming my fist on the desk Posted 2 months ago 2 months
on All to Myself (w/ falcxne) geekin Posted 2 months ago 2 months
on Resonance (ft Sofasound )
god damn Posted 2 months ago 2 months
on Resonance (ft Sofasound )
wow guys Posted 2 months ago 2 months
on Resonance (ft Sofasound )
oof Posted 2 months ago 2 months
on My Girl.
@nicciwho: was gud Posted 2 months ago 2 months
on Bass Cannon
@y4nn: I did rp, but only for like a day. great tune fam Posted 2 months ago 2 months
on $hawty Bad (prod by Eukalyptus) tight Posted 2 months ago 2 months
on $hawty Bad (prod by Eukalyptus)
I like the ride Posted 2 months ago 2 months on Questionz (prod. by Chuck Strangers)
too good Posted 2 months ago 2 months on Questionz (prod. by Chuck Strangers)
he's on Posted 2 months ago 2 months on Questionz (prod. by Chuck Strangers)
damn fuckk this beat is hot Posted 2 months ago 2 months
on Hit Da Brakez (prod. by Eukalyptus)
same Posted 2 months ago 2 months
on Wraith (prod. by Ashe)
wicked spread Posted 2 months ago 2 months
on Wraith (prod. by Ashe)
zoomin Posted 2 months ago 2 months
on Bic Boi (prod. by Austie A)
... Posted 2 months ago 2 months
on Bic Boi (prod. by Austie A)
this is so fucking chill dude Posted 2 months ago 2 months
on A M A I - MELANIE IN A DREAM
misty encounters Posted 2 months ago 2 months
on Sorbet (prod. By Sango) what a tune... we all need to make more unique music! Posted 2 months ago 2 months
on JT Soul - Down The Silhouette Road (jamvvis Remix)
yaaaaas Posted 2 months ago 2 months
on jean shorts vip 1.5
that was absolutely nuts Posted 2 months ago 2 months
on I'm Good (Prod. by DOPAM!NE)
love the message. song is pure heat Posted 2 months ago 2 months
on Honey
what in the world this is so sick Posted 2 months ago 2 months
on NIGHT GRIND - MY LIFE
tight Posted 2 months ago 2 months on Look At Me Freestyle stoney bonez ft o.c.t. javi
n i c e Posted 2 months ago 2 months
on NEW JERUSALEM (VI$UAL IN DESCRIPTION)
this is awesome. really enjoying the vibe Posted 2 months ago 2 months on Holly x Skope - Plasticity
this was a wild ride guys Posted 2 months ago 2 months
on TRON3X x HVYW8 - Clash [Free Download]
that was pretty dope Posted 2 months ago 2 months
on Sadkey - Further (VALENTINE Remix)
holy fucking shit Posted 2 months ago 2 months on VALENTINE & 4AM - Us (feat. Naji) [Stereo Cube Remix]
legendary Posted 2 months ago 2 months
on oceans deep
w o w Posted 2 months ago 2 months
on try (demo)
@trapnshit: I got you when I get to my hard drive Posted 2 months ago 2 months on ey ma
sick Posted 2 months ago 2 months
on Dwyer - New Day
nice track d Posted 2 months ago 2 months
on Halpe - Dreamcast ayyy idk why soundcloud playing all these oldies for me rn but I am not tryna stop it Posted 2 months ago 2 months
on try (demo)
@trapnshit: LOL I actually have a longer version I can send you if you want but I don't have the motivation to work on this one anymore haha Posted 2 months ago 2 months
on Flight |prod Monte Booker|
@osimac: dm me fam Posted 2 months ago 2 months
on B A Y N K
@its_the_anka: HANHKAHA Posted 2 months ago 2 months
on taking over
@user-363483686: thanks man Posted 2 months ago 2 months
on Wicked Game (prod. Strehlow)
the bells got me Posted 2 months ago 2 months
on Wicked Game (prod. Strehlow)
awesome work. nice sound fam Posted 2 months ago 2 months
on How Do You Know
mystical melodies and glued drive line love love love Posted 2 months ago 2 months
on Lights Out (feat Ayelle)
$$$ Posted 2 months ago 2 months
on GREEZE - KITCHEN greeze your flow thicker than london's sewer's grease clog's flow Posted 2 months ago 2 months
on Beamon - So Much Pain (produced by jvst x & Wyt)
@thebeamon: eatin nothin but cloutless goons Posted 2 months ago 2 months
on BLOODCODE% POOLDAD⭐ 32 BIT DREAMS⚡ FEAT. SOFTPROXY(
sky high Posted 2 months ago 2 months
on B A Y N K
@skug-1: me too bro me too Posted 2 months ago 2 months
on B A Y N K
@evanbreezewood: ^ Posted 2 months ago 2 months
on B A Y N K
A N K Y B Posted 2 months ago 2 months
on ANDREW
what's up brothel Posted 2 months ago 2 months
on Stuck To You stab me a couple hundred more times I dare you Posted 2 months ago 2 months
on Beamon - So Much Pain (produced by jvst x & Wyt)
loaded Posted 2 months ago 2 months
on Beamon - So Much Pain (produced by jvst x & Wyt)
beamon on that ultra diet Posted 2 months ago 2 months
on Sonder
holy moly man chill down Posted 2 months ago 2 months
on Cassie - Me And U (VAGUE003 Flip)
bring in the tech yuh fuck me up Posted 2 months ago 2 months
on Cassie - Me And U (VAGUE003 Flip)
related: this song make me wanna milk my dick Posted 2 months ago 2 months
on Cassie - Me And U (VAGUE003 Flip)
unrelated: who got them other vague00n accounts? Posted 2 months ago 2 months
on Bass Cannon
777 Posted 2 months ago 2 months
on Bass Cannon
lol jk i so am Posted 2 months ago 2 months
on Bass Cannon
I'm not even gonna repost this shit Posted 2 months ago 2 months
on Bass Cannon
done with you Posted 2 months ago 2 months
on Bass Cannon hahaahahahahahahh I AM SO HAPPY THIS SAMPLE JUST CAME IN THANK YOU YANN Posted 2 months ago 2 months
on Bass Cannon
let the bass cannon kick it Posted 2 months ago 2 months
on 92elm Sample Pack - $10 (Demo 2)
okay okay I see you Posted 2 months ago 2 months
on See Me
call 911 Posted 2 months ago 2 months
on See Me
I think my heart just stopped Posted 2 months ago 2 months
on Capital Cities - Vowels (Robotaki Remix) hell yeah boy we're wiggin and jivin on this block Posted 2 months ago 2 months
on Graduate
congratulations! already winning with this tune Posted 2 months ago 2 months on Flight |prod Monte Booker|
great combo Posted 2 months ago 2 months
on Ike - Juniper
world peace is round that corner we can do this Posted 2 months ago 2 months
on Bic Boi (prod. by Austie A) just vaporized my mouse with my beast of an index finger Posted 2 months ago 2 months
on Bic Boi (prod. by Austie A)
I'm about to hit this repost so hard Posted 2 months ago 2 months
on Bic Boi (prod. by Austie A)
ahahhh Posted 2 months ago 2 months
on Bic Boi (prod. by Austie A)
the fucking lazy harmonies are sooo dope Posted 2 months ago 2 months on Bic Boi (prod. by Austie A)
@oylo: vibe x3 Posted 2 months ago 2 months
on Bic Boi (prod. by Austie A)
vibe Posted 2 months ago 2 months
on Bic Boi (prod. by Austie A)
careless vibe but not a missed beat Posted 2 months ago 2 months
on Bic Boi (prod. by Austie A)
damn this is tight Posted 2 months ago 2 months
on Babywipe
yeaheaheaheaheahhhh I loooooooove this track Posted 2 months ago 2 months
on Babywipe the instruments in the back are so sassy and animated hahah they're basically wiggin their finger at me and cocking their heads back and forth Posted 2 months ago 2 months on Babywipe
good vibes all day Posted 2 months ago 2 months
on Jackal - Empathy
damn this synth right here driftin round snatchin souls and grinding them into icy plasma crystals Posted 2 months ago 2 months
on worry
very unique. keep coming with the fresh ideas Posted 2 months ago 2 months
on My Girl.
chromomcoincioc Posted 2 months ago 2 months
on Cofee and Dabz sensual and soothing. like eucalyptus vapor rub cream coating my inner ear Posted 2 months ago 2 months
on Avicii - Without You (Fareoh Remix)
them drums pop like a nice tight booty Posted 2 months ago 2 months
on Avicii - Without You (Fareoh Remix)
I can feel my arm hair buzzing Posted 2 months ago 2 months
on STARLIGHT
dojo mollywhopping us with his diverse set of skills Posted 2 months ago 2 months
on bc.einstein ~ i love u
wonderful Posted 2 months ago 2 months
on lissy ~ murdah mafs
alienated Posted 2 months ago 2 months
on bc.einstein x twuan & chief. ~ sexaphone god damn... I can't describe the way I feel about this in one word Posted 2 months ago 2 months
on uinta & Constellations ~ Orbitai
glorious Posted 2 months ago 2 months
on kudo ~ first train
wavy Posted 2 months ago 2 months
on daju ~ typical
energetic Posted 2 months ago 2 months
on snack ~ downtown at night
fresh Posted 2 months ago 2 months
on chief. & flavors ~ bug
spooky Posted 2 months ago 2 months
on b0nds ~ fantastik fantasees
saucy Posted 2 months ago 2 months on twuan & b0nds ~ dead presidents
creamy Posted 2 months ago 2 months on twuan & lissy ~ ling thribble
spacey Posted 2 months ago 2 months
on Big Trouble - Alec Good
ayyeee Posted 2 months ago 2 months
on Luv Me (Prod. LMC)
damn Posted 2 months ago 2 months
on Luv Me (Prod. LMC)
this beat is hot Posted 2 months ago 2 months
on Warmth In Winter
so warm Posted 2 months ago 2 months on Moonlight Sonata Theme ~~ Ludwig van Beethoven
I'm a sucker for this Posted 2 months ago 2 months on The Departure - Max Richter (The Leftovers), With A Twist
@user-958353156: no worries. thanks for listening Posted 2 months ago 2 months
on The Departure - Max Richter (The Leftovers), With A Twist
@user-958353156: hahah I'm sorry man but you didn't even listen to any of my music... you reposted like 5 songs in 1 minute... I'm here to support the music, not the stats... Posted 2 months ago 2 months
on The Departure - Max Richter (The Leftovers), With A Twist
@user-958353156: you gotta repay the favor first my guy. I can't just be reposting everything I get asked to repost, I'd have no followers left! Posted 2 months ago 2 months on Get Money (feat Maniyakk, & DopetheRuler) (VIDEO IN DESCRITION)
damnnn more heat! soundcloud still vibing y'all Posted 2 months ago 2 months
on Purpose.
well worth the listen Posted 2 months ago 2 months
on The Departure - Max Richter (The Leftovers), With A Twist you built so much emotion Posted 2 months ago 2 months
on SOMETIMES, I
awesome vocal work. very unique Posted 2 months ago 2 months
on Subside
@laxcitymusic: bro you have some heat on your side account... Posted 2 months ago 2 months
on Call Me On My SideKick
the way my body feels Posted 2 months ago 2 months
on Call Me On My SideKick
^me after listening to this song Posted 2 months ago 2 months
on Call Me On My SideKick
my fucking god bring her home oh yes Posted 2 months ago 2 months
on Call Me On My SideKick
#alwaysill Posted 2 months ago 2 months
on Call Me On My SideKick now he up here brushin shoulder with the big wig cats in suits smoking cigars Posted 2 months ago 2 months
on Call Me On My SideKick
that cartoon character climbed that ladder so quick Posted 2 months ago 2 months
on Call Me On My SideKick
real hop Posted 2 months ago 2 months
on Full Circle (w/ MISOGI)
daaaaaaaaayuuuuum Posted 2 months ago 2 months
on not strong (at all)
the percussion is choice af Posted 2 months ago 2 months
on not strong (at all)
damn bro this is charged up Posted 2 months ago 2 months
on Round - Be Trace
this fucking rides Posted 2 months ago 2 months
on Subside
way out there. what happened to creativity? all these other dudes making 100 versions of the same beat Posted 2 months ago 2 months
on King Of Hearts w/ Tendayi
good mother of fuck Posted 2 months ago 2 months
on Your Own Company
wonderful Posted 2 months ago 2 months
on Your Own Company northern european distant hill ride on the outskirts of magic city Posted 2 months ago 2 months
on Your Own Company take me along in your sidecar Posted 2 months ago 2 months
on Your Own Company
can't cry fast enough Posted 2 months ago 2 months
on Your Own Company
tear ducts just combusted Posted 2 months ago 2 months
on Catch Me (feat. Sherry W)
oof Posted 2 months ago 2 months
on Catch Me (feat. Sherry W)
wow Posted 2 months ago 2 months
on Catch Me (feat. Sherry W)
7 7 7 y'all hit the fucking J A C K P O T Posted 2 months ago 2 months
on Mad ting
unreal Posted 2 months ago 2 months
on Mad ting
finished Posted 2 months ago 2 months
on Mad ting
I'm fucking stunned Posted 2 months ago 2 months
on hehe flume is so cool
good god Posted 2 months ago 2 months
on hehe flume is so cool wait you have a main channel oh bruh Posted 2 months ago 2 months
on Autumn Keys - Help Laxcity Flip
holy fuck why I'm not following you Posted 2 months ago 2 months
on wake me
intricate Posted 2 months ago 2 months
on wake me
oh my spook Posted 2 months ago 2 months
on this is like an old thing but i think its cool
all I can do is sit here and watch this waveform like Posted 2 months ago 2 months
on this is like an old thing but i think its cool
dog Posted 2 months ago 2 months
on this is like an old thing but i think its cool
this shit is too on point to be real Posted 2 months ago 2 months
on Days Gone
yoo Posted 2 months ago 2 months
on Species ft. Roshima
I mean x is totally right, but fuck I hate his obvious cringey pandering, and with that said, musically that sample fits so fucking well. dope work Posted 2 months ago 2 months on Sofi Tukker - Fucc They (Awoltalk Remix)
powerful Posted 2 months ago 2 months
on Missing Hito - Up And Up
oh my, even nicer Posted 2 months ago 2 months
on Missing Hito - Damn!
nice nice nice nice Posted 2 months ago 2 months
on praises
wow Posted 2 months ago 2 months
on praises
yo Posted 2 months ago 2 months
on thumpalina this is fresher than than bel air's prince Posted 2 months ago 2 months
on Lights Out (feat Ayelle)
<3<3 Posted 2 months ago 2 months
on KRANE - Movin (fire spells Remix)
sick Posted 2 months ago 2 months
on KRANE - Movin (fire spells Remix)
yoooo boy you're killin' this one Posted 2 months ago 2 months
on Zip (Prod By Swamp)
that was hot Posted 2 months ago 2 months on SOUTHSIDE (PROD BY WONDAGURL + RYANJACOB + VNSN)
righteous Posted 2 months ago 2 months
on 䦒樌 [Time] (900K Plays!) | #LMTLESS
you know he had to do it to em Posted 2 months ago 2 months on 䦒樌 [Time] (900K Plays!) | #LMTLESS
clean essence, I like Posted 2 months ago 2 months
on inside-out blues
nothing is more relaxing Posted 2 months ago 2 months
on Zedd feat. Foxes - Clarity Remix by Kaspersen
fresh air over here Posted 2 months ago 2 months
on Zedd feat. Foxes - Clarity Remix by Kaspersen
damn... classic tune, nice twist Posted 2 months ago 2 months
on would you kindly?
@nadrojsirrah: <3 Posted 2 months ago 2 months
on Everlasting Bass (Free Download) beat is so fire. whole track has a fresh retro vibe. genuine. keep this shit up bro Posted 2 months ago 2 months on Everlasting Bass (Free Download) yo wtf how do you get a puzzle of yourself?? that pic looks legit as fuck Posted 2 months ago 2 months
on SANJOMOB ::: INTRO
hard Posted 2 months ago 2 months
on SANJOMOB ::: INTRO
neckhair raising type beat Posted 2 months ago 2 months
on SANJOMOB ::: INTRO
so damn tight bro Posted 2 months ago 2 months
on Serial0003
wicked Posted 2 months ago 2 months
on Serial0003
whoooooaa Posted 2 months ago 2 months on s i m a. but that cute little melody still floating along the way Posted 2 months ago 2 months
on s i m a.
massive Posted 2 months ago 2 months
on LOVIN IT (PROD BY BLANK BODY)
blvc reamin and your wife's creamin Posted 2 months ago 2 months
on LOVIN IT (PROD BY BLANK BODY)
that melody is nasty as fuuuck Posted 2 months ago 2 months
on LOVIN IT (PROD BY BLANK BODY)
the fuck how I missed this Posted 2 months ago 2 months
on DREAMS w/ EPSYLE
awesome piece y'all Posted 2 months ago 2 months on would you kindly?
@austintittel: we've all got irregular tendencies... do you Posted 2 months ago 2 months
on Distance ft. Lil Kray
@austintittel: right back at you fam Posted 2 months ago 2 months
on Distance ft. Lil Kray
lines for dayyyyys. nice work bro Posted 2 months ago 2 months
on YohanFran - Moon
solid production! percs interlock supremely. great mix, great composition, all round dope Posted 2 months ago 2 months
on "Outside" - Cardinal Beats [FREE MP3 DOWNLOAD] nice ride. super relaxing. good me good at 8:08 in the morning Posted 2 months ago 2 months
on Your Heart
this bangs bruh. sick warping Posted 2 months ago 2 months on would you kindly?
@chimmala: thanks for stopping in brother Posted 2 months ago 2 months
on would you kindly?
@spiralizer: <3 Posted 2 months ago 2 months
on would you kindly?
@spiralizer: appreciate the kind words! Posted 2 months ago 2 months
on would you kindly?
@mangalyan-records: thank you kindly Posted 2 months ago 2 months
on would you kindly?
@castle-tough: how are you bro Posted 2 months ago 2 months
on lucid
this is wonderful Posted 2 months ago 2 months on Hennessy (Prod. Owboybeatz) [MUSIC VIDEO IN DESCRIPTION]
trillin Posted 2 months ago 2 months
on VHOOR - Capoeira
ill Posted 2 months ago 2 months
on SAINTS - Blind, I
soothing properties. mad mellow man Posted 2 months ago 2 months
on cheks.
micks. Posted 2 months ago 2 months
on Waterfall (ft. Panama)
tiny toony cutie stabs Posted 2 months ago 2 months
on KarmawiN - Lazy Days [ hip dozer tape #4 ]
relaxed Posted 2 months ago 2 months
on la bound icy Posted 2 months ago 2 months
on Krs. // PBE demo slip slap bop bap put my acreage on the map Posted 2 months ago 2 months
on That Girl f. Gabrielle Aplin
powerful movement Posted 2 months ago 2 months
on Holding Out
pretty melody Posted 2 months ago 2 months
on Octane 91+
I dig the bump. right on Posted 2 months ago 2 months
on Haunting The Underage Room
I want to make something as intense as this Posted 2 months ago 2 months
on Union ft. Dana Kerr deep Posted 2 months ago 2 months
on Prior Stylings
wow Posted 2 months ago 2 months
on Prior Stylings
this is fucking nuts Posted 2 months ago 2 months
on Favorite Thing Remix - DY°BUMP - Gogo Cat NightZ ®EMIX haunting my soul with razor chords and hypnotic metallic bubbling deprivation sensations Posted 2 months ago 2 months
on We Were Alive
in love with this chord progression Posted 2 months ago 2 months
on 4u (Now on Spotify, Apple Music etc !)
wilding out Posted 2 months ago 2 months
on major lift sweet growls, pretty sweeps Posted 2 months ago 2 months
on empyreal ($30 lease - $75 exclusive)
this goes Posted 2 months ago 2 months
on would you kindly?
shouts out bioshock fans Posted 2 months ago 2 months
on Jefe (Rickyxsan Remix)
massive overload Posted 2 months ago 2 months
on going on
nice dives. good vibes. high-fi Posted 2 months ago 2 months
on going on the drums are massaging my brain matter Posted 2 months ago 2 months
on Broke in Silence (Finnstrumental Blues)
@oylo: e Posted 2 months ago 2 months
on Broke in Silence (Finnstrumental Blues)
very nic Posted 2 months ago 2 months
on Broke in Silence (Finnstrumental Blues) kinda gives me a rocking earthworm jim type vibe Posted 2 months ago 2 months
on Broke in Silence (Finnstrumental Blues)
wiggin' out on 'em Posted 2 months ago 2 months
on fame us
@cosmicprank: thank you thank you Posted 2 months ago 2 months
on cocaine+charlie
good shit Posted 2 months ago 2 months
on cocaine+charlie
goose egggggs Posted 2 months ago 2 months
on blstf.
beautiful Posted 2 months ago 2 months
on Forever
sick Posted 2 months ago 2 months
on Jizzjazz
waterwaler Posted 2 months ago 2 months
on Forever
chargin Posted 2 months ago 2 months
on Snakes this shit is so good Posted 2 months ago 2 months
on x
tight Posted 2 months ago 2 months on grey mornings (video in description)
same Posted 2 months ago 2 months on lil prissy ft Lukas - Dancing w/ the Devil
this is hard af Posted 2 months ago 2 months
on Godspeed
fucc Posted 2 months ago 2 months
on Feel You
i fucking dig man Posted 2 months ago 2 months
on circles - April
slop master grime dong Posted 2 months ago 2 months
on Y2K & lil aaron―DAMN―umru remix
classic Posted 2 months ago 2 months on Ramzoid - Covers Ft. Amy J Pryce
rides keep you bobbin Posted 2 months ago 2 months
on Ramzoid - Covers Ft. Amy J Pryce
nice one bro. I really dig the feel Posted 2 months ago 2 months
on fame us
@spinmanfinn: <3 Posted 2 months ago 2 months
on fame us
@spinmanfinn: hahah thank you! Posted 2 months ago 2 months on nandos spicy rice (new sound kit demo)(HAPPY BIRTHDAY 2 ME <3)
yoooooooooooo this is so spicy Posted 2 months ago 2 months
on shotgun
hot gun smoke muz Posted 2 months ago 2 months on Ö - CRISPR - Cas9
so unique Posted 2 months ago 2 months
on Ö - CRISPR - Cas9
what Posted 2 months ago 2 months
on Ö - CRISPR - Cas9
oh fuck this tune just caught me Posted 2 months ago 2 months
on YungJZAisDead - Oh I Know✨ · ˚(ft. SK)(Prod. by Hurtboy AG & YungJZA)
whoa Posted 2 months ago 2 months
on Paul Eubanks - What You Don't
cool flow Posted 2 months ago 2 months
on ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀
duuuude this is fucking nasty Posted 2 months ago 2 months
on see.
@alex-simsky: how have you not run out of upload time yet Posted 2 months ago 2 months
on Fallen For U yo the cover art was kinda of-putting, but I'm glad I stuck it through, good tune Posted 2 months ago 2 months
on FAT CAT BLUES (Alfonso Llorente)
you there! take five minutes and enjoy yourself. take a nice lung-full of oxygen and relax Posted 2 months ago 2 months
on Madegg - Wakaru (Daisuke Tanabe Remix)
appreciate your addition Posted 2 months ago 2 months
on Madegg - Wakaru (Daisuke Tanabe Remix) listening to all the diferent types of music I find in my stream really inspires my own production Posted 2 months ago 2 months
on stardust (ft. ásgeir)
i also like everyone you've collabbed with Posted 2 months ago 2 months
on stardust (ft. ásgeir)
i like you vaud Posted 2 months ago 2 months
on surprise yourself (ft. jack garratt)
oooohh mmmmmmmmymymy Posted 2 months ago 2 months
on this is it (ft. cami)
bruh camiiiiiiiiii Posted 2 months ago 2 months
on say so (ft. ady suleiman) damn idk why you're in my stream rn, but I am appreciating it Posted 2 months ago 2 months
on fate (ft. hanna leess)
@user-920537599: yessirsureis Posted 2 months ago 2 months
on dreaming (ft. ásgeir)
wonderful piece Posted 2 months ago 2 months on Inimicvs, Mo Vibez, WNTR, Three Dog & Creepa - YAA
! ! ! Posted 2 months ago 2 months
on Ballerina
tick tock Posted 2 months ago 2 months
on Ballerina
all day Posted 2 months ago 2 months
on see.
alexico Posted 2 months ago 2 months
on Finding Hope - Loveless (soulecist Remix)
damn this is money Posted 2 months ago 2 months on Venus *
h0t Posted 2 months ago 2 months
on Quasimoto Raw Cuts
glorious Posted 2 months ago 2 months
on wilkjayy x captaincrunch - blow up
hard out the gate Posted 2 months ago 2 months on i think i'm gonna die before i'm 65 ~(prod. by wilkjayy)
oof this dystopian cry Posted 2 months ago 2 months on i don't want to trap anymore ~ (prod. by eugene cam)
@wilkjayy: loooool whaaaaaaaaat Posted 2 months ago 2 months
on Quasimoto Raw Cuts
yes. nothing but yes Posted 2 months ago 2 months on no problem w/ ||DILIP||, otxhello & ny odus
i like it very much Posted 2 months ago 2 months
on Maybes (ft. Japanese Breakfast)
sparkling joy Posted 2 months ago 2 months on i don't want to trap anymore ~ (prod. by eugene cam)
<3 Posted 2 months ago 2 months
® ѕ u ɑ Ḻ ו on M o t h e r F u x k e r - m a n n y x Ѵ
low fidelity is best fidelity Posted 2 months ago 2 months
on brndn - barbie (prod @gosuto1k)
no barbies Posted 2 months ago 2 months
on 2ToneDisco x Hikeii - Baby Be More
massive Posted 2 months ago 2 months on GET OVER IT
awesome ride. this is tight Posted 2 months ago 2 months
on rowdy brain processes
slick Posted 2 months ago 2 months
on Scientist
@oylo: the fuck Posted 2 months ago 2 months
on Burned Bridges
pretty unique groove Posted 2 months ago 2 months
on without you
@clubmedd: rt Posted 2 months ago 2 months on The Sideline [J. Cole - The Sideline Story] Prod. Abel
oh damn Posted 2 months ago 2 months on Renegade
pulsing with electricity Posted 2 months ago 2 months
on Doves In The Sky
so tight Posted 2 months ago 2 months
on Doves In The Sky
love Posted 2 months ago 2 months
on Doves In The Sky
bruuuuuh this rides Posted 2 months ago 2 months
on Lisa's Birthday
choice bump Posted 2 months ago 2 months
on Lisa's Birthday can't go wrong with these samples Posted 2 months ago 2 months
on 03:00 nice one natt. very relaxed Posted 2 months ago 2 months
on MY MOMMA GOT A (BENZO)
@thomhannum_skullkid: ^ Posted 2 months ago 2 months
on MY MOMMA GOT A (BENZO)
fantastic piece Posted 2 months ago 2 months
on ☠ ☠ ☠ Lochman feat Treez of the 505 , Unholy Confessions , (A7F cover) ☠ ☠ ☠
pure flame Posted 2 months ago 2 months
on khaki - modem
ouch Posted 2 months ago 2 months
on khaki - modem dude brought us all here in the middle of woods to murder and defile us Posted 2 months ago 2 months on Spinnin’ Sessions 226 - Guestmix: Bob Sinclar
daaaaaamn this is loud Posted 2 months ago 2 months
on LIFTED
most ofset funk rhythm 10 Posted 2 months ago 2 months
on gorge
tortured emotions Posted 2 months ago 2 months
on Clarity.
muy beuno Posted 2 months ago 2 months
on Clarity.
fresh splesh mesh me g Posted 2 months ago 2 months
on Innocence
cerebral Posted 2 months ago 2 months on Innocence
massive clarity. ultimate control Posted 2 months ago 2 months
on Tsuruda Flow *27k Release*
dude. so nasty Posted 2 months ago 2 months on ruby on rails (20.00 lease -- 50.00 exclusive)
@user-463503342: DUMP Posted 3 months ago 3 months
on the little things rule my life
trippy Posted 3 months ago 3 months
on pumpin
please keep pumping out your sweetest Posted 3 months ago 3 months
on pumpin
massive props my guy Posted 3 months ago 3 months
on without you god damn... i am melting in my chair Posted 3 months ago 3 months
on damn
damn Posted 3 months ago 3 months
on damn
happy labor day Posted 3 months ago 3 months
on no scripts
good lord Posted 3 months ago 3 months
on no scripts
fuck dude you are dumb creative Posted 3 months ago 3 months
on prolly need lovin'
this place is deep Posted 3 months ago 3 months
on prolly need lovin' this shit smackin' boy Posted 3 months ago 3 months
on ruby on rails (20.00 lease -- 50.00 exclusive)
traktrain.com/oylo Posted 3 months ago 3 months
on Beamon - Angel Blood (produced by Mitsudomoe)
@thebeamon: fair Posted 3 months ago 3 months
on honey (10.00 lease -- 30.00 exclusive)
traktrain.com/oylo Posted 3 months ago 3 months
on Maf*ck dance
huge props Posted 3 months ago 3 months on SAN HOLO - HIDING FT. THE NICHOLAS (NOTPIL REMIX)
@notpil: not at all Posted 3 months ago 3 months
on Surgery
@saturnxxx: <3 np satun! Posted 3 months ago 3 months on Internet Daughter - Audemars feat. Rakeem Miles and Blxck lxn
sick Posted 3 months ago 3 months
on Hanz x Skurt Nilsen - Mood Swings
@sofasound-beats: : ) ( : : ) ( : : ) ( : Posted 3 months ago 3 months
on oooooohhh
<3 Posted 3 months ago 3 months
on oooooohhh
feels like the piece is one Posted 3 months ago 3 months
on oooooohhh
I absolutely love love love long smooth transitions Posted 3 months ago 3 months
on oooooohhh
nice. this is elegant. not in your face. super chill Posted 3 months ago 3 months on All Star Season (ft. Mathaius Young, Khary, Olukara, Joose the Conqueror, Indica)
amazing Posted 3 months ago 3 months on All Star Season (ft. Mathaius Young, Khary, Olukara, Joose the Conqueror, Indica)
stacked the fuck up Posted 3 months ago 3 months
on j walk (with TyLuv.)
caressing my lobes with the softest touch Posted 3 months ago 3 months
on genetics
gorgeous drums Posted 3 months ago 3 months
on a dip
waverin' Posted 3 months ago 3 months
on a dip
twinklin' Posted 3 months ago 3 months
on Mo Vibez - Calm Down
magical tune my guy Posted 3 months ago 3 months on SAN HOLO - HIDING FT. THE NICHOLAS (NOTPIL REMIX)
@notpil: let me in on it Posted 3 months ago 3 months
on ܧ [Crisis] w/ Cosmic (800K Plays!) | #LMTLESS
bruh this shit is whipping. leash your bass Posted 3 months ago 3 months
on Powder - [Electrostep Network EXCLUSIVE]
mad dope Posted 3 months ago 3 months
on Legend Of Coda
O_O Posted 3 months ago 3 months
on Legend Of Coda
what hanz said Posted 3 months ago 3 months
on Legend Of Coda
j this is so fucking tight Posted 3 months ago 3 months
on Legend Of Coda
holy mother of pearl Posted 3 months ago 3 months on FLOAT- XE feat. Deborah Bond
keep the bleezies runnin Posted 3 months ago 3 months
on Plushy
so much energy Posted 3 months ago 3 months
on Brockhampton - TRIP
ayyy Posted 3 months ago 3 months
on Brockhampton - TRIP
this is pretty tight Posted 3 months ago 3 months
on stop and smell the flowers sometime damn chief I mean you sure got me to stop and smell the flowers Posted 3 months ago 3 months
on Vargo & Swaidy - Getcha [Jersey Terror]
shiiiiiiit Posted 3 months ago 3 months
on Vargo & Swaidy - Getcha [Jersey Terror]
retarded nasty Posted 3 months ago 3 months
on Festivillainz - Of The Ground (Free Download)
thrash Posted 3 months ago 3 months
on MICRO MEN 6
that was pretty dope Posted 3 months ago 3 months
on Wicked (Loote Remix)
very well made Posted 3 months ago 3 months
on Surgery
duuuude that break Posted 3 months ago 3 months
on Surgery
I'm impressed by your composition abilities Posted 3 months ago 3 months on SAN HOLO - HIDING FT. THE NICHOLAS (NOTPIL REMIX)
chargin' Posted 3 months ago 3 months on SAN HOLO - HIDING FT. THE NICHOLAS (NOTPIL REMIX)
great work Posted 3 months ago 3 months on SAN HOLO - HIDING FT. THE NICHOLAS (NOTPIL REMIX)
been a solid minute since I heard a remix of this Posted 3 months ago 3 months
on Ronald Raygun [prod. Samurai-Caucasian]
burning rubber Posted 3 months ago 3 months on What Else
money Posted 3 months ago 3 months
on What Else
you already know Posted 3 months ago 3 months
on fame us
@user-252274449: thanks for stopping by! Posted 3 months ago 3 months
on wE'Re All tHE Same With DAMLA
wow Posted 3 months ago 3 months
on wE'Re All tHE Same With DAMLA
this is psychy. I'm so in Posted 3 months ago 3 months
on Sarah
@greygizzard: correct! the beautiful blue mountains of north carolina! Posted 3 months ago 3 months on KRANE & MYRNE - Monarch
WHAT EVEN Posted 3 months ago 3 months
on KRANE & MYRNE - Monarch
ARE YOU HEARING THIS FUCKING DROP Posted 3 months ago 3 months
on KRANE & MYRNE - Monarch
@oylo: I mean wtf.... Posted 3 months ago 3 months
on KRANE & MYRNE - Monarch
I mean every time I think music can't get any harder y'all niggas put out shit like this.... smdh Posted 3 months ago 3 months
on Sarah
thanks for a great listen Posted 3 months ago 3 months
on Sarah
imgur.com/BoRMhVy Posted 3 months ago 3 months on Sarah let me take a picture of what I'm looking at and link it here so you can see how perfectly this fits the mood right now Posted 3 months ago 3 months
on Handshakes And Contracts
goodness gracious this lead is slaying Posted 3 months ago 3 months
on -The Prisoner Soul-
whoa... this is tight Posted 3 months ago 3 months
on Blazed - Herman bloºm
that organ is penetrating my eardrums Posted 3 months ago 3 months
on Blazed - Herman bloºm
this is fucking sick Posted 3 months ago 3 months
on missed call
fuck I want to cry right now Posted 3 months ago 3 months on Lunar
i just don't even understand Posted 3 months ago 3 months
on mushroom cloud (for a school project)
this needs more attention asap Posted 3 months ago 3 months
on mushroom cloud (for a school project)
what the fuck!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! Posted 3 months ago 3 months
on ILIVEHERE. - Coming Home (flaws tribute)
dude... this tune kicks ass Posted 3 months ago 3 months
on Creepa & inverness - Up
@itsflaws: ahhh dope. good to see you again lol Posted 3 months ago 3 months
on Creepa & inverness - Up
@itsflaws: wtf who are you and why am I already following you?? fka somebody? Posted 3 months ago 3 months on fame us
@nadrojsirrah: . Posted 3 months ago 3 months
on blush x msft. - haha.
@oylo: and yo what the fuck is up with every comment saying "REPOSTED!" Posted 3 months ago 3 months
on blush x msft. - haha.
@itsmsft: doesn't have to be complex to sound good my man Posted 3 months ago 3 months
on "Let Me Tell You A Story" - Milana Zilnik with Phil McWalter
@phil-mcwalter: whoa!!! I didn't even read the description. just listened in stream. thanks for pointing that out! Posted 3 months ago 3 months
on fame us
@owlyeahofcial: thank you! Posted 3 months ago 3 months
on POSHLUST - NEVER THE SAME FACE (prod. james)
omg Posted 3 months ago 3 months
on POSHLUST - NEVER THE SAME FACE (prod. james)
O_O Posted 3 months ago 3 months
on things are good (instrumental)
@veigarbeats: truth Posted 3 months ago 3 months
on things are good (instrumental)
wicked Posted 3 months ago 3 months
on Pacific Patterns - Mirage
@sofasound-beats: hahahah Posted 3 months ago 3 months on "Let Me Tell You A Story" - Milana Zilnik with Phil McWalter
such an inviting composition... Posted 3 months ago 3 months
on aimeri - rustle (w/ holiday club)
@oylo: never not impressed Posted 3 months ago 3 months
on aimeri - rustle (w/ holiday club)
oh daaaaamn. I like the way the arp changes. those wet chamber tocks swelling around in my whatever an ear cavity area is called. like finaural or baclon or ecordra fuck idk Posted 3 months ago 3 months
on LIT [PROD. Y2K] ton'y hawk's pro skater soundtrack combined with all those bands like simple plan combined with lil aaron on that autotune. this shit interesting Posted 3 months ago 3 months
on Love Is Not Enough
<3<3<3 Posted 3 months ago 3 months
on lose
tender. soft Posted 3 months ago 3 months
on LIKE DUH (prod. DeliverTheCrush)
d u h Posted 3 months ago 3 months on LIKE DUH (prod. DeliverTheCrush)
how many times starfox pulled up somewhere Posted 3 months ago 3 months
on Bones (feat. Tilian)
massive tune Posted 3 months ago 3 months
on One Step )))) featuring Wellin, Lillithe, Paploviante and McWalter
@oylo: on the* Posted 3 months ago 3 months
on One Step )))) featuring Wellin, Lillithe, Paploviante and McWalter
harmonies and the step counter got me like >:) Posted 3 months ago 3 months
on One Step )))) featuring Wellin, Lillithe, Paploviante and McWalter
wonked up storytale funk keep flowin' Posted 3 months ago 3 months
on Beamon - Angel Blood (produced by Mitsudomoe) beamon howcome you always reply to comments outside of their comment chain Posted 3 months ago 3 months on dome
pretty dope beat but I can't really hear it in my left ear Posted 3 months ago 3 months
on Moth Circuit & soulecist. - Bankai (feat. THRPY)[emengy sponsored release]
ever seen a lawnmower fight a woodchipper Posted 3 months ago 3 months
on Moth Circuit & soulecist. - Bankai (feat. THRPY)[emengy sponsored release]
uh oh Posted 3 months ago 3 months
on Ʈ Ƕe ŴÌŤƇǶ ƑṜǾṀ ƮḨǝ ȄÀŚṪ. Ɖ. Ĵ . Âćɛ / ṔƦǾĐứ ṨỜỰɲĐƮŗặẌ ṂÌẌ ḺŏǤÌḉ.❌ 2017
intense vocals Posted 3 months ago 3 months
on Alina Baraz (feat. Khalid) - Electric (Electric Mantis Remix)
haven't heard the original, but this is sick Posted 3 months ago 3 months
on Alina Baraz (feat. Khalid) - Electric (Electric Mantis Remix) you ever seen those like columnar mountains that descend into cloudy depths unable to be seen? that what this sound like Posted 3 months ago 3 months
on Alina Baraz (feat. Khalid) - Electric (Electric Mantis Remix)
fitting remix Posted 3 months ago 3 months
on Banks - Fuck With Myself [Ivy Lab Remix]
wow Posted 3 months ago 3 months
on CANDLE OF SPACE I
oh buddddddddy!! this break holy Posted 3 months ago 3 months
on CANDLE OF SPACE I
intricate as hell g. it feels like were on some form of transportation not yet known to man. Posted 3 months ago 3 months
on FLIP DC FULL ATTACK (prod. Noer the Boy)
nas with a capital T Posted 3 months ago 3 months
on FLIP DC FULL ATTACK (prod. Noer the Boy) this is what i'm talking about. everyone listening & reading: try something new. stop rolling in your ruts. experiment Posted 3 months ago 3 months
on cold shoulder
i can get behind this Posted 3 months ago 3 months
on Love Hip Hop
yee Posted 3 months ago 3 months
on Love Hip Hop
can't stop this bih Posted 3 months ago 3 months
on Love Hip Hop
flowin' like a train Posted 3 months ago 3 months
on Love Hip Hop
a a a aaaa Posted 3 months ago 3 months
on Love Hip Hop
o o o oooooo Posted 3 months ago 3 months
on fingers crossed
you got me fucked the fuck up rn Posted 3 months ago 3 months
on fingers crossed
drums ride with the vocals so loose & carelessly. so sick Posted 3 months ago 3 months
on Can't Do Anything (prod. by Dylan Brady)
7415 5417 15 50000 600D Posted 3 months ago 3 months
on Creepa & inverness - Up
like a fucking intergalactic nuclear bomb filled with proactive radiation exploding all over the planet and forcefully spreading positivity and kindess. cool Posted 3 months ago 3 months
on Creepa & inverness - Up
this noise is about to cause me to wet my pants Posted 3 months ago 3 months
on Creepa & inverness - Up y'all did really well with this. i can't find any flaws Posted 3 months ago 3 months
on WORK | Prod By BEAM
hell yeah that synth glue af Posted 3 months ago 3 months
on WORK | Prod By BEAM
sa-vaghe Posted 3 months ago 3 months
on pomegranate
smiles all around Posted 3 months ago 3 months
on pomegranate
eye wuuuuv gwaypfwoot Posted 3 months ago 3 months
on pomegranate
cyoot Posted 3 months ago 3 months
on Ekali x Denzel Curry - Babylon (William. Remix)
this one of them smackers Posted 3 months ago 3 months
on dark rum/teaser/
this is sweet man. super smooth Posted 3 months ago 3 months
on waiting screen
unbelievable Posted 3 months ago 3 months
on waiting screen
unobtainable Posted 3 months ago 3 months
on waiting screen
unmatchable Posted 3 months ago 3 months
on waiting screen
wize's workflow is unstoppable Posted 3 months ago 3 months
on blush x msft. - haha. that bass is dumb nasty guys. props Posted 3 months ago 3 months
on blush x msft. - haha.
the last song I listened to arpeggiated perfectly into this track... same notes wtf Posted 3 months ago 3 months
on e l l e p h a n t 12121
bruuuuuh Posted 3 months ago 3 months
on e l l e p h a n t 12121
sokos you look like _diplo_ in your pic Posted 3 months ago 3 months
on e l l e p h a n t 12121
i am fully erect at this point Posted 3 months ago 3 months
on shinomura - dearly beloved (jaxan flip)
this is neat. I dig Posted 3 months ago 3 months
on Maone - Hold On // NTWRK002 this track is 10x louder than everything else in my stream Posted 3 months ago 3 months
on FAKE <3
@flippsmusic: literally nothing involved sadkey. the thing here is that you're paying for stats Posted 3 months ago 3 months
on worn out
@chris-okunbor: thanks!! Posted 3 months ago 3 months
on show me w/ kolada
@chris-okunbor: thank you! I appreciate your feedback Posted 3 months ago 3 months
on Sunrising Sake Blues ~ Yutaka Hirai & Chris O
@chris-okunbor: turn the volume up to 11 Posted 3 months ago 3 months
on FAKE <3
@sadkey: bruh his old tracks have like 10k plays and 1 comment. TELL ME HOW YOU DONT NEED TO BUY PLAYS AGAIN Posted 3 months ago 3 months
on rested @sadkey: LOL WTF I DIDNT SEE THIS COMMENT EITHER Posted 3 months ago 3 months
on fame us
@headofhydrus: thank you! Posted 3 months ago 3 months
on verzache interview
transition mode elite Posted 3 months ago 3 months
on DROELOE - Back When (1997)
experimental is the way of the future Posted 3 months ago 3 months
on Skumjas
such a pretty feeling Posted 3 months ago 3 months
on YourMomNeeds2Talk2U - WondaBluxz
numbing Posted 3 months ago 3 months
on fame us @phiilomusic: thank you phiilo Posted 3 months ago 3 months
on amai- idk how to tell you its over "ending"
@amaixamai: grass-fed cruelty free non-gmo tears Posted 3 months ago 3 months
on You Make Me
perf bounce quals Posted 3 months ago 3 months
on Anxious
thugged the fuck out yess Posted 3 months ago 3 months
on Anxious
dude this is nuts Posted 3 months ago 3 months
on ~ a good life ~
a Posted 3 months ago 3 months
on ~ a good life ~ mami mami am miaama i ma am m ma miai ma miami Posted 3 months ago 3 months
on this song is for you.
@easca-collective: ^ Posted 3 months ago 3 months
on AJMW - Let Me Guide You
this song is so gooooooood Posted 3 months ago 3 months
on Yury - Fade (prod. Yury)
life livin' the only way to live a life Posted 3 months ago 3 months
on Kryptonite Lean
thoroughly enjoyed Posted 3 months ago 3 months on Diferent High - SUBI x JENNA SUHL (Prod. by NATEY)
ooohh <3 Posted 3 months ago 3 months
on AOBeats - Like You (feat. Eric Nam)
dope Posted 3 months ago 3 months
on AOBeats - Like You (feat. Eric Nam)
#dohashtaglinksworkonsoundcloud #letsfindout #goodsong # movingcastle #aobeats #ericnam Posted 3 months ago 3 months
on hyperforms x théos - ultima.
magnitudinal Posted 3 months ago 3 months
on Fade (ft. Hunting Stories)
right on Posted 3 months ago 3 months
on Trippie Redd - Trapstar (remix by supagucci x madara tbh)
trippy fx. i'm with it tho, this is right Posted 3 months ago 3 months
on for the damaged heart.
dawg this outro is nearly breathtaking Posted 3 months ago 3 months
on YOUNG CADE - WITH YOU/WITHOUT YOU [prod. ESSEX]
$ $ $ Posted 3 months ago 3 months
on CASHFORGOLD & Tim Schaufert - Hold You
good god man these chords are love Posted 3 months ago 3 months
on Love my enemies (ft. Verti)
tight flow. wet. hydro Posted 3 months ago 3 months
on Mist (w/ avella)
soft embracings Posted 3 months ago 3 months
on fame us
@liniror: thanks for listening! Posted 3 months ago 3 months on Maxd & Adam Tell - Sleepy [NEST HQ Premiere]
beautiful Posted 3 months ago 3 months on Maxd & Adam Tell - Sleepy [NEST HQ Premiere]
excellent vocal work Posted 3 months ago 3 months on Candyland - Bring The Rain (slowed)
didn't expect this to be so good Posted 3 months ago 3 months
on espinas
so wet Posted 3 months ago 3 months
on espinas
oh fuck. took us deeeeeep. Posted 3 months ago 3 months
on Empty Hours (ft. Pheona)
this is mad dope my guy. silky milky sweet Posted 3 months ago 3 months
on Into the Woods
wicked atmosphere. and those opera vocals are too choice Posted 3 months ago 3 months
on Down And Out (in A Lonesome Town) - 2005 been chilling on your page for a few tracks now. super dope vibes. got me chillin rn my friend. appreciate you Posted 3 months ago 3 months on Dearest Friend
absolutely monstrous Posted 3 months ago 3 months on I Went To See My Molly ~ with fiddle. Chris O, Josh McAlexander, ft. Simon Watts on fiddle
holy moly this track is eye opening Posted 3 months ago 3 months on I Went To See My Molly ~ with fiddle. Chris O, Josh McAlexander, ft. Simon Watts on fiddle
thank you so much, I have to go now. need to make some music Posted 3 months ago 3 months on I Went To See My Molly ~ with fiddle. Chris O, Josh McAlexander, ft. Simon Watts on fiddle
this has just inspired me...... Posted 3 months ago 3 months
on Early Sunday Morning
arizona sunsets. chilled air Posted 3 months ago 3 months
on The Jackpot Blues ~ John Delk & Chris O massive vibe. y'all have me so relaxed right now Posted 3 months ago 3 months
on Sunrising Sake Blues ~ Yutaka Hirai & Chris O
good listen. thanks! Posted 3 months ago 3 months
on Sunrising Sake Blues ~ Yutaka Hirai & Chris O
solo slayiiiinngg Posted 3 months ago 3 months
on Sunrising Sake Blues ~ Yutaka Hirai & Chris O
I wish I could come up with more lyrics for my own music Posted 3 months ago 3 months
on Sunrising Sake Blues ~ Yutaka Hirai & Chris O
this is so good Posted 3 months ago 3 months
on Sunrising Sake Blues ~ Yutaka Hirai & Chris O
hell yeah, guitar is murdering this shit!! Posted 3 months ago 3 months
on Sunrising Sake Blues ~ Yutaka Hirai & Chris O
rockin' and a flowin' Posted 3 months ago 3 months
on Attrition
sweet Posted 3 months ago 3 months
on Attrition interesting arrangement. I'll distort my leads until the day I die Posted 3 months ago 3 months
on Isles of the Blessed
absolutely gorgeous Posted 3 months ago 3 months
on Starshot
icy Posted 3 months ago 3 months
on Starshot
dope spread on these drums Posted 3 months ago 3 months
on Starshot
cool combos Posted 3 months ago 3 months
on fame us
@vassh: <3 Posted 3 months ago 3 months
on fame us
@evelkneville: thanks man. appreciate you Posted 3 months ago 3 months
on fame us
@chimmala: call my psychiatrist Posted 3 months ago 3 months
on 1000 Degrees (feat. Floyd, Save & Tre Capital)
@jakemillsbeats: big ups! Posted 3 months ago 3 months
on Ken Blvd - Need Much (Prod. By Omito )
@lamusice: it's likely. i'm at 16k currently active comments Posted 3 months ago 3 months
on Karla
tasty goodness. nice nice nice Posted 3 months ago 3 months on used to know
mother of fuck Posted 3 months ago 3 months
on used to know
mind warping pleasure Posted 3 months ago 3 months
on all i want is you
fantastic Posted 3 months ago 3 months
on crks_
nothing but money Posted 3 months ago 3 months
on of sirens coming to lock me up. the rain never stops Posted 3 months ago 3 months
on Her
wow Posted 3 months ago 3 months on Her
...... Posted 3 months ago 3 months
on Her
holy smokes that pan is phenomenal Posted 3 months ago 3 months
on About Us Feat. Harper XO
this is beautiful Posted 3 months ago 3 months
on About Us Feat. Harper XO
harper elegantly brushes the song in angel dust Posted 3 months ago 3 months
on VALENTINE & 4AM - Us ft. Naji (yitaku & Xavi Remix)
this synth is pure energy. idk how you leashed that bih but don't let it loose pls. we would all be incinerated Posted 3 months ago 3 months
on JNNO - When I Say (ft. THEZ) chill planet? more like hyper beach party skip hopping planet Posted 3 months ago 3 months on JNNO - When I Say (ft. THEZ)
wockle debacle oh waddle Posted 3 months ago 3 months
on Ken Blvd - Need Much (Prod. By Omito )
ken you sound great. omito you sound great. Posted 3 months ago 3 months on congratulations x horizons (post malone vs autograf edit)
puncturing penetrating entering Posted 3 months ago 3 months
on Nostalgia ( Electronic - Future Bass Free Sample Pack)
them keys brooooo Posted 3 months ago 3 months
on Nostalgia ( Electronic - Future Bass Free Sample Pack)
bass got me on the zoomies Posted 3 months ago 3 months
on Nostalgia ( Electronic - Future Bass Free Sample Pack)
supremacy Posted 3 months ago 3 months on Scientist sparkle boys hip squad fuck 'em up nut in they butt yuh Posted 3 months ago 3 months
on Who's She To You
i mean damn Posted 3 months ago 3 months
on Who's She To You spectacular arrangement. this tune is enchanting as hell Posted 3 months ago 3 months
on The Sun Thing ((Conover/Keitonie))
that lead <3<3 holy cow Posted 3 months ago 3 months
on The Sun Thing ((Conover/Keitonie))
awesome job! Posted 3 months ago 3 months
on The Sun Thing ((Conover/Keitonie))
wish I would've themed mine better Posted 3 months ago 3 months
on The Sun Thing ((Conover/Keitonie)) glad to see someone else made a song for the eclipse! Posted 3 months ago 3 months
on Mr. Carmack - Slow Walk
comfortablee Posted 3 months ago 3 months
on Mr. Carmack - Slow Walk
hell yeah son. this is my kind of music Posted 3 months ago 3 months
on Dombresky - Aragon
zonkwonk 10000 Posted 3 months ago 3 months
on Dombresky - Aragon
thicker that a bowl of oatmeal Posted 3 months ago 3 months
on Cool Song
pop Posted 3 months ago 3 months
on Evan de Cloù - Rot this is mad trippy my friend Posted 3 months ago 3 months
on Cookie
interesting work Posted 3 months ago 3 months
on ឰᜰࢮ ҈҈ Ӑ҈ ӉҺӅҾӇҼҾ
this is absolutely magical Posted 3 months ago 3 months
on HARD # (w/LSL ✘ BOYGOLD ✘ M-PIECE)
@strain138: facts Posted 3 months ago 3 months
on HARD # (w/LSL ✘ BOYGOLD ✘ M-PIECE)
good god Posted 3 months ago 3 months
on HARD # (w/LSL ✘ BOYGOLD ✘ M-PIECE)
saw me apart. my fucking lord Posted 3 months ago 3 months on DREAM DAMA - THERE IS A STRANGER IN THE MIRROR [ЕВРОПА RELEASE] glistening crystal water rectangles no more thtan 1cm in width Posted 3 months ago 3 months
on BOUNCE
dope dope Posted 3 months ago 3 months
on shatter emotion
s i c k Posted 3 months ago 3 months
on shatter emotion
duuuuuuuuuuuude Posted 3 months ago 3 months
on 1000 Degrees (feat. Floyd, Save & Tre Capital)
hot hot hot Posted 3 months ago 3 months
on 1000 Degrees (feat. Floyd, Save & Tre Capital)
yoooo wtf this is an original?? Posted 3 months ago 3 months
on Rich Baby. (Prod. Iceboi Soorma) i feel Posted 3 months ago 3 months
on Laced Love [Free EP Download]
daisies Posted 3 months ago 3 months
on Laced Love [Free EP Download]
massively forceful relaxation Posted 3 months ago 3 months
on Life Goals (feat. Alexa Lusader)
cool. ice cold Posted 3 months ago 3 months
on Wicked Paradise Exclusive Mix - ❀ HARRISON ❀ gorgeous noise. this one making my mout hwater Posted 3 months ago 3 months
on Weaver Beats - Player
umph Posted 3 months ago 3 months
on Weaver Beats - Player
no stop Posted 3 months ago 3 months
on Weaver Beats - Player
leggggo that flute ballin' Posted 3 months ago 3 months
on Weaver Beats - Player hell yeah boy this beat gross nasty. i'm on bruh Posted 3 months ago 3 months
on Masochist
come a k-nockin' Posted 3 months ago 3 months
on Masochist
this is fucking sick man Posted 3 months ago 3 months
on drift
nice stabby waves of silk yuh Posted 3 months ago 3 months
on drift
the fill is unstoppable omg Posted 3 months ago 3 months
on amai- idk how to tell you its over "ending"
spicy gritty digitears Posted 3 months ago 3 months
on Madeline Kenney - Always
<3<3<3<3<3 Posted 3 months ago 3 months
on Unwell & Jay Knight - Tuna [ ENRCH004 ]
invasion. this is some mental shit Posted 3 months ago 3 months on i don't wanna do this anymore (JAMESIK remix)
nice pump Posted 3 months ago 3 months on i don't wanna do this anymore (JAMESIK remix)
trillin and chillin Posted 3 months ago 3 months
on sorrow.
gone deep. put 'em in a cofn Posted 3 months ago 3 months on love/hate
love the fresh air in ther Posted 3 months ago 3 months
on fame us
@crapface: thanks for stoppin' by my guy Posted 3 months ago 3 months
on Of The Land
this beat is fucking fiiire Posted 3 months ago 3 months
on reckless w/ paaus + oddvibes
@khakibeats: gotta dl Posted 3 months ago 3 months
on 3
this could be monstrous Posted 3 months ago 3 months
on 3
dude... Posted 3 months ago 3 months on 3
gorgeous Posted 3 months ago 3 months
on 2
spooky as hell Posted 3 months ago 3 months
on 1
sick outro Posted 3 months ago 3 months
on 1 chords speaking mad melancholic rain in this place Posted 3 months ago 3 months
on knowledge
@gotchi: thank you! Posted 3 months ago 3 months
on reckless w/ paaus + oddvibes
how the fuck yall get your mix so high Posted 3 months ago 3 months on reckless w/ paaus + oddvibes
mind blowing Posted 3 months ago 3 months
on Paces - Open Up Your Eyes (Chiefs Remix)
i never get tired of this song Posted 3 months ago 3 months
on Beautiful [free download]
i am fucking in this shit god damn Posted 3 months ago 3 months
on tilt
vrana collab me please Posted 3 months ago 3 months
on VRANA - '97
wicked smooth Posted 3 months ago 3 months
on VRANA - '97 what is this magical location you have brought me to Posted 3 months ago 3 months
on bespoke short and sweet. like those cinnabons they sell at taco bell mmmmmmm Posted 3 months ago 3 months
on bespoke
the world is turning around my head Posted 3 months ago 3 months
on bespoke
this man got a trip in his step Posted 3 months ago 3 months
on bespoke
bruh...... Posted 3 months ago 3 months
on Glacci, Deon Custom - Viridian (Feat. Deon Custom)
@vhsmidnightstyle: somebody get this man Posted 3 months ago 3 months
on dead and beat
@weirdromance: <3 Posted 3 months ago 3 months
on show me w/ kolada @weirdromance: thanks man! we appreciate you Posted 3 months ago 3 months
on sure don't
@professorjenkins: thank you! Posted 3 months ago 3 months
on knowledge
@liniror: <3 Posted 3 months ago 3 months
on sure don't
@inixiahd: thank you! Posted 3 months ago 3 months
on Born Dirty & Mai Lan - Technik
mad tech Posted 3 months ago 3 months
on Dame Civile - Maïa
i don't understand it but it sounds excellent Posted 3 months ago 3 months
on ҼӁӂӅӅ // ӐҺӏӒ (ӉӋӈҽ. һӒ ӋӈҼҼӈ) massive bump Posted 3 months ago 3 months
on Iglooghost - 'Bug Thief'
this is absolutely bonkers Posted 3 months ago 3 months on Manila Killa x Robotaki feat. Matthew John Kurz- I Want You (Party Pupils Remix)
wicked Posted 3 months ago 3 months
on DZZ & Halpe - Ghost's Lullaby
luv Posted 3 months ago 3 months
on DZZ & Halpe - Ghost's Lullaby
those spoinky clonks are speaking at me Posted 3 months ago 3 months
on DZZ & Halpe - Ghost's Lullaby
oh damn, yall on record record! tight Posted 3 months ago 3 months
on "FunkyBackStreet" With Jh0st / Please, read the description... ;) oh my... nice touch there Posted 3 months ago 3 months
on sure don't
@blue-room-green: thank you! Posted 3 months ago 3 months
on The Veronicas - Untouched (Willco Flip)
punch me in the face Posted 3 months ago 3 months on Alina Baraz & Galimatias - Show Me (The Red Baron Remix)
red you are killing this one boy Posted 3 months ago 3 months
on responsibilities
wispy mcools Posted 3 months ago 3 months
on everything
sneaky flow Posted 3 months ago 3 months
on gaws the great - stussy socks
you're a monster Posted 3 months ago 3 months
on Boxcutter
pieces Posted 3 months ago 3 months
on Rage Logic - Gravel
king kong mollywhop squad Posted 3 months ago 3 months
on PROVE IT(Prod. TQ2)
dope Posted 3 months ago 3 months
on Otaku Mode (feat. Birocratic)
dudes this slams Posted 3 months ago 3 months
on Otaku Mode (feat. Birocratic)
torchin Posted 3 months ago 3 months on Galaxy 22 (Featuring Jon Lock on Bass)
this is gorgeous my friend Posted 4 months ago 4 months
on sure don't
@djmabi: thanks! Posted 4 months ago 4 months
on sure don't
@jcs-807293158: appreciate that! Posted 4 months ago 4 months
on WORK
l Posted 4 months ago 4 months
on WORK
damn this is rea Posted 4 months ago 4 months
on felt
@ryanaexavier: kag been dialt dude Posted 4 months ago 4 months
on show me w/ kolada
@mesdabosc: thanks! appreciate that Posted 4 months ago 4 months on higher
@steeziakbeats: s t 3 3 3 3 3 3 3 3 3 z what up bruh Posted 4 months ago 4 months
on knowledge
@julien-morency: #laughmasteroylo Posted 4 months ago 4 months
on sure don't
@julien-morency: thank you!! Posted 4 months ago 4 months
on felt
@skug-1: vibe on then my guy Posted 4 months ago 4 months
on higher
this man sam def higher than any of yall Posted 4 months ago 4 months
on felt
@skug-1: bruh when are you not vibin? Posted 4 months ago 4 months on Nothin 2 Somethin (Prod. Wanderous One)
this album is tight man Posted 4 months ago 4 months
on want u 2
mmph Posted 4 months ago 4 months
on Timbaland - Carry Out (inverness Remix)
this is rad Posted 4 months ago 4 months
on Shakuhachi Flow
this is a damn tune Posted 4 months ago 4 months
on keep shining (feat. The Kount) these drums are the most technical drums i'll hear today Posted 4 months ago 4 months
on The Escape
peaceful moonlight Posted 4 months ago 4 months on The Escape beautiful soundscape. autumn hills rolling away from the sun Posted 4 months ago 4 months
on Suchard
very cool mes Posted 4 months ago 4 months
on 60.000 Ways to leave your madre
intrigued. really digging the compacted drums. all dope Posted 4 months ago 4 months
on Stand! featuring Jana Phillips
these drums are on fire, and jana is pouring in gasoline Posted 4 months ago 4 months
on RUB TRANCE / just a demo
roarin Posted 4 months ago 4 months
on RUB TRANCE / just a demo
mischievous. go on Posted 4 months ago 4 months
on MORE interesting choice in the composition. enjoyed and appreciated Posted 4 months ago 4 months
on Heart Dance
massively deep bind g Posted 4 months ago 4 months
on WELCOME
i like the area your soundscapes emerge from. i wanna go to there Posted 4 months ago 4 months
on Stairway to Light
spectral analysis revealed that jenny would never walk again. she began to cry. that was exactly what she wanted Posted 4 months ago 4 months
on 565789y.MP3 were we go
boonk gang Posted 4 months ago 4 months
on Maximus Analog Goa
supertech. i'm in man. these bg fx are stunna Posted 4 months ago 4 months on Analogwurm Final Pleasure rmx
i can feel the skin covering my ears Posted 4 months ago 4 months
on Boost(Original mix)
mad funk my guy Posted 4 months ago 4 months
on Adam Hinden - Moondial
oh damn..... that was clean. this is so wet Posted 4 months ago 4 months
on Wonderland
happy time space brine jam climb aye Posted 4 months ago 4 months
on Lollo Blanco awesome tune. beat had me on lock for a minute Posted 4 months ago 4 months
on Dubloadz - Bubble Bobble
my boy done gone of Posted 4 months ago 4 months
on Dubloadz - Bubble Bobble charging up these bolts breh Posted 4 months ago 4 months
on Nature
money Posted 4 months ago 4 months
on Plant
nice Posted 4 months ago 4 months
on Plant interested combination. frightened in solitude. stay coolin Posted 4 months ago 4 months
on Dance On The Volca
i love this melody Posted 4 months ago 4 months
on Alexey Romeo - Summer (Preview) [VIP Records]
this slams bro. i can't stop bobbing Posted 4 months ago 4 months
on Phase 2 Album Teaser Medley island tilt haunt mood. cyriak visuals Posted 4 months ago 4 months
on knowledge
@negative-headphone: thanks for checking in fam! Posted 4 months ago 4 months
on sure don't
@specialececilia: thank you! Posted 4 months ago 4 months
on sure don't
@alzzed: thanks for your kind words! Posted 4 months ago 4 months
on THE ROAST OVERLORD MIXTAPE VOL. 1
serious movement Posted 4 months ago 4 months
on knowledge
@headofhydrus: thanks for the love Posted 4 months ago 4 months
on Glacci, Deon Custom - Viridian (Feat. Deon Custom)
@reas0n: Deon Custom, Deon Custom - Deon Custom (Deon Custom. Deon Custom) Posted 4 months ago 4 months
on knowledge
@david-louthan: thanks my guy Posted 4 months ago 4 months
on sure don't
@are-charles-pedersen: appreciate that! Posted 4 months ago 4 months
on knowledge
@specialececilia: thank you! Posted 4 months ago 4 months
on The Norwegian Fjords
mmmm so tasty' Posted 4 months ago 4 months
on The Norwegian Fjords
amazing reverb on this guitar holy moly Posted 4 months ago 4 months
on THRoUgH EYeS oF an ARTiST (New CLIP see link below ) awesome tune. feels dystopian disco. fully recycled societies with no human flesh left Posted 4 months ago 4 months
on Got It Made
cool experience. feels like a new orbit Posted 4 months ago 4 months
on Fireflies
here we have arrived at the market. as you can see there's quite a hustle and bustle in the small town from the eastern lands, where it's sunny, joyful and positive Posted 4 months ago 4 months
on Danse au clair de lune / Acte IV
wow...... Posted 4 months ago 4 months
on Danse au clair de lune / Acte IV
most delightful Posted 4 months ago 4 months
on Danse au clair de lune / Acte IV
magnificiante Posted 4 months ago 4 months
on Distant Voices beautiful piece gotchi. very relaxing Posted 4 months ago 4 months on Chemin du retour: RE-WORKED [Gotchi & THE ∆LpHΛ CεTI ◊RCHESTRΛ collaboration]
wow. this feels like summiting a mountain Posted 4 months ago 4 months
on Tomorrow We'll See (see notes on collaborators)
nice emotion. puts my mind in a happy state Posted 4 months ago 4 months
on Slow Motion - electro jazz
i am serenaded <3 Posted 4 months ago 4 months
on Visions - Collab - The Old School & Tainted Icarus
nice work guys. fantastic stories painted on the backs of my eyelids Posted 4 months ago 4 months
on !"#$ %$ ☢ (&'()/*+,-./ 012. &'(3) - ☛ 456789:;9<= ☚
sort of reminds me of system of a down. these melodies are pure flames Posted 4 months ago 4 months on >?@+ *#2$ ☮ (0#2. &'(3)
what a beautiful soundscape Posted 4 months ago 4 months
on >?@+ *#2$ ☮ (0#2. &'(3) bruh. let me tell you first: i am totally digging the aesthetic of this tune. font/cover/atmosphere/everything Posted 4 months ago 4 months
on Beachside
this hops got me on jam mode bruh Posted 4 months ago 4 months
on Le Knight Club - Soul Bells (Cryda Luv' Tribute Mix)
great pump Posted 4 months ago 4 months
on Cryda Luv' - ENJOY (club mix)// FREE DOWNLOAD
zoomin and groovin. super playful sweeps Posted 4 months ago 4 months
on ARRASAN " Razing" (METALIZADO)Free download
dynamite Posted 4 months ago 4 months
on zat?! super intricate. horns tell a nice steady story of the mechaotic downfall Posted 4 months ago 4 months
on Break me
this beat mean Posted 4 months ago 4 months
on Break me
@vectorsin: tru Posted 4 months ago 4 months
on Nightbirds
livin' right Posted 4 months ago 4 months
on Maesic & Hillbom - Remind Me
hard movement. electrifying Posted 4 months ago 4 months
on Glacci, Deon Custom - Viridian (Feat. Deon Custom)
glacci, deon custom (feat. deon custom) lol what Posted 4 months ago 4 months
on preach (w/ regtheledge)
great work Posted 4 months ago 4 months
on preach (w/ regtheledge)
yooo this is icy Posted 4 months ago 4 months on Naduve - Ready Set Go (Saturn Memories Tahini Mix) [Disco Halal]
nice underground midtown aquaziar vibe rolling here Posted 4 months ago 4 months
on Marc Maya - Tika
mad groove bud Posted 4 months ago 4 months
on Crosswerved
goddamn Posted 4 months ago 4 months
on Adolescence
@migglepepperoni: ^^^^^^^^ Posted 4 months ago 4 months on Shakuhachi Flow
mother of god Posted 4 months ago 4 months
on OTESLA - SEEDS A [full][buylinkforDL]
these beats are hopping af Posted 4 months ago 4 months
on MISTRAL WIND
fin essence oil prints, yes? Posted 4 months ago 4 months
on I Can't Help You Now )))) Conover / Warnick this part swells a cooling feeling of joy in my chest Posted 4 months ago 4 months
on simon eng - more we learn / less we know
gungho on this bih Posted 4 months ago 4 months
on Lemon Juice
fresh Posted 4 months ago 4 months on TWISTSTEP (Masayoshi Iimori Remix)
kotekan death rain Posted 4 months ago 4 months
on TWISTSTEP (Masayoshi Iimori Remix)
this is the rudest tune Posted 4 months ago 4 months
on I made this mix lol
oof Posted 4 months ago 4 months on management made us do it [NEW UM.. EP NEXT WEEK]
o k o k o k Posted 4 months ago 4 months
on until the quiet comes edit
man Posted 4 months ago 4 months
on zero cool + sidewalk boy - purgatory
wow Posted 4 months ago 4 months on sure don't
@suexde: ; ) Posted 4 months ago 4 months
on Bittersweet
nicely done Posted 4 months ago 4 months
on gouache tape [free dl in desc]
nuts Posted 4 months ago 4 months
on gouache tape [free dl in desc]
@zezima-dogbone: dude must have 99 farming because his produce game is fire Posted 4 months ago 4 months
on MEMORIESLIKEMOVIES, prod me
sc going hard as hell this morning Posted 4 months ago 4 months
on Shibuya (Prod. LMC)
this rides Posted 4 months ago 4 months on knowledge
@cesiumswimsuit: thanks for listening! Posted 4 months ago 4 months
on B2TB- KXYO FT(L.I JSTAR)PROD.ONETIME
soaring like banjo at freezeezy peak Posted 4 months ago 4 months
on HOLLYWOOD
always bumpin Posted 4 months ago 4 months
on HOLLYWOOD
rich Posted 4 months ago 4 months
on SOUL WEEK
bassline livin' on the edge Posted 4 months ago 4 months
on HOME interplanetary communication and assistance type feel Posted 4 months ago 4 months
on HOME <3 Posted 4 months ago 4 months
on VITAMIN D (Interlude) wow. those lyrics go deep... Posted 4 months ago 4 months
on REDMAN (Interlude)
! ! ! ! spine chills Posted 4 months ago 4 months
on REDMAN (Interlude)
w Posted 4 months ago 4 months
on REDMAN (Interlude)
i am so impressed right no Posted 4 months ago 4 months
on REDMAN (Interlude)
hadiya this literally nuts Posted 4 months ago 4 months
on GET ME OUT my goodness. so trippy Posted 4 months ago 4 months
on GET ME OUT
fucking hell, guess i should just repost the playlist Posted 4 months ago 4 months
on HOT FLAVOR perfection. such gorgeous clarity in these vocals. and 3lo my dudes y'all murdered this. well done everybody Posted 4 months ago 4 months
on ACCESS
hadamnbruh Posted 4 months ago 4 months
on ACCESS
what in the Posted 4 months ago 4 months
on Red Light ... (prod. shamana) * VIDEO IN DESCRIPTION *
tech deck 9 amirite Posted 4 months ago 4 months
on Red Light ... (prod. shamana) * VIDEO IN DESCRIPTION * shamana boy you're nuts Posted 4 months ago 4 months
on Peppermint Flavour (Ft. Icedhoneybun)
why all the comments right here Posted 4 months ago 4 months
on Weaver Beats - Conscience
@weaverbeats: no problem dude! soundcloud has a few issues with comment replies i've noticed (i.e. not appearing on reload, notifying yourself of your own replies, ^ deleting themselves) lol it's a mess Posted 4 months ago 4 months
on Weaver Beats - Conscience
@weaverbeats: mighty fine, thanks for asking Posted 4 months ago 4 months
on Towers
man going crazy Posted 4 months ago 4 months
on Soul
bruhhhh Posted 4 months ago 4 months on Soul
this is nuts Posted 4 months ago 4 months on Two Friends - Emily (Zack Martino & BEAUZ Remix)
wow Posted 4 months ago 4 months
on Jeremy Ismael & Pdb - 42
hip and sophisticated Posted 4 months ago 4 months
on 4 old times' sake
filth Posted 4 months ago 4 months
on 4 old times' sake
ass grind Posted 4 months ago 4 months
on Weaver Beats - Conscience
@weaverbeats: how you been bruh Posted 4 months ago 4 months on Xans
5 Posted 4 months ago 4 months
on Xans
b 4 r Posted 4 months ago 4 months on Way That You Feel damn this is money Posted 4 months ago 4 months
on dusk gorgeous melodies Posted 4 months ago 4 months
on Summer Breeze
excellent Posted 4 months ago 4 months
on Canon Keys
nutty Posted 4 months ago 4 months
on Canon Keys this is trippy Posted 4 months ago 4 months
on Let's Go (Prod. SOTB)
dope flow Posted 4 months ago 4 months
on i know (w/ dvniel)
summiting Posted 4 months ago 4 months on Magic (feat. YoZ) [Prod. by AMD & A Moldy Leak]
hard like a rock Posted 4 months ago 4 months on Magic (feat. YoZ) [Prod. by AMD & A Moldy Leak]
this shit thick like a sausage Posted 4 months ago 4 months
on Nice Trees
i fuck with this heavy Posted 4 months ago 4 months
on Mo Vibez & Ohsun - Talk To Me got that wide hard sparkle flare. i like i lke Posted 4 months ago 4 months
on closer. glorphymorphy ya feel. took me by the cymnipllbes Posted 4 months ago 4 months
on Not Over Yet
awesome bounce Posted 4 months ago 4 months
on Weaver Beats - Conscience
hi weaver what's up my dude Posted 4 months ago 4 months
on WOOZY
gang bangin n flamin in the manger mane Posted 4 months ago 4 months
on "Colours Of The World" - The Capistrano Birds & Jadester77Rock..inspired by su..
love that organ way in the back Posted 4 months ago 4 months
on "Colours Of The World" - The Capistrano Birds & Jadester77Rock..inspired by su.. beautiful words. uplifting and fresh Posted 4 months ago 4 months
on Come & Get It (feat. YUNG BAE)
nothing but love guys Posted 4 months ago 4 months
on Ground.0
tall tastes Posted 4 months ago 4 months
on A Milli those hi hats are the trillest hi hats in history Posted 4 months ago 4 months
on Jami Brwn - Easy Breezy
yeah buddy! this goes! super professional Posted 4 months ago 4 months
on She (prod. Ontrio & Avix)
rare goodies Posted 4 months ago 4 months
on Shawn Wasabi - Otter Pop (ft. Hollis) spicy Posted 4 months ago 4 months
on dibiase x devonwho - "access denied" - 2017
fire Posted 4 months ago 4 months
on dibiase x devonwho - "access denied" - 2017
permission granted Posted 4 months ago 4 months
on GANGSIGNS - OVERCAST (FL!PPS REMIX)
all you can do is make jersey? most talentless genre Posted 4 months ago 4 months
on FAKE <3
now this is actual garbage Posted 4 months ago 4 months
on FAKE <3
why you buy plays bruh Posted 4 months ago 4 months
on On The Fire
@enclaveoficial: do you only get on soundcloud every 5 months Posted 4 months ago 4 months
on Thomas Mraz ft. MB Polyana,PADILLION & DAY1 - Kill Boss
@ofcial-day1-corp: this isn't a hustle. you're begging for stats. hustling implies work Posted 4 months ago 4 months
on Thomas Mraz ft. MB Polyana,PADILLION & DAY1 - Kill Boss
@ofcial-day1-corp: someone with 15x your followers who has never done this Posted 4 months ago 4 months
on Thomas Mraz ft. MB Polyana,PADILLION & DAY1 - Kill Boss
@ofcial-day1-corp: you're never going to make it like this bruh Posted 4 months ago 4 months
on Lise.FM - Nadia
:) Posted 4 months ago 4 months
on ®® Persian Empire - Amca Feat. Salty Sam ®®
tune Posted 4 months ago 4 months on Bukubru
whonk Posted 4 months ago 4 months
on dark days
a coat Posted 4 months ago 4 months on Money And Fame ft. Alan Longo - Prod. By Alan Longo
i hope soundcloud stays up so this does Posted 4 months ago 4 months
on ok2222 x kogane - lost
rad Posted 4 months ago 4 months
on some times (prod. domino)
trippy Posted 4 months ago 4 months
on some times (prod. domino)
oh my god this part is fucking gold Posted 4 months ago 4 months on some times (prod. domino)
lyricism af Posted 4 months ago 4 months
on some times (prod. domino)
solid from the start Posted 4 months ago 4 months
on Mind Of (feat. Kudu Blue)
@valentina-marini: ^^^^^^^^^^^^^^^^^^^^^ Posted 4 months ago 4 months
on Mind Of (feat. Kudu Blue)
@izzisdizzi: they've yet to pull a profit i guess Posted 4 months ago 4 months
on Mind Of (feat. Kudu Blue)
@izzisdizzi: the fired a bunch of dudes and tech crunch or something said they've got 50 days until their last quarter Posted 4 months ago 4 months
on Mind Of (feat. Kudu Blue)
@joornitth: here's hoping Posted 4 months ago 4 months on sure don't
@lowmain: thank you kindly Posted 4 months ago 4 months
on sure don't
@par-lo: thanks! Posted 4 months ago 4 months
on Mind Of (feat. Kudu Blue)
@joornitth: it can still be salvaged my friend Posted 4 months ago 4 months
on sure don't
@lowmain: yoooo Posted 4 months ago 4 months
on Mind Of (feat. Kudu Blue)
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Midas Palm tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Intro
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Why Hide It
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Luminate - Confessions
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on alchemy (trap edition)
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Broadway [NEST HQ Premiere]
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Sorrow – The Twelve EP
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months on 100 ROUNDS
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on night.drive.
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Unltd. (prod. GRiMM Doza)
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Droptop
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Behavior
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Pullup ft. Buddy (prod. ayoayo.)
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on tinted sleeves
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months on TAY-K - The Race 5 (Prod: S.Diesel) [@DJPHATTT Exclusive] *VIDEO IN DESCRIPTION*
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on Hold On We're Going Home - Drake (Cover)Prod.Lucid Green
tell your friends to tell their friends that the world's favorite music streaming service, soundcloud, is going to go under unless they get some money. there's got to be some soundcloud-loving millionaire out there who would be happy to invest. if you love this website do your duty and get the word out Posted 4 months ago 4 months
on does it have to be
@k1lowatt: appreciate that bruh Posted 4 months ago 4 months
on sure don't
@k1lowatt: thanks! Posted 4 months ago 4 months on POWER OF LOVE~ ft. SUNNIDAYZ AND A BIG SMILE TO ALL OF YOU~ HAGW!!
<3 thanks for cheering me up before i have to drudge through class Posted 4 months ago 4 months
on Moon Bounce - 100% Devil
fresh and clean. like a perfect pair of socks Posted 4 months ago 4 months
on Moon Bounce - I Am A Strange Loop
the esteemed crunchy slip clap Posted 4 months ago 4 months
on SEVEN TRUMPETS
@prodbywho: who? Posted 4 months ago 4 months
on invictus
lol damn this shit goes harder every time i hear it wtf Posted 4 months ago 4 months
on NO ASSIST
nu age starfox el classico Posted 4 months ago 4 months on COLD COMFORT 냉담한
cataclysmic Posted 4 months ago 4 months
on Ed, Edd N Eddy
stab me fam cataclysmic Posted 20 hours ago 20 hours
on Ed, Edd N Eddy
stab me fam Posted 20 hours ago 20 hours
on EAST COAST
holy shit Posted 20 hours ago 20 hours
on Black Mage | @ArzonMusic
@ktng: facts. this track is trail blazing bro Posted 20 hours ago 20 hours
on Fytch - Change Me (ft. Naika)
@oylo: ...but i won't show it. no i'll just hold my breath and keep it quiet... every little earthquake BWEEEEER BWOOOOOOR BWUUUUUUUUUR BWUUUUUUUUUR BWUR BWOR BWEEEEER Posted 20 hours ago 20 hours
on Fytch - Change Me (ft. Naika)
@oylo: oh boy this version on your youtube is waaaaaay higher quality than the one i've got downloaded lol Posted 20 hours ago 20 hours
on Fytch - Change Me (ft. Naika)
@oylo: found it! it is you! Posted 20 hours ago 20 hours
on Fytch - Change Me (ft. Naika)
@oylo: ahh the good old days Posted 20 hours ago 20 hours
on Fytch - Change Me (ft. Naika) fytch are you the guy that made that earthquake remix like 8 years ago? that shit slaaaaams Posted 20 hours ago 20 hours
on make soundcloud great again
#2015Cloud Posted 20 hours ago 20 hours
on SEVEN TRUMPETS it's like the future is invading trap's past through a rip in the fabric of space-time Posted 20 hours ago 20 hours
on SEVEN TRUMPETS
bruhhhh Posted 20 hours ago 20 hours
on SEVEN TRUMPETS
this is absolutely gargantuan Posted 20 hours ago 20 hours
on blablabla
even your throwaway tracks are bomb Posted 20 hours ago 20 hours
on I'll be okay
good lord. where the fuck am i at Posted 20 hours ago 20 hours
on DNA - (PartyWave x Shlump Remix)
damn. Posted 20 hours ago 20 hours
on Monday mighty fine piece of work you've constructed here. every bar is different from the last, but never strays from the theme glue. your skills make me sick. envious Posted 20 hours ago 20 hours
on Gwan Big Up Urself big ups roy this has got a nice feeling Posted 21 hours ago 21 hours
on Fallen
been fell Posted 21 hours ago 21 hours on Matt Citron ~ Run Around (Prod. Shamana)
blippin trippin rippin nippin Posted 21 hours ago 21 hours
on CiDi - Love Hate
pinch me i must be dreaming Posted 21 hours ago 21 hours
on still hopeful (lost project file)
touchy. punchy. roughly sunny Posted 21 hours ago 21 hours
on krs. + rae srem flip.1
boutta beat my dicc raw to this shit Posted 21 hours ago 21 hours
on purple drapes (prod. WIZE)
waveform just disappeared on me Posted 21 hours ago 21 hours
on vulgar
i wish my downtime was this productive Posted 21 hours ago 21 hours
on Fyütch & Boba Sweat- Catch Me Cruisin' (omniboi rmx)
615 4 l1f3 Posted 21 hours ago 21 hours
on Thomas Mraz ft. MB Polyana,PADILLION & DAY1 - Kill Boss can't believe y'all working with this day1 dude... spam much mother fucker? Posted 22 hours ago 22 hours
on knowledge
@home-run-119260219: : ) Posted 1 day ago 1 day
on lets just make a band bro /w gertrude
thicc Posted 1 day ago 1 day
on lets just make a band bro /w gertrude
you're a fucking killer my dude Posted 1 day ago 1 day
on tear drop
fucking rollin' Posted 1 day ago 1 day
on tear drop
space spook wave team Posted 1 day ago 1 day
on Constellation
tasty dunkin Posted 1 day ago 1 day
on the miseducation of playboi cartier
spectacle of humanity Posted 1 day ago 1 day
on Serene
clean pillow cases Posted 1 day ago 1 day on The Girl By Yellow Belly-brillbilly Collab(Alternative DreamPop)
beautiful piece Posted 1 day ago 1 day
on Lone - Minds Eye Melody
top speed Posted 1 day ago 1 day
on rock the boat
this vocal always makes me wet Posted 1 day ago 1 day
on rock the boat
chacharming as hell friend Posted 1 day ago 1 day
on ||DILIP|| x Tibe - Ventilate
bass whipping like satan's dick Posted 1 day ago 1 day
on ||DILIP|| x Tibe - Ventilate
no one can stop them Posted 1 day ago 1 day
on ||DILIP|| x Tibe - Ventilate fucking punked up dude. this is heavy Posted 1 day ago 1 day on Taska Black - Where We Go
that washed out lead is orgasm Posted 1 day ago 1 day
on nights with u
intricate. delicate. Posted 1 day ago 1 day
on Exitus W/ Sepia
we movin ouchea Posted 1 day ago 1 day
on DANK SAMPLES (out now via splice)
congrats on the success my dude Posted 1 day ago 1 day
on DANK SAMPLES (out now via splice)
oh bet Posted 1 day ago 1 day on What Are You Doing Here (feat. Casey Breves)
$ Posted 1 day ago 1 day on What Are You Doing Here (feat. Casey Breves)
stabs and stereo boops got me Posted 1 day ago 1 day
on What Are You Doing Here (feat. Casey Breves)
interesting technique Posted 1 day ago 1 day
on T h e W e e k e n d - (Zikomo Remix)
dope chops. plunk me along dun Posted 1 day ago 1 day
on Hold Me
that melody is fucking charged Posted 1 day ago 1 day
on Maroon
zanaris******** Posted 2 days ago 2 days
on Maroon we've arrived here at the cosmic altar in zanarias Posted 2 days ago 2 days on Finale
track just came on me Posted 2 days ago 2 days
on Finale
overloaded Posted 2 days ago 2 days
on What About Monday?
just fire Posted 2 days ago 2 days
on What About Monday?
no ice Posted 2 days ago 2 days
on What About Monday?
noice Posted 2 days ago 2 days
on What About Monday? good god bruh that snare clickdownpanroll shit wtffff Posted 2 days ago 2 days
on What About Monday? i absolutely adore these kicks. need Posted 2 days ago 2 days
on What About Monday?
that fucking transition omg Posted 2 days ago 2 days
on Dutch
power chords Posted 2 days ago 2 days
on Dutch
bruh these alien swarms swoopswishing by my ears Posted 2 days ago 2 days
on Barriers (ft. Knapsack) sidechain heavier than a gallon sized jug of mercury Posted 2 days ago 2 days
on Barriers (ft. Knapsack)
knipknackpsaccin on dem boys Posted 2 days ago 2 days
on The Void w/ Knapsack gorgeous stabbage Posted 2 days ago 2 days
on Pace
sass ass fat claps Posted 2 days ago 2 days
on Pace goddamn that crushed arp yuhh <3<3 Posted 2 days ago 2 days
on Pace
got me swammin' bruh Posted 2 days ago 2 days
on Preme - Luxury Cars (2014)
hot af Posted 2 days ago 2 days
on Hol' Dat
mmm Posted 2 days ago 2 days
on Hol' Dat
yuhhhhh this is vibe central Posted 2 days ago 2 days
on Context
got yourself some fresh produc(tion)e here Posted 2 days ago 2 days
on Grow Up
too sick Posted 2 days ago 2 days
on Grow Up
trenchin through the streets of ooglog Posted 2 days ago 2 days on DLX - Hodgy Beats (Produced By Wasabi McGruff)
sick Posted 2 days ago 2 days
on fuck bush
magic dust in my cnaal Posted 2 days ago 2 days
on DustbowL
beautiful Posted 2 days ago 2 days on Rico Rich - Honey Berry Backwoods
this is some inspirational quality Posted 2 days ago 2 days
on Wrath Of The Guided
those hats are relaxed af Posted 2 days ago 2 days
on Wrath Of The Guided
money Posted 2 days ago 2 days
on Museums
so chill Posted 2 days ago 2 days
on Museums
damn... this is some real shit Posted 2 days ago 2 days
on Islands
wow Posted 2 days ago 2 days on Islands
i am in rn Posted 2 days ago 2 days
on Chosen the fucking background vox and the ad libs are perfectly eerie. so tight Posted 2 days ago 2 days
on Chosen
this is so damn creative Posted 2 days ago 2 days
on 4 Gig Nasa [psy, art, and prime]
phase me fam Posted 2 days ago 2 days
on shade
you nasty boy, but got that elegant touch Posted 2 days ago 2 days
on Cashmere Cat - 9 (After Coachella) ft. MØ & SOPHIE [KRANE Remix]
wigglin Posted 2 days ago 2 days
on Human v2
gooood shit my dude Posted 2 days ago 2 days
on Lo-fi Scape
yo this shit actually bumps bro Posted 2 days ago 2 days
on knowledge
@user-109752179: thanks man Posted 2 days ago 2 days
on knowledge
@sazetrax: appreciate your comment! Posted 2 days ago 2 days
on Outlit x Obi - Greatness
magnifico Posted 2 days ago 2 days
on Needlepoint i whacc me dicc to the roaring dino-saws sweeping past my head evr tim Posted 2 days ago 2 days
on Needlepoint
absolutely disgusted Posted 2 days ago 2 days
on Needlepoint
yo this is fucking raunchy Posted 2 days ago 2 days
on Needlepoint
charge me up boys we're going in Posted 2 days ago 2 days
on GAWTBASS x Outlit - Thrones
two shits in 3 hours? come on now what am I? 89? Posted 2 days ago 2 days
on GAWTBASS x Outlit - Thrones this track just shifted all the shit in my bowels to the end of my intestines Posted 2 days ago 2 days
on Hudson Mohawke - Passports feat. Remy Banks
this shit is dumb wonky. love it Posted 3 days ago 3 days
on BACK OF MY HEAD (PROD BY BLVC SVND)
slop slappin'. knock em dedd Posted 6 days ago 6 days
on HAARP
chilll ouutttt Posted 6 days ago 6 days
on mi infancia. ticktackchugchackpaddywhackmysackallthewaydownthetrack hayakapackyak Posted 6 days ago 6 days
on Proffesional Flexers
whippin Posted 6 days ago 6 days
on KYLIN for First Ear Radio
these kicks are altering my heartbeat Posted 6 days ago 6 days
on SECOND COMING [PROD. RARE AKUMA]
dig this Posted 6 days ago 6 days
on hold up
nice fit Posted 6 days ago 6 days
on Plants
for certain Posted 6 days ago 6 days
on twisted dw, one day you will be bigger than that other nerd methone Posted 6 days ago 6 days
on DRUMKIT VOL 2 !!! - https://sellfy.com/p/DUej/
stewin n brewin Posted 6 days ago 6 days
on Shell
wind travel air mastery Posted 6 days ago 6 days
on invictus
tasty. rude sugar bb Posted 6 days ago 6 days on Post Malone - Money Made Me Do It (ft. 2 Chainz) (Shisto Flip)
shisto flipped that shitson Posted 6 days ago 6 days
on WE ARE FURY - Signal Fires (feat. Alina Renae)
very nice Posted 6 days ago 6 days
on same color
ummmm?? Posted 6 days ago 6 days
on same color
shawty too bad Posted 6 days ago 6 days
on Moving On (ft. Karra)
legendary Posted 6 days ago 6 days
on Moving On (ft. Karra) so much energy. shit's pouring through rips in the fabric of space Posted 6 days ago 6 days on AJ Tracey - Wifey Riddim (AKAY Remix)
wicked Posted 6 days ago 6 days
on unfamiliar energy [ sophie meiers x halpe ]
spooky Posted 6 days ago 6 days
on knowledge
@bruce-conover: ; ) Posted 7 days ago 7 days
on knowledge
@bruce-conover: haha! thank you! Posted 7 days ago 7 days on Fight For You (Ft. MAX)(Pluto & Inverness Remix)
loads of energy Posted 11 days ago 11 days on PHASES ft. Trevor Lanier (Prod. by Drunken Killah)
last supper Posted 13 days ago 13 days on Indigo Beck Team Supreme Vol. 144
@indigobeck: afk Posted 13 days ago 13 days
on Love So Endlessly Feat. AmandaSofia
@night-swim-radio: yes! Posted 13 days ago 13 days
on Love So Endlessly Feat. AmandaSofia
@night-swim-radio: yes! Posted 13 days ago 13 days
on Love So Endlessly Feat. AmandaSofia
amandasofiasound Posted 13 days ago 13 days
on Indigo Beck Team Supreme Vol. 144
zane what are you smoking bro Posted 13 days ago 13 days on Herobust - Vertebreaker (Jack Slade Edit)
nice 1 my boy jacko Posted 13 days ago 13 days on Soft Channel 007
stop brainwashing me Posted 13 days ago 13 days
on Soft Channel 007
this is fucking wicked Posted 13 days ago 13 days
on Pretty Faces [Prod-Juggman Rico]
hell yeah. this rides Posted 13 days ago 13 days
on DELIVERY - CHERISH THIS (Video in description) flanging mad dope. vox mad oppressive. i want to fetal position in this bitch rn Posted 13 days ago 13 days
on CHAIN
i am absolutely loving this bounce... idgaff Posted 13 days ago 13 days
on Femi Jaye ~ Baby Boy
savåge Posted 13 days ago 13 days on Owe Me Back
aaaaaallll the way Posted 13 days ago 13 days
on MAY GOD BLESS YOUR HUSTLE
@dollarstore-keyboard: facts Posted 13 days ago 13 days
on Falling
massive conglomeration of sound Posted 13 days ago 13 days
on float
i admire you Posted 13 days ago 13 days
on Sidawn w/ Aelodie & Gato
nas-t Posted 13 days ago 13 days
on Sidawn w/ Aelodie & Gato this intro fucked with my head. sick spread Posted 13 days ago 13 days
on the void darkness stares back at you Posted 13 days ago 13 days
on OLD PICTURES [prod. sen09]
it's the kartoon emporer Posted 13 days ago 13 days
on OLD PICTURES [prod. sen09]
i feel Posted 13 days ago 13 days
on IT'S NOT COOKIE TIME [Sundae Sauuce Funk Comp]
yuh Posted 13 days ago 13 days
on LIL PUMP - MOLLY (the day after)
b34n Posted 13 days ago 13 days
on Evar x Kattie - Trust very unique set of sounds and the arrangement was interesting the whole time Posted 13 days ago 13 days
on xxxtentacion - looking for a star (yehme2 rmxxx) spun Posted 13 days ago 13 days
on Mobocracy - Hold
smooth and soulful Posted 13 days ago 13 days
on Autograf - You Might Be ft. Lils (Ramzoid Remix)
clean and elegant. well done rammy Posted 13 days ago 13 days
on Call Out My Name drums have feint elements of daft punk tucked inside. super dope Posted 13 days ago 13 days
on Call Out My Name
organ is captivating Posted 13 days ago 13 days on INQUIRE WITHIN AMAI YAYAY [email protected] CONTACT NOW FOR ALBUM AND MERCH
what Posted 13 days ago 13 days on IM YO DAD (PROD BY BLVC SVND)
stay staccin' Posted 13 days ago 13 days
on sure don't
@jackxdean: oh, thanks! lol Posted 15 days ago 15 days
on sure don't
@jackxdean: sorry Posted 15 days ago 15 days
on LEGEND PT.2
industrious Posted 15 days ago 15 days on I HATE TO CHOOSE W/ CAPSHUN
fuckin' charged Posted 15 days ago 15 days
on EASTER ISLAND
why i'm not following you Posted 15 days ago 15 days
on EASTER ISLAND this is sick Posted 15 days ago 15 days
on Lido―Citi Bike―umru remix
@umru: bahahah Posted 16 days ago 16 days
on Here with you now.
stripped of stress Posted 16 days ago 16 days
on does it have to be
@whyyoudelete: i agree with you. some might say it's too loud, that it sits too far above the rest of the mix... but everything i've ever produced is perfect, so that can't be Posted 16 days ago 16 days
on Dooqu - Circles Ft. Ian Gott
@dooqu: hmm i think i said that backwards... real dooku no match for him Posted 18 days ago 18 days
on it's different & Taptone - Peace Of Mind (ft. Josh Rubin) pause wipe wipe destroy extinguish pause asses obliterate Posted 18 days ago 18 days on it's different & Taptone - Peace Of Mind (ft. Josh Rubin)
bassline driving like a wildman. hold on Posted 18 days ago 18 days
on They Make It Look So Easy awesome vocals. they sit in parallel with most of the rest of the mix. cool effect Posted 18 days ago 18 days
on Beyond The Outstation Music Bed only
another treasure Posted 18 days ago 18 days
on SUCKA MC'S (Prod. O Tesla)
on the realest Posted 18 days ago 18 days
on Ain't Nothing
wonderful fun time jam Posted 18 days ago 18 days
on island w/ rayo
i'm on a hill somewhere, under an oak tree, watching the sun set Posted 18 days ago 18 days
on told (10.00 lease -- 30.00 exclusive)
buying lotd 46m Posted 18 days ago 18 days
on told (10.00 lease -- 30.00 exclusive)
traktrain.com/oylo Posted 18 days ago 18 days
on adravia (20.00 lease -- 50.00 exclusive)
traktrain.com/oylo Posted 18 days ago 18 days on Beyond The Outstation [Conover/Outstation]
steve! killin' it Posted 18 days ago 18 days on Beyond The Outstation [Conover/Outstation]
sonic butterscotch Posted 18 days ago 18 days
on i still smell you on my sheets
choice Posted 18 days ago 18 days on mindful (10.00 lease -- 30.00 exclusive)
traktrain.com/oylo Posted 19 days ago 19 days on 16YROLD FT DESIIGNER X SKI MASK THE SLUMP GOD - UP NEXT """"""""""""""""""""
solid Posted 19 days ago 19 days
on Dooqu - Circles Ft. Ian Gott
beams of that good old fresh tasty sunlight Posted 19 days ago 19 days
on Dooqu - Circles Ft. Ian Gott
yellow saber mane Posted 19 days ago 19 days
on Dooqu - Circles Ft. Ian Gott
no match for tha real dooku Posted 19 days ago 19 days
on Dooqu - Circles Ft. Ian Gott
count dooqu jedi master Posted 19 days ago 19 days on Lil Toenail - FUCK SHiT REMiX W/ RiFF RAFF (Prod J.M.D.B)
^^^^^ Posted 19 days ago 19 days on Lil Toenail - FUCK SHiT REMiX W/ RiFF RAFF (Prod J.M.D.B)
dope Posted 19 days ago 19 days on Lil Toenail - FUCK SHiT REMiX W/ RiFF RAFF (Prod J.M.D.B)
damn this is hard as hell Posted 19 days ago 19 days on Lil Toenail - FUCK SHiT REMiX W/ RiFF RAFF (Prod J.M.D.B)
non of that fuck shit bruh Posted 19 days ago 19 days
on She Was Raised Out in Brooklyn (feat. DrewsThatDude)
箧¶ç§®¶ç¶®ç¶®§ç¶®ç¶¶¶¶ç§¶ç§¶ç§¶çç§ç綧綧 Posted 19 days ago 19 days
on She Was Raised Out in Brooklyn (feat. DrewsThatDude)
i feel like i'm getting abducted by aliens Posted 19 days ago 19 days on She Was Raised Out in Brooklyn (feat. DrewsThatDude)
yall killin this one Posted 19 days ago 19 days
on sugar
caramel Posted 19 days ago 19 days on 16YROLD FT DESIIGNER X SKI MASK THE SLUMP GOD - UP NEXT """"""""""""""""""""
ggggggrrrah Posted 19 days ago 19 days
on show me w/ kolada
@admbmusic: thank you! Posted 19 days ago 19 days
on Midevil//the Gate Keeper
damn bro, chill tf out Posted 19 days ago 19 days
on Midevil//the Gate Keeper
this shit is fatter than my chode Posted 19 days ago 19 days
on sad boy
great harmony Posted 19 days ago 19 days
on sad boy
#sosad Posted 19 days ago 19 days
on Tables Turn [Demo 2017] love the lyrics. and the upbeat emotion of the track really adds to it Posted 20 days ago 20 days
on Service with a Smile [Demo 2017]
awesome feeling. full of sunshine Posted 20 days ago 20 days
on Wrong Path [CLIP]
wipe your monstrous robot ass with that synth boi Posted 20 days ago 20 days
on Wrong Path [CLIP]
fucking mad nasty my friend Posted 20 days ago 20 days
on Survival Of The Fittest [ FREE DL ]
raw as fuck Posted 20 days ago 20 days
on Survival Of The Fittest [ FREE DL ]
this is super tryppi kryo Posted 20 days ago 20 days
on BACK ON TRACK damn, this that good bump. makes me wanna go skating Posted 20 days ago 20 days
on Blaster
gazzo hiya niman yano! ! ! ! Posted 20 days ago 20 days
on Blaster
charge it up bruh, we bout to bust out this bitch Posted 20 days ago 20 days
on Solstice
awesome drums and fx hits. inspiring me Posted 20 days ago 20 days on Bubble Jack - Forced Dance (Original Mix)
sick vox Posted 20 days ago 20 days
on Bubble Jack - Forced Dance (Original Mix) jungle movements. don't look over your shoulder. keep a movin' Posted 20 days ago 20 days
on The Club
tight switch up. got me feeling sort of islander nostalgic Posted 20 days ago 20 days
on my prime
lots of clean energy poppin here Posted 20 days ago 20 days
on blocks
keeping roots with that drum line. i dig Posted 20 days ago 20 days
on blocks
these polyrythms are sick Posted 20 days ago 20 days on Back Home
lovely Posted 20 days ago 20 days on Lewis Cancut - Plastic Games
squippy boi Posted 20 days ago 20 days
on Suede
rolling on Posted 20 days ago 20 days
on Suede
100% gorgeous Posted 20 days ago 20 days
on say.
colloquial pleasantries Posted 20 days ago 20 days
on Will - On Call
please hold Posted 20 days ago 20 days on dunt w/ william.
irregular seduction Posted 20 days ago 20 days
on NxWorries - Suede (GEOTHEORY Remix)
YUH Posted 21 days ago 21 days
on H o w G r e a t (Chance)
anka! Posted 21 days ago 21 days
on Hallucinations (Production by GBSP) it's like i'm surrounded by warm water Posted 21 days ago 21 days
on Low Life Flip
it all perfectly interlocks Posted 21 days ago 21 days
on Low Life Flip
going waaaaay up Posted 21 days ago 21 days on knowledge
@motta_wave: thank you! Posted 21 days ago 21 days
on zack villere - NEXT
@xander: lol okay Posted 22 days ago 22 days
on THATS MY BITCH NOW (prod. ParisVVS)
j00qin' on 'em Posted 22 days ago 22 days
on THATS MY BITCH NOW (prod. ParisVVS)
get it bamby Posted 22 days ago 22 days
on leaving the one you love
crumblytenet Posted 22 days ago 22 days on JESSE TYLER - MURDER ALL SHE WROTE (PROD. GHOSTIE)
dip Posted 22 days ago 22 days on JESSE TYLER - MURDER ALL SHE WROTE (PROD. GHOSTIE) ghostie this shit is rrrraaaaw Posted 22 days ago 22 days
on JESSE TYLER - MURDER ALL SHE WROTE (PROD. GHOSTIE)
take 3 blunts to he face Posted 22 days ago 22 days
on Sunset Lover (Slow Hours Remix)
raw and immediate. not afraid to hold that force Posted 22 days ago 22 days
on Pisar- Akai s1000
nice touch friend Posted 22 days ago 22 days
on Bad Bitches. (Prod. Cor Blanco) i need to figure out how to autotune myself... you think it wouldn't be that hard, but i haven't done it yet Posted 22 days ago 22 days
on Bad Bitches. (Prod. Cor Blanco)
cor blanco set you up bruh, this fire Posted 22 days ago 22 days
on span. the crowd is touching me Posted 22 days ago 22 days
on span.
i wish i had your workflow Posted 22 days ago 22 days
on span.
alex do u hate me Posted 22 days ago 22 days
on beau
soothe me to sleep. breath of fresh relaxation Posted 22 days ago 22 days
on no more happy endings fuck... not sure why i didn't hear this one... beautiful... Posted 22 days ago 22 days
on spinach
sunday monday tuesday wednesday fun day hun Posted 22 days ago 22 days
on zack villere - NEXT that cool synth aye Posted 22 days ago 22 days
on zack villere - NEXT
this is absolutely beautiful Posted 22 days ago 22 days
on zack villere - NEXT
@xander: just a guess, but i think he's (at least partially?) covering himself legally, by distancing from yo-yo ma Posted 22 days ago 22 days
on zack villere - NEXT
looks like i need to step it way the fuck up Posted 22 days ago 22 days
on zack villere - NEXT
f u c k Posted 22 days ago 22 days
on Country Til I Die-
folks don't know how it is Posted 22 days ago 22 days on Mr. Hong - Summer Love (w. Summer Soul) [NEST HQ Premiere] spinning and whirling. cosmic cyclones Posted 22 days ago 22 days
on Fantasy
i needa get me some anime poontang bruh Posted 22 days ago 22 days
on Fantasy
hi internet boi Posted 22 days ago 22 days
on Zen
got tha power i see Posted 22 days ago 22 days
on BRAZIL ROOTS BALANCE
<3 Posted 22 days ago 22 days
on BRAZIL ROOTS BALANCE
goodness my armhair standing straight up Posted 22 days ago 22 days
on BRAZIL ROOTS BALANCE pizzaz in excellence. be no other, do no wrong, stay above, play along Posted 22 days ago 22 days
on BRAZIL ROOTS BALANCE
hell yeah bruh. this tickles my dick Posted 22 days ago 22 days
on RollOut (prod. CamGotHits)
all i do is roll up Posted 22 days ago 22 days
on goodbyeeeee
tappin' hard on 'em. great stuff Posted 22 days ago 22 days
on XOXO(Sample Pack)[PROD. BY VALENTINE]
gargantuan n o y z e Posted 22 days ago 22 days
on BeauDamian X ZEKE BEATS - Faux Bourdon
going iiiiin Posted 22 days ago 22 days
on BeauDamian X ZEKE BEATS - Faux Bourdon fance prance pants dicc in me pantaloooooons Posted 22 days ago 22 days
on BeauDamian X ZEKE BEATS - Faux Bourdon
never mind, it's right here Posted 22 days ago 22 days
on BeauDamian X ZEKE BEATS - Faux Bourdon anyone got some raunch sauce for me to dip my ear tips in? Posted 22 days ago 22 days
on Monte Booker & Naji - Mona Lisa
pure cream Posted 22 days ago 22 days
on Robert Robert - Get To You Safe Ft. Ryan Playground
y'all this is new. good Posted 22 days ago 22 days
on Robert Robert - Get To You Safe Ft. Ryan Playground it's easy to experience these fresh feelings flowing from you fingertips robert Posted 22 days ago 22 days
on Prettiest (ft. Jazz Cartier) awesome scene bro this is tight. percs keep it moving at an interesting rate, vocals are chilling, almost scary. great work Posted 22 days ago 22 days
on magic trees
@barrel-frencheyes: bruh how you gona laugh at me dog, i am so lit i have 120 firemaking Posted 23 days ago 23 days
on Ballad Of A Dead Genre
@brianwes: you're welcome boss Posted 23 days ago 23 days
on 01. "Pilot" (Intro)
@official_stone: important Posted 24 days ago 24 days
on 01. "Pilot" (Intro)
@official_stone: i see that avatar change bruh Posted 24 days ago 24 days
on Penutbuter
y Posted 24 days ago 24 days
on Penutbuter i'm sincerely envious of your ability to produce these soundscapes in such a wau Posted 24 days ago 24 days
on Did You Get That on Tape?
did you touch a meteorite as a kid or something Posted 24 days ago 24 days
on Did You Get That on Tape?
are your fingers made of magic Posted 24 days ago 24 days
on speak whaale
it's not everyday you get to hear something completely original Posted 24 days ago 24 days
on appetite.
poppapoppapoppapoppapoppapopjawns Posted 24 days ago 24 days
on midori field of waterways and solar beams. life of exotic greenery dreams Posted 24 days ago 24 days on 01. "Pilot" (Intro)
@official_stone: i see that delete bruh Posted 24 days ago 24 days
on matame
these hi hats are like daggers raining upward from hell Posted 24 days ago 24 days
on matame
that the kind of music that plays in the heads of those little children you see on tv that have no remorse for dismembering their 7 year old best friend Posted 24 days ago 24 days
on lowly egg
shifting and collecting Posted 24 days ago 24 days
on lowly egg
is that the lava strykewyrm heart that you can add to the staff of light to make a staff of darkness? i want that, but will never be able to afford it... staff looks super sick though Posted 24 days ago 24 days
on 01. "Pilot" (Intro) gratatata Posted 24 days ago 24 days on Bones - WhatAGreatDayToStayIndoors (feat. Jon Simmons of Balance and Composure)
force Posted 24 days ago 24 days
on Pressure
squish squash wish washed gotta saw the savior sifter brendhandto Posted 24 days ago 24 days
on paper planes
that rif holy moly Posted 24 days ago 24 days
on virtualiz.
um cha cha um cha chcka um cha cha um cha Posted 24 days ago 24 days
on virtualiz.
this almost baille Posted 24 days ago 24 days
on virtualiz. hi alex Posted 24 days ago 24 days
on Ballad Of A Dead Genre rotation and acceleration. aggravation and intimidation. seuqence Posted 24 days ago 24 days
on moon jump
warp the fucking out that shit bro nice Posted 24 days ago 24 days
on damn idk shit crazy (prod. grimm doza)
deep Posted 24 days ago 24 days
on damn idk shit crazy (prod. grimm doza)
reapin on these fools Posted 24 days ago 24 days
on Cruising (feat. Lil Star & Dawson) [prod. Lil Curry & Charlie Shuffler]
lil star & lil curry can you fuck my bitch Posted 24 days ago 24 days on The Season (prod. velvet ferrari) is that bitch cuddlin an ounce of pot Posted 24 days ago 24 days
on moves
this is a throwaway?? lol Posted 24 days ago 24 days
on moves
fug Posted 24 days ago 24 days
on moves
good fucking lord bruh Posted 24 days ago 24 days
on moves
this is fucking grunge nutty Posted 24 days ago 24 days
on moves
dip, scoop, slap, tap Posted 24 days ago 24 days
on Screwy gungho in this bitch, cum in her bunghole type sitch get me Posted 24 days ago 24 days
on SoundPatrol & Seafarer - Euphrates
mighty taser Posted 24 days ago 24 days
on Ghemon - Grande (Red Bull Culture Clash Dubplate)
liebe das ja Posted 24 days ago 24 days
on L
my tongue knotted up just thinkin' about these lyrics Posted 24 days ago 24 days
on Believe Me (Migos Type Beat)
chain Posted 24 days ago 24 days
on Juan RIOS • putyahandzup.
don't stop us now Posted 24 days ago 24 days
on Heavy Heart (King Khamen Remix) - Mothica excellent remix Posted 24 days ago 24 days
on I Wanna Die (Patersongs/Conover)
i can almost breathe the fresh air Posted 24 days ago 24 days
on I Wanna Die (Patersongs/Conover)
this really makes me wanna go skating Posted 24 days ago 24 days
on passt this tune tastes like the thickest richest pasta you can imagine, lightly seasoned with just dusted parmesan Posted 24 days ago 24 days
on Mask Awfff
put your serj away brah Posted 24 days ago 24 days
on Mask Awfff
i can't believe this works so well Posted 24 days ago 24 days
on Mask Awfff what the fuck is this mashup Posted 24 days ago 24 days
on Gio Nailati X Earknock - Quadradinho De Oito (Remix) FREE DOWNLOAD CLICK BUY
fucking p o w e rrrrrrrrr Posted 24 days ago 24 days
on magic trees
bought to get some clean dwarf weed and grab my glassblowing pipe, gonna spend my stack on smoke runes Posted 24 days ago 24 days
on somethingaboutyou
stretchy lugg Posted 24 days ago 24 days
on Falcxne - Drop Da Bomb
come on down now keep on lockin' yah yuh uh ooh Posted 24 days ago 24 days
on Zero Tep - Smash Cut (feat. Noer the Boy) (STRTMF058)
i think i died Posted 24 days ago 24 days
on ACCORDIANT this some dirt nasty murder right here Posted 24 days ago 24 days
on kolaz - feel good
honk Posted 24 days ago 24 days
on kolaz - feel good
sparklin' jazz'm'ra'tazz Posted 24 days ago 24 days
on comets & fake blood it's like i'm dunkin' my nuts in icy milk doughnut dough brro Posted 24 days ago 24 days
on MURKIT100 W/oddboiboi
knowledge Posted 24 days ago 24 days
on SCUFFLE ~ A Better Place
massive feelings flowing in here. tune Posted 24 days ago 24 days
on We Are Sex Bob-Omb man fuck previews Posted 24 days ago 24 days
on shake.dat
rrrreeeeee Posted 24 days ago 24 days
on BIG ENUFF [ PROD. OOGIE MANE + FORZA ]
can't wait for matt ox hype to die. this kid sucks Posted 29 days ago 29 days
on sure don't
@milantorne: you're in luck my dude! you can listen for free right here Posted 1 month ago 1 month
on ᐟ to be real
yoo Posted 1 month ago 1 month
on Monster ft. Deko (Prod. By Jerome Keys)
sliiid Posted 1 month ago 1 month
on 0001 16 - Audio damn that was 7 minuteS? Posted 1 month ago 1 month
on 0001 16 - Audio
jk Posted 1 month ago 1 month
on 0001 16 - Audio
trash' Posted 1 month ago 1 month
on 0001 16 - Audio
tastes pure, like icy acaaiia melt plate Posted 1 month ago 1 month
on 0001 16 - Audio i wanna put me pen15 in this 0001 16 Posted 1 month ago 1 month
on 0001 16 - Audio
yay yay i a hawaii cuck mai ai ai yai Posted 1 month ago 1 month
on 0001 16 - Audio
who are you Posted 1 month ago 1 month
on Skit X Kareful - Palace chargin' head man, enemy got better vapor wishoattt Posted 1 month ago 1 month
on Weaver Beats - Reflection
resolved Posted 1 month ago 1 month
on Weaver Beats - Reflection
bring it on up Posted 1 month ago 1 month
on Weaver Beats - Reflection
pump station active Posted 1 month ago 1 month
on BMB SpaceKid x Illa J - Prophecy [Funkella 1.0]
power Posted 1 month ago 1 month
on BMB SpaceKid x Illa J - Prophecy [Funkella 1.0]
dunko blinko sarge gomme Posted 1 month ago 1 month
on BOY SIM - Take You Home (feat. Jack O Connor)
sweatin' bullets over here Posted 1 month ago 1 month
on BOY SIM - Take You Home (feat. Jack O Connor) i can't sweep my ass any lower bro lemme catch a fucking b r e a k Posted 1 month ago 1 month
on BOY SIM - Take You Home (feat. Jack O Connor)
magician secrets Posted 1 month ago 1 month
on BOY SIM - Take You Home (feat. Jack O Connor)
overpass drama Posted 1 month ago 1 month
on BOY SIM - Take You Home (feat. Jack O Connor)
junglequest Posted 1 month ago 1 month
on Plaza w/ Veenom
toss me some ass chunk Posted 1 month ago 1 month
on up hi hats like soft comforting braceful waves surrounding my being, support my weight against gravity Posted 1 month ago 1 month
on SEVEN
driven to the brink of suspension in trinity Posted 1 month ago 1 month
on Leave Me Alone [ Feat. MJD & Ylti ] (Produced By BibbsMon)
up and up and up and up Posted 1 month ago 1 month
on moodygood - superlager (tapecut remix)
rude Posted 1 month ago 1 month
on Snuffy x C0MAD0SE x Milan.. - Wisteria
clank that ratchet guys Posted 1 month ago 1 month
on Snuffy x C0MAD0SE x Milan.. - Wisteria sloppin that tractor beam 'round the swamp like yi yi yi yi Posted 1 month ago 1 month
on Snuffy x C0MAD0SE x Milan.. - Wisteria
pure wet thug sludge nature gang shit Posted 1 month ago 1 month
on Milan.. - Clouded
colder than a witch's titty in a brass bra bruh Posted 1 month ago 1 month on Rather Chew On Batteries. (read lyrics n leave me alone.)
damn, brain... Posted 1 month ago 1 month
on begin
spiritual Posted 1 month ago 1 month
on Lean On Me
good to hear this again Posted 1 month ago 1 month
on The Witch w/662607004
butt nasty bois Posted 1 month ago 1 month on wuudlum - memories of u
fence construction Posted 1 month ago 1 month
on Sona Ova - Amiss
..... Posted 1 month ago 1 month
on Speak
<3 Posted 1 month ago 1 month
on Speak
super fresh sound dude Posted 1 month ago 1 month
on while you were here remastered - soundcloud.com/oylomusic/while-you-were- here-remastered Posted 1 month ago 1 month
on while you were here (remastered)
traktrain.com/oylo Posted 1 month ago 1 month on OMG MY WRIST SLUSHHER X HENRIK FLIP
aye aye aye aye aye Posted 1 month ago 1 month
on sunflower
nice nice nice Posted 1 month ago 1 month
on do the most (rough)
your voice is so crisp Posted 1 month ago 1 month
on 182nights
this is pretty sick Posted 1 month ago 1 month
on museum
hey there Posted 1 month ago 1 month
on sure don't
@churchoftheundecided: i appreciate your wonderful compliment! <3 Posted 1 month ago 1 month on Dylan Brady - KIDS (ft. Night Lovell)
beautiful soundscape Posted 1 month ago 1 month
on S l i d e (Zikomo remix)
keep coolin' on 'em Posted 1 month ago 1 month
on Memories
nice drivetrain u got there buddo Posted 1 month ago 1 month on ҰӁҾӇ қҺһӒӅӈӇ ҜӈӆҾӌ ҿӍ. үӂӓҼӈӋ
space walk Posted 1 month ago 1 month
on repeat
looks like i scared everyone off Posted 1 month ago 1 month
on gucci thangs
oh my god such filthy purity Posted 1 month ago 1 month on gucci thangs
s @ s $ Posted 1 month ago 1 month
on so..... im on beat block i will forever be a rude bass sucker. rah rah all over me fam Posted 1 month ago 1 month
on gees, where you been?
dope phase Posted 1 month ago 1 month
on difference
clip - check, trill - check, bloopy - check, wispy - check, rides af Posted 1 month ago 1 month
on Charged you ain't afraid to use them synths like flailing fucking whips dude are you Posted 1 month ago 1 month
on T Ran
fucking gone o f f Posted 1 month ago 1 month on winterheat rip that digital raw meat veil off my venison guy, i'm looking for the 16bit calories Posted 1 month ago 1 month
on weak texture - mirror
waxy wicked work Posted 1 month ago 1 month
on weak texture - timer (visuals in description)
subtle crush Posted 1 month ago 1 month
on weak texture - timer (visuals in description)
whippin' and a whirlin' tippin' and a twirlin' Posted 1 month ago 1 month
on chill ur ballz
hell yeah boy, pick up that beat bruh. we goofin' over here Posted 1 month ago 1 month
on weak texture - frust
scoot Posted 1 month ago 1 month on Vexed (prod. Weak Texture)
real Posted 1 month ago 1 month
on gooseberry (ft. kevin moran)
aspirations Posted 1 month ago 1 month
on numb felt like ear wax just melted out of all the deepest corners of my ear folds Posted 1 month ago 1 month
on numb
this tunnel is much deeper than i initially anticipated Posted 1 month ago 1 month
on TALK
one thousand Posted 1 month ago 1 month
on Claw Viper
rollin' on they asses Posted 1 month ago 1 month on Color Flux
space funk woke str stop playin Posted 1 month ago 1 month
on New Fumes
speechless Posted 1 month ago 1 month
on New Fumes
mix* Posted 1 month ago 1 month
on New Fumes boy brought the max all the way for presentation to lord god Posted 1 month ago 1 month
on Ganz Feld - Blackdragon [NEW ALBUM 'Bethany' out June 7]
clout packages starting at 19.99 usd Posted 1 month ago 1 month
on Ganz Feld - Ascension Perish [NEW ALBUM 'Bethany' out June 7]
submerging Posted 1 month ago 1 month on Elijah Kessler - Lottery (Prod. Chindamo)
strapped Posted 1 month ago 1 month
on Elijah Kessler - Red Wine (Prod. Blvc Svnd) gung gong thang wang bang pain mane dang gang Posted 1 month ago 1 month
on Blue (Prod. Good Intent + Riclaflare)
roygbiv af Posted 1 month ago 1 month
on skullkid - sleepless w/ regtheledge
raw edge, seared and cleared for hearing Posted 1 month ago 1 month
on light rays w/ jestic
prince of persia slayin' on dat electric Posted 1 month ago 1 month
on light rays w/ jestic
siiiiick Posted 1 month ago 1 month on snow w/ original.sky
artificial flight. taking care Posted 1 month ago 1 month
on Groove On: Session 075 w/ khaki
@thegodsofgroove: L00L Posted 1 month ago 1 month
on Groove On: Session 075 w/ khaki
@thegodsofgroove: i haven't listened to this track is a hot minute lol Posted 1 month ago 1 month
on Succubus (demo)
@dominosmusic: actually in the concrete jungle now my boy Posted 1 month ago 1 month
on taking over
@verdictent: thanks! Posted 1 month ago 1 month
on bystander
lo-glitter gulch fi-mine amirite my guys Posted 1 month ago 1 month on how bout ur gurl? (description)
solidified fresh audio Posted 1 month ago 1 month
on how bout ur gurl? (description)
you didn't Posted 1 month ago 1 month
on how bout ur gurl? (description) like imagine you saw the most beautiful girl in the world Posted 1 month ago 1 month
on how bout ur gurl? (description)
dude i'm talking 100/10 Posted 1 month ago 1 month
on how bout ur gurl? (description)
finest of the fine Posted 1 month ago 1 month
on Young Heavy Skulls (Album Stream)
grudger mud slump pumping gudge dunk Posted 1 month ago 1 month
on Climb aquatic ambience amirite amilio aguavanio Posted 1 month ago 1 month
on Stand Alone Prod by nuntheless
mystifying mysteries Posted 1 month ago 1 month
on Those Chords Ft. RoDerrick
the clap <3 Posted 1 month ago 1 month
on Those Chords Ft. RoDerrick
boy oh boy, this downbeat...... Posted 1 month ago 1 month
on Those Chords Ft. RoDerrick wavy airy light buoyant baby synths don't you just want to make love to them and their melodies?? Posted 1 month ago 1 month
on Those Chords Ft. RoDerrick
smacking in the most delicate manner than smacking can occur Posted 1 month ago 1 month on Untitled [nuntheless x vibesounds]
we deep in this cave boi Posted 1 month ago 1 month
on skullkid - hoodie weather w/ nuntheless
bands man bands Posted 1 month ago 1 month
on spacerider [prod. nuntheless]
damn bruh this is money Posted 1 month ago 1 month
on Kylo feat. Omar Aragones
wonderful. got me feeling very warm Posted 1 month ago 1 month
on blue. w/ Peace To Mateo are they ringshifted? this effect is so sick Posted 1 month ago 1 month
on rtb
changa da pozishuns Posted 1 month ago 1 month
on rtb rock that mf boat hoe Posted 1 month ago 1 month
on Taint
damn this shit is good Posted 1 month ago 1 month
on nuntheless - tfw
love your style Posted 1 month ago 1 month
on Next Level
dope composition man Posted 1 month ago 1 month
on nuntheless - [001]
can't wait for [002] Posted 1 month ago 1 month
on nuntheless - [001]
valuable Posted 1 month ago 1 month on D Hizzy - My Line Ft. Kasey Jones (Prod. DUV) hi hat on teleportation shrooms in this twiviolet soundscape of oblivion, so latent and warm Posted 1 month ago 1 month
on all falls down
spinnin on em. sinnin on em. make a good livin on em. made Posted 1 month ago 1 month
on Away Ft. Kind
squad up Posted 1 month ago 1 month
on Parallels
entracing Posted 1 month ago 1 month
on Hit The Dough!
this shit flamin bro Posted 1 month ago 1 month
on Thomas Mraz ft. MB Polyana,PADILLION & DAY1 - Kill Boss
damn this goes Posted 1 month ago 1 month
on kygo & ellie goulding - first time (outamatic remix) wooo Posted 1 month ago 1 month
on s l i d e.
jabair this is crazy dude Posted 1 month ago 1 month
on Gucci Leather Jacket⭐$✨ prod. by Gosuto
sparkling sass Posted 1 month ago 1 month
on XVII
yuh Posted 1 month ago 1 month
on acqua famiglia
boy got them emots fam Posted 1 month ago 1 month
on Happy Thoughts & (video link in description)
captivation and coalescence Posted 1 month ago 1 month on Orwell Jr. - Gotta Get It Ft. Deon Boston X Ton'e Major X Trevor Lanier
rollin' Posted 1 month ago 1 month on Orwell Jr. - Gotta Get It Ft. Deon Boston X Ton'e Major X Trevor Lanier
awesome bump. great bpm Posted 1 month ago 1 month
on B O K E H - I Know You Know (Ninski Remix)
blazing Posted 1 month ago 1 month
on FVLCRVM - Hi! '
shoot man Posted 1 month ago 1 month
on FVLCRVM - Hi! ' this is one of those super fresh tracks you only come upon ever now and then Posted 1 month ago 1 month
on making my way through life n shit
work Posted 1 month ago 1 month on What You Know (w/ mikuda)
horns always have a laxitative effect on me Posted 1 month ago 1 month
on would you love me on macbook speakers
no Posted 1 month ago 1 month
on I Care w/ Olukara (prod. by j.robb and austin marc)
dope flow austin Posted 1 month ago 1 month on Mits x LUX - Unleash The Hounds (MITS 3FM RADIORIP)
like me cocc Posted 1 month ago 1 month on Mits x LUX - Unleash The Hounds (MITS 3FM RADIORIP)
massive Posted 1 month ago 1 month on Mits x LUX - Unleash The Hounds (MITS 3FM RADIORIP)
my fists are up!! Posted 1 month ago 1 month on Mits x LUX - Unleash The Hounds (MITS 3FM RADIORIP)
these vox are absolutely terrifying Posted 1 month ago 1 month
on ZEKE BEATS - Dispatch (Raymer Remix)
what do you call 100 white people running down a hill? avalanche. what do you call 100 black people running down a hill? mudslide. what do you call 100 mexican people running down a hill? prison break. hahAh ah A H 4h H . A Posted 1 month ago 1 month
on Light Us Up (feat. Calum Scott)
sparking bulbs playin' them snizzarrahs Posted 1 month ago 1 month
on prod. by Snares - Triangle [92]
spoken wonder extravasavants Posted 1 month ago 1 month
on aaaaa
@oylo: ed Posted 1 month ago 1 month
on aaaaa
fix Posted 1 month ago 1 month
on aaaaa
idk why i haven't followed you Posted 1 month ago 1 month
on citgo
got that real nice drive time. got it Posted 1 month ago 1 month
on MILLIONAIRE w/ unlovely
ain't this tiny tim? Posted 1 month ago 1 month
on MILLIONAIRE w/ unlovely
this fucking beat what in the hell Posted 1 month ago 1 month
on lil aaron x blackbear - escalade judge remix this track is fucking lightning charged, carbonic-exalterated tunistic machineries kid Posted 1 month ago 1 month
on it's a sine.
it's wind chill 420 up here Posted 1 month ago 1 month
on Kaelin Bougneit - Movement 2: Highway 18 To Dickeyville...
thanks for this time Posted 1 month ago 1 month
on STEPHANY (read desc.)
rich and wonderful Posted 1 month ago 1 month
on Stoneman Ft. Bizarre (of D12) & Slug Christ
yes yes yes yes yes Posted 1 month ago 1 month
on thankyoumary slurping my grey matter out like ramen bro, have some manners Posted 1 month ago 1 month
on GroovyCasnova - Fake Kickin' PROD B1ackboy
nasty raw. keep roll on tight Posted 1 month ago 1 month
on Cold Blood - Sinjin Hawke
this is sick Posted 1 month ago 1 month
on Cold Blood - Sinjin Hawke
i ' m s i n j i n h a w k e Posted 1 month ago 1 month
on Farfalla
rip slappin' whoop nappin' cadillacin' yuh Posted 1 month ago 1 month
on erase me [ sophie meiers x nion ]
gud 2ne breh Posted 1 month ago 1 month
on erase me [ sophie meiers x nion ] had a dream once that you changed your sc handle to "liquid azul" Posted 1 month ago 1 month
on leaving you
spraying emotion Posted 1 month ago 1 month
on Jealousy & Envy ( prod. @prodbypregame )
nasty Posted 1 month ago 1 month
on Jealousy & Envy ( prod. @prodbypregame )
this shit rides quick Posted 1 month ago 1 month on emma's song pt. 2 (the end) w/ sterfry + fluxxy
nicely done Posted 1 month ago 1 month on emma's song pt. 2 (the end) w/ sterfry + fluxxy
sex Posted 1 month ago 1 month on emma's song pt. 2 (the end) w/ sterfry + fluxxy
someone fucking leash that 808 bruh Posted 1 month ago 1 month
on Succubus (demo)
bruh... this is tight Posted 1 month ago 1 month
on Krs. x Grumby // Anticipation (feat. Hari Mint)
get it hari Posted 1 month ago 1 month
on Krs. x Grumby // Anticipation (feat. Hari Mint)
good god Posted 1 month ago 1 month
on Krs. x Grumby // Anticipation (feat. Hari Mint)
this is some magical touch Posted 1 month ago 1 month
on Krs. x Grumby // Anticipation (feat. Hari Mint)
wow what in the shit... Posted 1 month ago 1 month
on procrastination
sincere Posted 1 month ago 1 month
on Night purest raunch crystals i ever done did witness Posted 1 month ago 1 month
on rosegold. (prod. ARTHUR. & STILL)
damn... this is one scary tune my friends Posted 1 month ago 1 month on Pillow Fight [prod. vbnd]
fire Posted 1 month ago 1 month
on Pillow Fight [prod. vbnd]
this is wild yall Posted 1 month ago 1 month
on Douglas Dare – Swim (Rival Consoles Remix) this is sick. kept elevated and alert by them percs and the scorched car horn synth Posted 1 month ago 1 month
on rise.
now shine Posted 1 month ago 1 month
on rested
@limit_potential: much love friend Posted 1 month ago 1 month
on suqah (20.00 lease -- 50.00 exclusive)
traktrain.com/oylo Posted 1 month ago 1 month on sorted (10.00 lease -- 30.00 exclusive)
traktrain.com/oylo Posted 1 month ago 1 month
on rested
@spinmanfinn: thank you! Posted 1 month ago 1 month
on facets (10.00 lease -- 30.00 exclusive)
traktrain.com/oylo Posted 1 month ago 1 month
on woods. tall tales of abandonment and ritualistic sacrificial tendencies Posted 1 month ago 1 month
on taking over
@denairu: thanks my dude! Posted 1 month ago 1 month
on Certified Freak (Jailo & Yung Wall Street Refix)
bro my stainless steel winder rips my destabilizer with so much force you wouldn't even know what hit you. quit flexin them weak ass blade skill on the net bruh. step up Posted 1 month ago 1 month
on CRYSTAL CHAMBERS
mystic appearances shattering emotions writhed with chastity and perseverance boiling into a peak occurrence Posted 1 month ago 1 month
on flexed too hard now im tired and lonely.. popped them biceps, boy deflatin' over here, get him some friends asap as possible stat Posted 1 month ago 1 month
on Kleiner Bruder (Spring)
or no homies? Posted 1 month ago 1 month
on Kleiner Bruder (Spring)
kleiner bruder mean little brother? Posted 1 month ago 1 month
on Kleiner Bruder (Spring)
got the leaned back rollin' arms tossin' money camera zoomin' in and out vibe giong Posted 1 month ago 1 month
̛ on sirens. ̎ ́ ͡ ̎ͧ ͯ͝ ̐̎ ̈̌̍ ̐ͨ ̕ ͌̽ ͪ̑ ́̋ ̂̑ ͥ ̅̔̚ ̸ ̇ ̌̽ ͬ̈́ ͂ͭ ̓ @alex-simsky: h̍͢ E͆͋̏͟ ͏̈́ͅ l͐̓ ̠ ̗̽ p̠̂̌ͥ ̖͍ ̼̭ ̳̭̮ ̳̞ ̮ͅ ̬̫ ̦ ̭ ͖̰ ̪̳ ̜ ̫̤ ̛ ̎ ́ ͡ ̎ͧ ͯ͝ ̐̎ ̈̌̍ ̐ͨ ̕ ͌̽ ͪ̑ ́̋ ̂̑ ͥ ̅̔̚ ̸ ̇ ̌̽ ͬ̈́ ͂ͭ ̓ @alex-simsky: h̍͢ E͆͋̏͟ ͏̈́ͅ l͐̓ ̠ ̗̽ p̠̂̌ͥ ̖͍ ̼̭ ̳̭̮ ̳̞ Posted 1 month ago̮ͅ ̬̫ ̦ ̭ ͖̰ ̪̳ 1 month ̜ ̫̤
on falcxne - Last Timbit Of The Night/Bye Forever (Bus Ride Home)
serious caress right here Posted 1 month ago 1 month
on When I was in Lagos (Prod. YungLingz)
the vocals are gold Posted 1 month ago 1 month
on When I was in Lagos (Prod. YungLingz)
this is sick. very cool fx Posted 1 month ago 1 month
on When I was in Lagos (Prod. YungLingz)
full Posted 1 month ago 1 month
on B4 Ya Mama Get Home
damn these horns went nasty like that Posted 1 month ago 1 month
on B4 Ya Mama Get Home who smoke weed if they live with their parents?? that's just begging for unnecessary trouble. you ain't need to get high that bad fam, just wait until you're older. it can hinder brain development in youths, so just be smart y'all Posted 1 month ago 1 month
on What Am I ? (Prod. By Kind)
damn this is really good Posted 1 month ago 1 month
on sirens. air waves. i'm telling you. that's how they're brainwashing us. electromagnetism, 19500 Posted 1 month ago 1 month
on Fight For You (Feat. MAX)
lay blaze waste on they asses Posted 1 month ago 1 month
on Fight For You (Feat. MAX)
killer vocal work Posted 1 month ago 1 month
on She Know I Got It ft. Smokepurpp (prod. 808Mafia)
bust bust bust bust Posted 1 month ago 1 month on ODB - Shimmy Shimmy Ya
wet em Posted 1 month ago 1 month
on fortune
nice tune friend Posted 1 month ago 1 month
on fortune
we just went baille yall Posted 1 month ago 1 month
on fortune
the charge on that bass... rahrahrah Posted 1 month ago 1 month
on fortune this is to tight. composition well thought out Posted 1 month ago 1 month
on fortune
vwervivwerrrrv Posted 1 month ago 1 month on snow flakes
@gabriel-jones-221565216: that's true, don't think i've ever heard something i didn't enjoy Posted 1 month ago 1 month
on "Helplessly" taken from Phalanx III (Airynore) [OUT NOW]
sparkling drum slappers Posted 1 month ago 1 month
on Getter - Forget It (feat. Oliver Tree)
love Posted 1 month ago 1 month
on Welcome To LA
also wish you had more music Posted 1 month ago 1 month
on Welcome To LA
wish i had found your page sooner than this Posted 1 month ago 1 month
on Prevent
clutch it Posted 1 month ago 1 month on i wanna (ft.otxhello)
nice one guys Posted 1 month ago 1 month
on i wanna (ft.otxhello)
this otx??? bruhhh Posted 1 month ago 1 month
on i wanna (ft.otxhello)
autotucc me into bed momma Posted 1 month ago 1 month on @alois3m - deadly (interlude) ft. austin skinner (prod. boofbag)
gang Posted 1 month ago 1 month on @alois3m - deadly (interlude) ft. austin skinner (prod. boofbag)
diamond time, 9 9 yuh Posted 1 month ago 1 month
on Washed Out - Get Lost
cool Posted 1 month ago 1 month
on Washed Out - Get Lost filling the water with tons of pool toys and colorful empty plastic cups near an active airport in an open beach region. homeboys over by the salsa bowl needed chill on them salt shakers tho, them chips too salty bruh!! Posted 1 month ago 1 month
on Tell All Ur Friends (feat. J'von)
your flow is encouraging, admirable and notable. i'm impressed by your ability to follow the beat so arbitrarily and on a whim like that. tons of ad lib rhythm around every corner, but perfectly kept on pace Posted 1 month ago 1 month
on All I Got
these vocals cut perfectly Posted 1 month ago 1 month
on All I Got
fucking mother fuck, you're going to make me cry. chill out homie Posted 1 month ago 1 month
on All I Got
it's like cage the elephant if they were really good, and on steroids Posted 1 month ago 1 month on All I Got
oh my god, this one's even better sheeeeeesh Posted 1 month ago 1 month
on All I Got
loving the atmosphere you've provided here for me Posted 1 month ago 1 month
on prtygrl
sausage meat fat thickener tubbed up Posted 1 month ago 1 month
on prtygrl
bump thug nut bub cunt rub succ fug lug buck rut cung Posted 1 month ago 1 month
on prtygrl take em in boys. we got dat power strength on this pier. grrrrrrah Posted 1 month ago 1 month
on prtygrl
surfing on waves of love Posted 1 month ago 1 month on Apato x Madkins - Heatwave lows got me levitating, this track is literally supporting my weight Posted 1 month ago 1 month
on Apato x Madkins - Heatwave
this is grimy. intrigued by you dirty metal Posted 1 month ago 1 month
on Apato x Madkins - Heatwave brass shuttle prepping for reentry, coring on these bitches ya feel me. let's get it Posted 1 month ago 1 month
on SAPBOYS REMIX
dude the pan on the low Posted 1 month ago 1 month
on SAPBOYS REMIX
chair Posted 1 month ago 1 month
on SAPBOYS REMIX
&o& Posted 1 month ago 1 month on SAPBOYS REMIX
dunk Posted 1 month ago 1 month
on Juicy (prod. Woxx)
666 Posted 1 month ago 1 month
on Juicy (prod. Woxx)
poundin on em Posted 1 month ago 1 month on Bludwork & Zendelasilva - Congrats On All The Years
saw my legs off and feed em to a horse Posted 1 month ago 1 month
on Be Your Girl (JON REYES REMIX)
that arp is so warm and delicious Posted 1 month ago 1 month
on Be Your Girl (JON REYES REMIX)
$ $ Posted 1 month ago 1 month on Be Your Girl (JON REYES REMIX)
real. this feels real Posted 1 month ago 1 month
on Check Me Out
roar Posted 1 month ago 1 month
on Check Me Out
stacc Posted 1 month ago 1 month
on Check Me Out
stack Posted 1 month ago 1 month
on Check Me Out
yeahhh, 500 days is plenty to get paid Posted 1 month ago 1 month on Martin Garrix & Troye Sivan - There For You (Poorchoice Remix)
squirmin and swerving, laser facets Posted 1 month ago 1 month on Martin Garrix & Troye Sivan - There For You (Poorchoice Remix) hi hats on ass clapping fleek week today bruh Posted 1 month ago 1 month on Martin Garrix & Troye Sivan - There For You (Poorchoice Remix)
this build is putting the cum in my dick Posted 1 month ago 1 month
on David Eliza - F.A.M.E ft. Asoh Black! the composition is next level. do you guys even hear all of these components swirling their stereo paths around your head in mathematic harmony? what in the actual fuck is going on here? Posted 1 month ago 1 month
on David Eliza - F.A.M.E ft. Asoh Black!
like wtf this is huge Posted 1 month ago 1 month
on David Eliza - F.A.M.E ft. Asoh Black!
man so many people destroying it on this site man Posted 1 month ago 1 month
on U DONT STOP
tail Posted 1 month ago 1 month on U DONT STOP
never stop. train keeps hopbopsloppin down the rail Posted 1 month ago 1 month
on Do You
the snare is absolute perfection Posted 1 month ago 1 month
on Do You
luscious Posted 1 month ago 1 month
on Do You the fucking background and adlibs are destroying me holy shit Posted 1 month ago 1 month
on Do You
this some fresh laundry right here damn Posted 1 month ago 1 month
on jnthn stein x carmack - who cares (chuck sutton remix)
moneeyyyy Posted 1 month ago 1 month on phalguEP [on bandcamp]
confirmed whole tape rad Posted 1 month ago 1 month
on phalguEP [on bandcamp]
good lord... so hollow and deep. warm as hell friend Posted 1 month ago 1 month
on Two hoe's ( prod. blank body ) and these vocals are eerie and surrounding. this tune paints a crazy picture Posted 1 month ago 1 month
on Two hoe's ( prod. blank body )
blank body this beat is slick as fuck Posted 1 month ago 1 month
on Ghozt & TRUNX - GET!
bruh Posted 1 month ago 1 month
on Ghozt & TRUNX - GET!
mother fucking mud Posted 1 month ago 1 month on Ghozt & TRUNX - GET!
disgusting Posted 1 month ago 1 month
on Ghozt & TRUNX - GET!
nasty Posted 1 month ago 1 month
on Ghozt & TRUNX - GET!
filthy Posted 1 month ago 1 month
on Ghozt & TRUNX - GET!
in other words Posted 1 month ago 1 month
on Ghozt & TRUNX - GET! this is to clean as salt is to pepper Posted 1 month ago 1 month
on taking over watch me build this brick ass wall Posted 1 month ago 1 month on we share (20.00 lease -- 50.00 exclusive)
traktrain.com/oylo Posted 1 month ago 1 month
on sure don't
@dintyslop: <3 Posted 1 month ago 1 month
on Cosmo's Midnight - History (Herzeloyde Remix)
trezfest yahhh Posted 1 month ago 1 month
on ponyboi - no friend
chords got the troyboi aura bout em Posted 1 month ago 1 month
on What Did You Call Me ? spider silk, lighter than cinnamon dust, wet pillow dumplings Posted 1 month ago 1 month
on Shawty
th1s mak3s me wanna to cr4ck p0pple and sn@p open a c0ld 1 wit my b0y5 Posted 1 month ago 1 month on Johnny Third - Quick Love (ReauBeau Remix)
charged up. super tough Posted 1 month ago 1 month
on Tobtok ft. Sorana - Rooftops (Aber)
put em on dance Posted 1 month ago 1 month
on Monkey Bars Feat. Claire Ridgely
$ Posted 1 month ago 1 month
on hmu
right Posted 1 month ago 1 month
on no doubt [5k]
massive respect Posted 1 month ago 1 month
on Afrocat - Sun
thoroughly enjoyed Posted 1 month ago 1 month on Afrocat - Sun
good mother fucking lord Posted 1 month ago 1 month
on Afrocat - Sun
oh snapp a lack Posted 1 month ago 1 month
on 4 lovers, pt 2
and the stereo got me like "iii i ii ii i wananan beeb b youyoyouyyyttt mananaabbb Posted 1 month ago 1 month
on 4 lovers, pt 2
absolutely loving the fart on the section crash Posted 1 month ago 1 month
on don't leave me alone year old goldwater x1000 than 1000 year in the future oylo Posted 1 month ago 1 month
on anewplace
@elliott-ives: facts Posted 1 month ago 1 month on NEST!
fragmented Posted 1 month ago 1 month
on goodies
@factory_flow: hahah he sure did homie Posted 1 month ago 1 month
on all yours
@alphaleiden: thanks man Posted 1 month ago 1 month on AINT SHIT CHANGE *ROUGH* (PROD. TYEPRODUCTIONZ)
movements Posted 1 month ago 1 month
on GRIEFLORD w/ AURÆTERNAL
good shit Posted 1 month ago 1 month
on Freddie Mercury - Bicycle Race (CHROME Remash)
sick Posted 1 month ago 1 month
on well, you know (20.00 lease -- 50.00 exclusive) traktrain.com/oylo Posted 1 month ago 1 month
on whob (10.00 lease -- 30.00 exclusive)
traktrain.com/oylo Posted 1 month ago 1 month
on sanctions (20.00 lease -- 50.00 exclusive)
traktrain.com/oylo Posted 1 month ago 1 month on it's about the angle (20.00 lease -- 50.00 exclusive)
traktrain.com/oylo Posted 1 month ago 1 month
on taking over
@churchoftheundecided: thanks cotu!! Posted 1 month ago 1 month
on empanada
sugar Posted 1 month ago 1 month
on ○ ¸ ...you °. @rhys-evans1: i'm kind of a celebrity in these parts Posted 1 month ago 1 month
on dead and beat
@onitram52: what's there to get my friend Posted 1 month ago 1 month
on Jay Dee - piano solo flip (1st unquantized)
@onitram52: boy spirit graahk shilo village Posted 1 month ago 1 month
on Dou
massive Posted 1 month ago 1 month
on Findme
i mean shit Posted 1 month ago 1 month
on Findme
good god damn my friend what are you on Posted 1 month ago 1 month
on Split w/ dxwntxwn
r.i.p. oylo Posted 1 month ago 1 month
on Mountains
scenic af Posted 1 month ago 1 month
on Jay Park (박재범) - Stay With Me(Tobias Dray Remix)
! Posted 1 month ago 1 month
on Jay Park (박재범) - Stay With Me(Tobias Dray Remix) if you could 3-d burn this waveform into butter i would beat off with it Posted 1 month ago 1 month
on Replacement Girl
poppy snackin Posted 1 month ago 1 month
on Replacement Girl
soft swing tang time smacks Posted 1 month ago 1 month
on Meek Mill x Tory Lanez x Drake Type Beat ''Revenge'' | Prod. by Foreign Beats 10-4 Posted 1 month ago 1 month
on SSJ
aw damn that's it? post more pls, thanks! Posted 1 month ago 1 month
on SSJ
corkscrew after loop after twist bro this ride is super sick, the lava wasn't even that hot Posted 1 month ago 1 month
on SSJ dope tight, percs tight close to the coaster car, right where i like accent to follow me, keep us trackin Posted 1 month ago 1 month
on Flacko
got the nasty boy dyin back there on the es sperando flaminco horn mane, give old buddy a break Posted 1 month ago 1 month
on Flacko
rude boy whip it - stutter peel ash smash Posted 1 month ago 1 month on Flacko
ooohh it's ivan not I V N Posted 1 month ago 1 month
on Falling
• Posted 1 month ago 1 month
on Falling
everything is suspiciously on point Posted 1 month ago 1 month
on Falling i need a hi hat like this, a soft ticker tacker Posted 1 month ago 1 month
on Falador
i fw you Posted 1 month ago 1 month
on Falador
twerk-dabbing in the party room like Posted 1 month ago 1 month on Falador
i'm frozen man, what is this bpm Posted 1 month ago 1 month
on Falador
dog this is fucking gross Posted 1 month ago 1 month
on drown.
666 feet of wave Posted 1 month ago 1 month
on gliding. pndwawter treasure chests amirite Posted 1 month ago 1 month
on gliding.
you're expressive. i dig Posted 1 month ago 1 month
on yacht.
nasty Posted 1 month ago 1 month
on yacht. yuck bro this beat slingin' smuck in my head wet Posted 1 month ago 1 month
on yacht.
swiggity swoogty, hide that booty Posted 1 month ago 1 month
on my nightmares haunt me.
dystopian dinotopia Posted 1 month ago 1 month
on xanax.
charged with oodles of fluid and juice ay ay ay ay ay ay ay ay ay ay ayayayay yy yy y y yy yy y y yy yy y y y y y y yy y yy yy y yy yy y yy y y yy y yy yy oh fuck bro i couldnt stop typing the lead caught me and the drums held my arms down Posted 1 month ago 1 month
on i don't want to lose your love.
creative Posted 1 month ago 1 month
on i don't want to lose your love.
counting the red blood cells Posted 1 month ago 1 month on Yunomi - य़䜜πЀϕϺЄ϶Є (feat. TORIENA) [NovaDrops Remix]
moanysexsynth yuhhh Posted 1 month ago 1 month
on Go Away
incredibly happy filled Posted 1 month ago 1 month
on diamat - Painkillers (Hartmann Remix)
take me all the way in Posted 1 month ago 1 month
on Bombers
breakout out, showering down, layering land of light and sound Posted 1 month ago 1 month
on ○ ¸ ...you °.
dude Posted 1 month ago 1 month
on ○ ¸ ...you °.
full of soul Posted 1 month ago 1 month
on ○ ¸ ...you °.
mix game 100 as fuck Posted 1 month ago 1 month on Prison Planet ft. eNtity [prod. yxng camo]
trip Posted 1 month ago 1 month on Prison Planet ft. eNtity [prod. yxng camo]
bro this should be huge Posted 1 month ago 1 month on Jay Dee - piano solo flip (1st unquantized)
pure essence - for natures Posted 1 month ago 1 month on Jay Dee - piano solo flip (1st unquantized)
pure excellence - from nature Posted 1 month ago 1 month on no use [oh so poisonous] • prod. jozwyn •
nas wit a capital T Posted 1 month ago 1 month on another dream this is sick. evolved james blakeesque rythm. beautiful elements Posted 1 month ago 1 month
on Lightheaded*
late night right jam man ok Posted 1 month ago 1 month
on City of God
eloquent medieval baille ball funk fest. good times Posted 1 month ago 1 month
on lambchops
rolling hard Posted 1 month ago 1 month
on Coke Sniffer Prod. by Mantra
mantra the destroyer Posted 1 month ago 1 month
on Coke Sniffer Prod. by Mantra
this is hot Posted 1 month ago 1 month on Bobby Shmurda - Hot Nigga (Exmag Bootleg)
all fucking night Posted 1 month ago 1 month
on trees
buttercream icing Posted 1 month ago 1 month
on BOUT YOU (feat. APOLLO HILL)
great listen. fulfilling experience Posted 1 month ago 1 month
on 0000 12 - Audio
this one's a pants creamer Posted 1 month ago 1 month
on Aesop Fable Feat. Tsuruda
warping voices Posted 1 month ago 1 month
on DARKMARK - Sensei
sick the hounds Posted 1 month ago 1 month on ԥᔨ仼䶲
blazatown Posted 1 month ago 1 month
on umbrella
warm rain Posted 1 month ago 1 month on Mezzo - Asteroid Boy (ft. Swisha)
livid Posted 1 month ago 1 month on Mezzo - Asteroid Boy (ft. Swisha)
down Posted 1 month ago 1 month on Mezzo - Asteroid Boy (ft. Swisha)
shorty got a fat 808 Posted 1 month ago 1 month
on bandits (sample kit link in desc.)
haunting Posted 1 month ago 1 month on bandits (sample kit link in desc.)
scratch that, illegal Posted 1 month ago 1 month
on bandits (sample kit link in desc.)
holy mother of pearl, this is naughty Posted 1 month ago 1 month
on TERROR W/ HALI that bassline straight rippin its way out the womb. done being cooked Posted 1 month ago 1 month
on TERROR W/ HALI
threats Posted 1 month ago 1 month
on TERROR W/ HALI
massive props guys Posted 1 month ago 1 month
on TERROR W/ HALI
hahahahahaahahahhah this is fucking evil!!!! Posted 1 month ago 1 month on 02.Dem Lil People
sick Posted 1 month ago 1 month
on 01.In Neutral
dope shakers, got me in a nice step Posted 1 month ago 1 month
on HAIM- Falling (NK30 REMIX)
going 1000mph Posted 1 month ago 1 month
on HAIM- Falling (NK30 REMIX) this shit got me trippin dude. encompassing movement Posted 1 month ago 1 month
on HAIM- Falling (NK30 REMIX)
saw you on joe goes bro what's up Posted 1 month ago 1 month
on New Generation Kids - Burn Me Down (ft. Ruben Hultman )
awesome vocals Posted 1 month ago 1 month
on New Generation Kids - Burn Me Down (ft. Ruben Hultman ) c maybe? idk Posted 1 month ago 1 month
on New Generation Kids - Burn Me Down (ft. Ruben Hultman )
experiential Posted 1 month ago 1 month
on blocked
live as fuck Posted 1 month ago 1 month
on Brrrap!! (OUT NOW)
bbbrap Posted 1 month ago 1 month on Jarreau Vandal 'Someone That You Love' (Franc Moody Remix)
spockalin Posted 1 month ago 1 month
on Chance The Rapper X Jeremih - Snowed In (Imotep Remix)
trappin' Posted 2 months ago 2 months
on The Push Stars - Me nice harmonies - well touched Posted 2 months ago 2 months
on worth_2
cutchomp kickchain on the spooky chord lane Posted 2 months ago 2 months
on worth_2
angrypeace Posted 2 months ago 2 months
on Langsette magical camp log toast. wet warm forest morning wrapped fiery mellow hair wet. massive starpower - unique in an extreme way Posted 2 months ago 2 months
on Funkin' these keys dominant all others' keys, you can't defeat these keys Posted 2 months ago 2 months
on Krass | Carried Away
arabia make me dance Posted 2 months ago 2 months on Parkinson White - Sun Beam
$$ $$ $$ Posted 2 months ago 2 months
on Bow Down (Sh?m Remix) cool resolution, unique fades between your mixture of tracks Posted 2 months ago 2 months
on light demo***** (w/fwdslxsh and romil)
easy listening. well enjoyed Posted 2 months ago 2 months
on TastyTreat x ESQ - Lemön
alien abduction bowel mutilation forced excursion Posted 2 months ago 2 months
on PRISM (1 year old shit i forgot about)
this is the nastiest most dumb evil shit i've heard in a bit Posted 2 months ago 2 months
on Lisa Mitchell - Wah Ha (Seekae Remix)
nothing but meditation here, good arrival Posted 2 months ago 2 months on simon eng - oh
soothed Posted 2 months ago 2 months
on simon eng - oh sprinkle of enjoyment, dash of sass, pinch of vintage pre- columbo modern-esque appeal Posted 2 months ago 2 months
on amortal
wiry and wrecked. i feel abandoned in this iron jungle surrounded by rebar and rust Posted 2 months ago 2 months
on Lost Kings - Quit You (feat. Tinashe) [Justice Skolnik Remix] spreading nothing my cheese grinning sun shining smiling fun Posted 2 months ago 2 months
on breath
haunted spirit inhabitants Posted 2 months ago 2 months
on one thing [95]
fantastic execution Posted 2 months ago 2 months
on rndm wide and wicked layin' presence portals dab smack in the center of the oscillating light rings Posted 2 months ago 2 months
on quick freestyle (prod. foust)
rusty clit Posted 2 months ago 2 months
on We Are Gonna Be Alright
my fav is door slammin' dry cuttin' thick percs Posted 2 months ago 2 months
on Alejo & Aytiko - Crude Awakening (Clip)
this is rough and rigid... it's like you're flooding my head with non newtonian fluid in angled disc wave patterns Posted 2 months ago 2 months
on Sktchy Ppl- Drip
i am zonking tf out Posted 2 months ago 2 months
on I Know You’re Feeling Numb
dope vibe Posted 2 months ago 2 months
on alone
massive ride Posted 2 months ago 2 months
on missing.
outdoor ballroom evening fun Posted 2 months ago 2 months
on jewels edit.
help that man, he is in agony Posted 2 months ago 2 months
on jewels edit.
i'm scared shitless right now Posted 2 months ago 2 months
on Felmax - My Love
devil's lingering Posted 2 months ago 2 months
on sexy jutsu this is interesting bucket. i like what i'm hearing - it's really got me quite relaxed (might also be the chronic) Posted 2 months ago 2 months
on Take Me In raw bass nice nasty touch on the creamy chords, dope mingling Posted 2 months ago 2 months
on Low
doin' it right Posted 2 months ago 2 months
on GOT GAS
grimel0rd Posted 2 months ago 2 months
on GOT GAS
this is nas with a capital t Posted 2 months ago 2 months
on movement
ayy Posted 2 months ago 2 months
on movement
808 so fat it's like u mom's fart Posted 2 months ago 2 months
on movement
snare cuts like bot cutter with the safety tab removed Posted 2 months ago 2 months
on See U There
nice listen Posted 2 months ago 2 months
on See U There
flute is boner material Posted 2 months ago 2 months
on See U There don't you say nothin' to me boooy you look like a mutha fuckin' uuuuhhhhhhhhhhhhhhhh Posted 2 months ago 2 months
on down wit u (description)
mother fuckin yuh Posted 2 months ago 2 months
on down wit u (description)
i want a sample of this 808 Posted 2 months ago 2 months
on down wit u (description)
this synth caught me Posted 2 months ago 2 months
on down wit u (description) scented fresh - making quick cuts and deep grooves Posted 2 months ago 2 months
on Power.
you ain't shit if you ain't about that sass life Posted 2 months ago 2 months
on Power.
tin elephant unpleasantries Posted 2 months ago 2 months
on Power.
aka the what you got Posted 2 months ago 2 months
on lil uzi vert - xo tour llif3 (josh pan & medasin remix)
. . . Posted 2 months ago 2 months
on Mura Masa & Charli XCX - One Night (Khamsin Remix)
cool mix. the vocals sit in the instrumental like a bench Posted 2 months ago 2 months
on wasca
yoooooo Posted 2 months ago 2 months
on wasca
mollywhop all the bitches Posted 2 months ago 2 months
on wasca lord these percs takin' me for a right good roundthablock Posted 2 months ago 2 months
on drug talk (prod. cresce)~ out on spotify now
sensual. silken smooth Posted 2 months ago 2 months
on Sushi - Keepin' On (Free Download)
fun Posted 2 months ago 2 months on Crawl
feelings Posted 2 months ago 2 months
on Windows Down (ft. Lonemoon)
@lonemoon: crawl back under your febreeze comerical couch you garbage slug Posted 2 months ago 2 months
on sure don't
@itsleemz: leeeemuuuur Posted 2 months ago 2 months
on taking over
@negative-headphone: appreciate the compliment my friend! Posted 2 months ago 2 months
on taking over
@biice: bo0OºoOm Posted 2 months ago 2 months
on sure don't
@biice: thanks! i personally like the first half more! lol Posted 2 months ago 2 months
on Logic - All I Do (Goldwater Edit)
why did you upload this Posted 2 months ago 2 months
on somebody buy me a 404
this needs to be longer!! i wasn't ready for it to end! Posted 2 months ago 2 months
on Monro - Elevation (remix)
this is pretty sick. nice stabs Posted 2 months ago 2 months
on Monday (imANGELO)
#detunedlife Posted 2 months ago 2 months
on Monday (imANGELO)
you're spookin' me dog Posted 2 months ago 2 months
on feinin this beat is dope as fuck. love the way it rocks and rides. i'm on Posted 2 months ago 2 months
on lock on my heart
music box of mystery and revelation Posted 2 months ago 2 months
on clarity lock painting a lovely view for myself and others. we appreciate your time spent creating, never stop Posted 2 months ago 2 months
on water falls the plucks, the vox, the vibe, my socks, they're rocked, this top, non-stop, perfection Posted 2 months ago 2 months
on rose gold smashing waves of fantastic colorful sound and beauty. the crashes are life Posted 2 months ago 2 months
on daeh ym ni syawla uoy era yhW lazy warped and dystopian. gives me a feeling of relief and content - thank you Posted 2 months ago 2 months on siee [OKC66]
tight Posted 2 months ago 2 months
on siee [OKC66]
break it down, toss it in the box flattening machine Posted 2 months ago 2 months
on siee [OKC66]
hail satan Posted 2 months ago 2 months
on BOR creative composition. very relaxing. it only felt like it was a minute long! Posted 2 months ago 2 months
on empathy
creepy wavy dissonant full wet smooth Posted 2 months ago 2 months
on Sad Meal - Oh
oodles and oodles of pure unadulterated energy. nice one sad meal Posted 2 months ago 2 months on 2young
damn bro, that is some raunchy bass. keep killing it. this went hard Posted 2 months ago 2 months
on Not Ego Strippin (Prod. "...")
such taste Posted 2 months ago 2 months
on Not Ego Strippin (Prod. "...") i'm not really sure where all of this fantastic music has been, but props to soundcloud for finally bringing it into my related. they've gotten it right. this is the shit i want to hear. bravo man, wonderful track Posted 2 months ago 2 months
on vespera.
incredible melodies. i appreciate the warm surrounding glee you filled the room with on this tune. easy going all day Posted 2 months ago 2 months
on So Am I
breathy chords will be the death of me. overjoyed by this - you've really created a beautifully soft body of sound here man. thanks for letting me listen Posted 2 months ago 2 months on aiyhn; inyourheadnow
very interesting percussion. gives me a bunch of ideas for my own work. keep it up charlieso, this is cool Posted 2 months ago 2 months
on soul
nice story being told. triumph and pain, success and downfall. wrapped together Posted 2 months ago 2 months
on Some Mistakes
awesome feel. all the individual components of those who worked on it shine through in their respective ways, coming together for a wonderful piece Posted 2 months ago 2 months
on goodbye warm summer days
<3<3 such peaceful serene surroundings. i want to live for eternity in these conditions. you've put my mind at ease for a few minutes in this busy hectic time on earth Posted 2 months ago 2 months
on Hindsight
thanks for showing me a good time. wish it were longer Posted 2 months ago 2 months on peak appropriate name and title friend Posted 2 months ago 2 months
on homme (feat. benny sings)
benny you're a slayer Posted 2 months ago 2 months
on play palette yuhhh son this is 100% gorgeous Posted 2 months ago 2 months
on hand to hold (feat. lontalius)
it's chilly in here Posted 2 months ago 2 months
on save
@nickgreenthumb: lol? Posted 2 months ago 2 months
on aftergrit
nice clean fun. i vibe Posted 2 months ago 2 months
on sure don't @officialimotep: thanks man Posted 2 months ago 2 months
on Araatan - Effervesce
seeing stars Posted 2 months ago 2 months
on sure don't
@liniror: thanks linir! Posted 2 months ago 2 months
on stories
@inn-checked: k Posted 2 months ago 2 months
on sure don't
@dominiquefrench: appreciate that! Posted 2 months ago 2 months on Makes Me Better (Ft. Amanda Sofia & Obvi)
good work you all Posted 2 months ago 2 months
on utopia w/ TAN keep it up guys Posted 2 months ago 2 months
on train.
magic level 99 Posted 2 months ago 2 months
on Garage ish
f r e s h Posted 2 months ago 2 months
on best for you w/ sophie meiers & tola
these instruments are living Posted 2 months ago 2 months on Subtact & Duskus - Wait (ft. Emma Sameth)
@user-781670139: correct Posted 2 months ago 2 months
on sure don't
@jared-heck-3: what's up jared Posted 2 months ago 2 months
on sure don't
@thedailydig: love Posted 2 months ago 2 months
on sure don't
@whyyoudelete: thanks for listening <3 Posted 2 months ago 2 months
on The Origins of The Milwaukee Cannibal
jesus christ Posted 2 months ago 2 months
on Andrew Luce - Trouble
@clint-poret: gotta get them golden scarab Posted 2 months ago 2 months
on 3MA3
pump power Posted 2 months ago 2 months on The Core ft. Sanna Hartfield / Lillithe & Paploviante
whirpoolin' Posted 2 months ago 2 months on The Core ft. Sanna Hartfield / Lillithe & Paploviante
killin it Posted 2 months ago 2 months
on Houman - Euphoric
deadly storytelling feel. taken to the grave Posted 2 months ago 2 months
on Shhh
nicely done... again... what's new Posted 2 months ago 2 months
on freedom
@oylo: it happened again. wtf did you do here wize? why is this shit turning meo on Posted 2 months ago 2 months
on Tibe - She Bad
good lord Posted 2 months ago 2 months
on Tibe - She Bad
this is fucking naaaaaaasty Posted 2 months ago 2 months
on Danny L Harle - Me4U feat. Morrie
such a cutieeeee Posted 2 months ago 2 months
on badmind
i like i like Posted 2 months ago 2 months
on Ananda
interesting scape you've painting here. scenes moving Posted 2 months ago 2 months
on In Touch
and those deep bubbling clanker percs hnnnng Posted 2 months ago 2 months
on In Touch
the chorus is perf Posted 2 months ago 2 months
on Emotional (Anjulie & Justice Skolnik)
this make my dick wet Posted 2 months ago 2 months
on woolymammoth & chrome republic - thotmail.com funk mode entering the hallway. get your spicket tockers a rollin' Posted 2 months ago 2 months
on BOWTYE x ROMderful - On & On
@thomhannum_skullkid: catchy as fucccc Posted 2 months ago 2 months
on HEY COACH IM HIGH
this shit is livid. rude af Posted 2 months ago 2 months
on luv rain (refurbished)
sex bullet ya feel me Posted 2 months ago 2 months
on sumthin sumthin - Lotus [RUN THE TRAP Premiere]
when your mom tells you to clean your room and then you close the door make a face and mouth whiny gibberish mocking her stupidity Posted 2 months ago 2 months
on Sem - Like U So
like this so Posted 2 months ago 2 months
on whats ya name? yooooooo this is mad creative rom. you got a good one here Posted 2 months ago 2 months
on Oneiroi
evil needle coming in fresh. i like this man Posted 2 months ago 2 months
on $wift BALLING ft Cloudy2800 prod by Clody2800 (DJ STAIN EXCLUSIVE)
relaxed but still taught. i can feel Posted 2 months ago 2 months
on Story (feat. Cimo Fränkel)
classy brass and sassy/punctual snare. good combo Posted 2 months ago 2 months
on Biggest Fan
hot one Posted 2 months ago 2 months
on Biggest Fan hell yeah. this that raggavibe. how can you not love this shit Posted 2 months ago 2 months
on Pasta
wonderful accompaniment Posted 2 months ago 2 months
on Pasta
mistifying Posted 2 months ago 2 months
on Satin Stranger
nice one Posted 2 months ago 2 months
on Satin Stranger
boy you got the groove down pat Posted 2 months ago 2 months
on Subtact & Duskus - Wait (ft. Emma Sameth)
sitting outside in this day-after storm, humid-ass 90º georgia sun, and this track is not cooling me down in any way Posted 2 months ago 2 months
on Point Point - Hands (feat. Denai Moore)
this is a genuinely wonderful piece of music. thank you Posted 2 months ago 2 months
on Purple Feelings ft. Rainsford spunky Posted 2 months ago 2 months
on Purple Feelings ft. Rainsford
now this is some fresh ass shit. appreciated Posted 2 months ago 2 months
on Wait Too Long
sensual feel. no homo Posted 2 months ago 2 months
on London Man
good moods Posted 2 months ago 2 months
on London Man
sparkling clean. i can taste this tune Posted 2 months ago 2 months
on 973 - Scarface (Prod. By Gio Nailati)
stay pullin in the green boys. grind don't stop Posted 2 months ago 2 months
on Chuuwee & Trizz - Rotation tight flow. good work on the matched layering. beat is super dope too Posted 2 months ago 2 months
on Fuck It Up ~ feat Lil Dude & Kelow Latesha (prod. Jprice)
quick tongue Posted 2 months ago 2 months
on Things You Want To Show Me [featuring Jussi Welin]
good shit my man Posted 2 months ago 2 months
on Recluse - Crystals
dark energy flowing 'round here Posted 2 months ago 2 months
on Recluse - Crystals
wet bailee Posted 2 months ago 2 months
on YOOKiE x Holly - Money Shotz
*seizes* Posted 2 months ago 2 months
on Andrew Luce - Trouble take me into the temple andrew. lets plunder this pyramid Posted 2 months ago 2 months
on 914 Sampson
beautiful jam. i mean absolutely gorgeous. well done Posted 2 months ago 2 months
on ANH & quickly, quickly - Charade (Ft. Mo Vibez & Olu Bliss) cutting edge pairing. those percs are perfectly peculiar Posted 2 months ago 2 months
on Sennid & Reggae Livication Records -"Take Dem Away!!" awesome, relaxing vibe. perfect start to my friday tune session Posted 2 months ago 2 months
on woke
@lowmain: thanks fam Posted 2 months ago 2 months
on XXX
@oylo: mad*nificent Posted 2 months ago 2 months
on Just Ride
heaviest sidechain i've ever experienced Posted 2 months ago 2 months
on Purity Ring - begin again (LAIRE Remix)
the chiiiiimes Posted 2 months ago 2 months
on idk.
clean Posted 2 months ago 2 months
on idk. is that a sample of the ghost from super mario party Posted 2 months ago 2 months
on Penguin's Club Quicky #1
pimp out the melodies like rain Posted 2 months ago 2 months
on Can't Keep Moving
bro this percussion is insane Posted 2 months ago 2 months
on Telescope Thieves - R U Still Down? (Kurus Bootleg)
very realxed. digging Posted 2 months ago 2 months
on Me And My Friends (Ft. Tola)
smooth experience. i'm on Posted 2 months ago 2 months
on sol.
awesome composition Posted 2 months ago 2 months
on M O V E
so much energy!! god damn Posted 2 months ago 2 months
on X&G - Home Feat. kidä
: ) Posted 2 months ago 2 months
on aywy - the thrill
yes Posted 2 months ago 2 months
on Nobody But You (ft. SAKIMA) this is prime time gang shit mane Posted 2 months ago 2 months on Speak Up (ft. Little Shadows)
this lead takes me back Posted 2 months ago 2 months
on Lavender
bless up Posted 2 months ago 2 months on Relapse [Interlude] (Prod. MadBliss & DailyBreed)
yuuhhhhh. bruh i am riding Posted 2 months ago 2 months
on dreams
thanks for this. peacful journet Posted 2 months ago 2 months
on you
<3<3<3 Posted 2 months ago 2 months
on p2 freestyle (prod. mitch geist)
@zottimusic: this Posted 2 months ago 2 months on remote w/ darrion (prod. xander)
this is seriously dope my friend Posted 2 months ago 2 months
on mebeforeyou
good god these stabs are deep Posted 2 months ago 2 months
on ourfirstdate
page checks out. everything is dope. thanks Posted 2 months ago 2 months
on gvnglove pt.two
real Posted 2 months ago 2 months
on Boring ?
how do you type that face. when i copy paste it the left eyebrow is missing every time. wtf Posted 2 months ago 2 months
on B ass To B ass
damn bro you really know how to bring those elements together. this makes me wanna shake the fuck out my flat board ass Posted 2 months ago 2 months
on Bipolar Disorder
mollywhoppin' Posted 2 months ago 2 months
on Bipolar Disorder
pump the accelerator Posted 2 months ago 2 months
on ourgarden
you got me speechless... Posted 2 months ago 2 months
on ghsts x jkma // Pocono
i love this Posted 2 months ago 2 months
on move that dope (
@eugenecam: thanks for enlightening me cam Posted 2 months ago 2 months
on move that dope (
@eugenecam: ooooohhhh Posted 2 months ago 2 months
on Windows Down (ft. Lonemoon)
facts Posted 2 months ago 2 months
on Windows Down (ft. Lonemoon)
guys this is very pleasing Posted 2 months ago 2 months
on Windows Down (ft. Lonemoon)
lonemoon you monster Posted 2 months ago 2 months
on Who Don't Wanna Ft. JAMO! & NATEY
pass it here please Posted 2 months ago 2 months
on Crowns (Produced By Rascal) good god damn... those horns are the perfect accompaniment Posted 2 months ago 2 months
on Crowns (Produced By Rascal)
rascal knows how to go out. this shit is mad Posted 2 months ago 2 months
on potential
bro i wish i knew how to produce anything Posted 2 months ago 2 months
on potential
dumb dank Posted 2 months ago 2 months
on astral travellin pt.1 (Lᴜᴍɪɴᴀᴛᴇ) incredibly fresh. i'm talking febreeze bro. i'm talking snuggle fabric softener you feel me Posted 2 months ago 2 months
on Worst Than a Drug Ft. ERAGE
tight Posted 2 months ago 2 months
on Flashbacks
innovative. creative Posted 2 months ago 2 months
on freedom
waves Posted 2 months ago 2 months
on freedom
pitched a tent instantly Posted 2 months ago 2 months on Migraine(Produced By Psymun, Greg Grease & Trelly Mo)
bro this is c l e a n Posted 2 months ago 2 months
on PUT YOU ON
butter in my ear canal Posted 2 months ago 2 months
on one u (prod. BobbyRaps)
flamesytnh Posted 2 months ago 2 months
on Roy Wood$ - Jealousy (Fwdslxsh Remix)
solid Posted 2 months ago 2 months
on Blindside
good lord. this part right here Posted 2 months ago 2 months
on trust me
your bass is warm Posted 2 months ago 2 months
on trust me
bckslxsh Posted 2 months ago 2 months
on I Need
daddy Posted 2 months ago 2 months
on I Need
beautiful. pumping emotions in here Posted 2 months ago 2 months on Perfect by Tyler the Creator ft. Kali Uchis & Austin Feinstein (cover) by Sara King
eerie relief Posted 2 months ago 2 months
on move that dope ( you know i've heard this sample probably a billion times but i still have no idea whatsoever what exactly it is that he's saying. y'all niggas move that dope - yah, nigga, move that dope - yoniga, move that dope? Posted 2 months ago 2 months
on 48 ft Jay Prince
this is fresher than tropicana Posted 2 months ago 2 months
on Trainlife
this is mad af Posted 2 months ago 2 months
on BIRTHDAY - We Need To Talk
gorgeous Posted 2 months ago 2 months
on BIRTHDAY - We Need To Talk
them vocals wetter than the ocean Posted 2 months ago 2 months
on Afterdark (feat. Aviella)
damn bro this shit is huge. absolutely charged the fuck up Posted 2 months ago 2 months
on kuiters - flavours lightly touching Posted 2 months ago 2 months
on the grass is always greener
magnificent work Posted 2 months ago 2 months on s. lyre - google maps holiday (hello ghxst remix)
tight flip Posted 2 months ago 2 months
on Humble (R3LL Remix) [Dirty]
inventive Posted 2 months ago 2 months
on taking over
@theoretical-being: <3 Posted 2 months ago 2 months
on rested
@theoretical-being: appreciate that! Posted 2 months ago 2 months
on NGHTMRE & GHASTLY - END OF THE NIGHT @user-180419430: this isn't the way to get your music out there Posted 2 months ago 2 months
on don't be scared [ sophie meiers x michael mason ]
now this some good shit Posted 2 months ago 2 months
on SOMETIMES
nice movement Posted 2 months ago 2 months on Diplo & Autoerotique - Waist Time (ETC!ETC! Whyel Remix) {OUT NOW!}
massive Posted 2 months ago 2 months
on FUBU & VERSACE
daymond john Posted 2 months ago 2 months
on Flume - Quirk (SVDKO Remix)
this is sparking Posted 2 months ago 2 months
on HOUNDS & baht - Morning Star bruh bruhs Posted 2 months ago 2 months
on árboles de humo. )
taste Posted 2 months ago 2 months
on NGHTMRE & GHASTLY - END OF THE NIGHT
damn Posted 2 months ago 2 months on Here Comes The Night (NGHTMRE Remix) [feat. Mr Hudson]
bro we whippin' out here Posted 2 months ago 2 months
on Neo Tokyo (w/ skypierr)
mad evil in here Posted 2 months ago 2 months
on Future - Mask Off (AVIDD & JUDGE Remix)
charge wit da raunch mane Posted 2 months ago 2 months
on rested @wolfensteinosx: thanks man Posted 2 months ago 2 months
on rested
@wolfensteinosx: if you mean the trickling swamp space bg fx, then no. lol it's a sample of me screaming that stretched to be like 16 bars long, then i pitched it and added assloads of reverb Posted 2 months ago 2 months
on YEET W/ WHO?
@notpil: i would never call you fat notpil Posted 2 months ago 2 months
on Turtle Bay
thanks for this time spent well rested Posted 2 months ago 2 months
on KaTT - [O012] Ultraviolet
good mother fucking lord Posted 2 months ago 2 months
on KaTT - [O012] Ultraviolet yo this sort of reminds me superhexagon music with a lower bpm Posted 2 months ago 2 months
on KaTT - [O012] Ultraviolet
raw mode entered Posted 2 months ago 2 months
on falling in love in 7/4 time
dare to explore Posted 2 months ago 2 months
on Line Prod By Derelle Rideout
r a d Posted 2 months ago 2 months
on AIDA - Let's Ride awesome composition! tons of energy throughout the entire piece. well made Posted 2 months ago 2 months
on Paradise Plaza ft. TOFUKU (NRMN Remix)
nice roar Posted 2 months ago 2 months
on Paradise Plaza ft. TOFUKU (NRMN Remix)
i thought this was about to be nxc Posted 2 months ago 2 months
on childish w/ otxhello
explosion typhoon rice Posted 2 months ago 2 months
on needle w/ bogart
such cute glides. i want to fuck your sampler Posted 2 months ago 2 months
on Gimme The Loot
gone digital. whippin' n whalin' Posted 2 months ago 2 months
on Gimme The Loot
snatchin' Posted 2 months ago 2 months
on DROELOE - See Through Me
about time i heard some new shit. this is tight Posted 2 months ago 2 months on AllttA (20syl & Mr. J. Medeiros) - Touch Down - Part I (Instrumental)
lovely... such a soothing experience Posted 2 months ago 2 months
on ҼӈӏҾӋҾҽ
dog you're triggering palpitations hhnnnngggggg Posted 2 months ago 2 months
on YEET W/ WHO?
the raunch is thiccc Posted 2 months ago 2 months
on rested
@liniror: <3<3 Posted 2 months ago 2 months
on rested
@david-paganin: thanks david! i appreciate the kind words Posted 2 months ago 2 months
on rested
@paullutz: lol i just saw this Posted 2 months ago 2 months
on What So Not & Burns - Trust (Badrapper & Benji Flip)
massive flip my dudes Posted 3 months ago 3 months on UZI VERT - XO TOUR Llif3 (LUCA LUSH LIFT)
clonk meh Posted 3 months ago 3 months
on six feet under
gong buster nang sauce Posted 3 months ago 3 months
on Touch
nutttt Posted 3 months ago 3 months
on "Jackal" makes the hair on the back of your neck stand up Posted 3 months ago 3 months
on All On Mi - Ft. Yung DB [Prod. Lemuel]
rope gang Posted 3 months ago 3 months
on Petite [Prod. Lemuel]
this is fresssssh Posted 3 months ago 3 months on walking
handfuls of fancy elegant pudding dripping through my fingers Posted 3 months ago 3 months
on Kasbo - Found You (Feat. Chelsea Cutler)
@user371814096: i'm kissed by the love of my life every day niggaaa Posted 3 months ago 3 months
on Slow Ft. CRT
i am enjoying the fuck out of this Posted 3 months ago 3 months
on Night Gleam Moon Dance
@sofasound-beats: check me twitte rbri Posted 3 months ago 3 months
on Night Gleam Moon Dance
@sofasound-beats: spelled it wrong lo l i'm still doped up on these wisdom tooth meds Posted 3 months ago 3 months
on Tonight w/ Del
all night Posted 3 months ago 3 months
on Ell (ft. Rocks FOE)
this har Posted 3 months ago 3 months
on EESTBOUND ~ COOLIT
i'm ice cold Posted 3 months ago 3 months
on sorry 4 flexing ft. compulsive
this was mad tight Posted 3 months ago 3 months
on Night Gleam Moon Dance
enrtrancing Posted 3 months ago 3 months
on Choke Me (feat. josh pan)
asphyxiate Posted 3 months ago 3 months on LUMBERJVCK - LITM feat. Kat Nestel (VNDL Remix)
tons of energy packed in here Posted 3 months ago 3 months
on aimeri - rustle (w/ holiday club) this has been a glorious journey. thanks for bringing me along Posted 3 months ago 3 months
on Sakura Blossom
this is gorgeous Posted 3 months ago 3 months
on Sakura Blossom will you send me that drummer chop sample? i can't find that sound anywhere!! Posted 3 months ago 3 months
on untitld - where da weed at (fooligan flip)
grime' Posted 3 months ago 3 months
on untitld - where da weed at (fooligan flip)
this fool again Posted 3 months ago 3 months
on Indifference
put me at ease Posted 3 months ago 3 months
on RiP DIAMONDS * [PROD. JFRESH!]
@layzie-g: fuck the fuck off. no one cares Posted 3 months ago 3 months
on uuuUuuUuuuUuUu
yup yup yup never get tired of this vibe Posted 3 months ago 3 months
on drive
all night Posted 3 months ago 3 months
on Blank - Hold On up and up and up and up and up anda pud an apud pa nad p au an dpoajpadad iad aano aija Posted 3 months ago 3 months
on Playboi Carti ft. G Herbo - Juice / No Limit (Prod. Honorable C- Note)
tighter than my highschool girlfriend Posted 3 months ago 3 months
on Numbers tell 'em Posted 3 months ago 3 months
on +
drowning in sad Posted 3 months ago 3 months
on Sloop (out NOW on Spotify!)
click clockin' on 'em Posted 3 months ago 3 months on OZZIE & Phazz - Throw Sum (Free Download)
. . . Posted 3 months ago 3 months
on TWYN - Martin
mad stacks Posted 3 months ago 3 months
on Lotus
this shit is amped Posted 3 months ago 3 months
on Downpour milky rain Posted 3 months ago 3 months
on laxcity & Røhaan - First Of Many (JADŪ042)
mighty Posted 3 months ago 3 months
on goodbye lonely
i want to eat this Posted 3 months ago 3 months
on Love Affair
yo this is clean af. like the third track in a row that i've reposted. and it's rare that repost anything. soundcloud is on fire tonight Posted 3 months ago 3 months
on Phazz & Ozzie - Illusion
damn y'all this is solid Posted 3 months ago 3 months
on u bit ~ w/ jasmine
wonderful piece guys. super unique collection of sounds Posted 3 months ago 3 months on 3lo - Necessities
@james_bryce: you and me both Posted 3 months ago 3 months
on Jamaican Tour
whoopin Posted 3 months ago 3 months on future & rihanna - selfish (sevnth remix)
sick Posted 3 months ago 3 months on Eclectic FM Vol. 023 - Steelix Guest Mix
this is a great mix. thank you Posted 3 months ago 3 months
on underscores - good morning
well done. lovely arrangement Posted 3 months ago 3 months
on Underestimate Love
<3 Posted 3 months ago 3 months
on mistake. wicked Posted 3 months ago 3 months
on Too Tired (Cambot)
@cambotmusic: yo i did! thanks for checking up Posted 3 months ago 3 months
on STYLSS Single 032: Indigo Beck - Future Runner
pail stop taking so many drugs Posted 3 months ago 3 months on AllttA (20syl & Mr. J. Medeiros) - Connery (Instrumental)
the fucking stabs!!11!!!!!!!!!1! jfc my man Posted 3 months ago 3 months on AllttA (20syl & Mr. J. Medeiros) - Connery (Instrumental)
f o r e v e r a n d a l w a y s w i l l i l o v e Posted 3 months ago 3 months
on Nosni X Bier - Underwater Fishtank
wishful tidings Posted 3 months ago 3 months
on Sway! (lease beat now) friendly atmosphere. nice feel Posted 3 months ago 3 months
on XXXTENTACION - All I Can Do Is Scream (Lvnar Rmx)
@lvnarlvnarlvnar: what's up Posted 3 months ago 3 months
on Osza - Beginnings
water Posted 3 months ago 3 months
on pastel
gorgeous piece Posted 3 months ago 3 months
on pastel every time i try to sing on my own music i do 40+ takes and delete them all, then do something dumb with my voice, and distort the living fuck out of it Posted 3 months ago 3 months
on Weaver Beats - U Do Know awesome sampling work. the flow sort of reminds me of that xxxtentacion likes pants shit swindail upped. lol just the sample though. good shit buddo Posted 3 months ago 3 months on GET BACK (prod. STAIN)
death shit Posted 3 months ago 3 months
on Eganomixxxxxxxx - Angel (DIVERSA Remix) where this cave hidden at? i need to find it and set up camp. i'm going tom hanks on that bitch. call me castoyloy Posted 3 months ago 3 months
on Too Tired (Cambot)
thanks! cya Posted 3 months ago 3 months
on Too Tired (Cambot)
this just made me want to play ratchet and clank Posted 3 months ago 3 months
on MOTHER EARTH ft. Cardone x Cosmic Charlie
on that new wave. sick combination of sounds Posted 3 months ago 3 months
on COSMICOSMO - MILK & COOKIE
bubble bubble bubble pop! Posted 3 months ago 3 months on Plastic Faces
<3<3<3<3 amazing Posted 3 months ago 3 months
on Because of You
nice one fung Posted 3 months ago 3 months
on Feeling Alright ft. Nessa Rica
chop god Posted 3 months ago 3 months on luke warm ft. marcus rodriguez
sexy sound Posted 3 months ago 3 months
on 2K17 (prod. by Heffy)
^ ^ ^ ^ ^ ^ ^ ^ ^ Posted 3 months ago 3 months
on snakes ft.faeriey
beautiful vox Posted 3 months ago 3 months on i frequently say the same things to different people
these synths are pure cash Posted 3 months ago 3 months
on i frequently say the same things to different people
yo me too Posted 3 months ago 3 months
on Yay :)
nasty evil. enjoyed Posted 3 months ago 3 months
on hang up / made in m & smuv (out now)
y'all just like playin' with our emotions or?? Posted 3 months ago 3 months
on Kenzo Paris
p o w e r Posted 3 months ago 3 months on Jane Deezy - Look At What You've Done (Produced by SUG) [Bonus Track]
sick piece of work you all Posted 3 months ago 3 months on Krs. // Loodi
i'm impressed by your ability to fit individual pieces together well enough to form a whole portion of your idea. super dope Posted 3 months ago 3 months
on Krs. // Loodi
this synth choppin' my ears into perfectly even slices Posted 3 months ago 3 months on SLIPKNOT (ft. UNOfromPLUTO, KAMIYADA, GAMEBOYSACE & YUNG BAMBI)
i need to change my pants Posted 3 months ago 3 months
on XXXTENTACION - All I Can Do Is Scream (Lvnar Rmx)
dude Posted 3 months ago 3 months
on HOLY TRAP FT. SMOKEPURPP (prod. DJ Patt x @RayAyy x CyberSuicide x Ca$hio)
sav Posted 3 months ago 3 months
on Shisto & Grizzrivers - Silhouette
l0ve Posted 3 months ago 3 months
on Shisto & Grizzrivers - Silhouette you ain't afraid to use your entire repertoire of energy mans Posted 3 months ago 3 months
on Acaer - Dude
sparks flying, missiles guiding, percs multiplying Posted 3 months ago 3 months
on ҦҺӋӅһӈӋӈ ҧӈ. ҋҐ
sweet serenity. for only a moment Posted 3 months ago 3 months
on cowboy killa
rope gang Posted 3 months ago 3 months
on cowboy killa
damn Posted 3 months ago 3 months
on lights down
reelin' in the feels Posted 3 months ago 3 months
on bad and boujee (flip)
drawin' blades bruh. watch yo self Posted 3 months ago 3 months
on Yung Gravy - Splash Mountain (ft feals)
i'm on with this Posted 3 months ago 3 months
on OldGold - Prism Talk
these percs are fucking nuts! Posted 3 months ago 3 months
on HYPERBOLICORANGEPEEL gooood! how do people get that stubby dropped the bassline down some stairs at x2 speed shit ugh i'm jealous Posted 3 months ago 3 months
on TOO WARM TO CHILL
the bounce is right. extraordinary piece my friend Posted 3 months ago 3 months
on NATLANTHM_test
i bleed red white and blue Posted 3 months ago 3 months
on Migos - Bad and Boujee [Paradise Edit]
this guy's a magician Posted 3 months ago 3 months
on Space Strut (Part II)
wicked Posted 3 months ago 3 months
on Unknown Immoral Tempestra better get back in the ship y'all our oxygen supply is very limited out here Posted 3 months ago 3 months
on MIRROR. (FEAT. COFFEEBLACK)
spank l0rd Posted 3 months ago 3 months
on YOU DECIDED. (FEAT. IDL3)
the spread on that rolling instrument is trippy - i like it Posted 3 months ago 3 months
on AGAIN & AGAIN.
this is live as fuuuuuck Posted 3 months ago 3 months
on unreal
tight! love the atmosphere. antique booty dancin' Posted 3 months ago 3 months
on fucking who knows these days..
charged like an electric bone saw Posted 3 months ago 3 months
on in deep..
interesting piece homie Posted 3 months ago 3 months
on Karma where they got dominican women with cinnamon tans Posted 3 months ago 3 months
on Karma
take me down to miami Posted 3 months ago 3 months
on vomit
tight Posted 3 months ago 3 months on Threats (Makzo Flip)
you got a smile on this face Posted 3 months ago 3 months
on Makzo - Deku The Guardian
wobbly Posted 3 months ago 3 months
on Makzo - Deku The Guardian
good lord. fancy mess Posted 3 months ago 3 months
on Makzo - Trips (ft. MARVOLU$ JAY)
awesome vibe makzo. i appreciate this Posted 3 months ago 3 months
on Makzo - Trips (ft. MARVOLU$ JAY)
verse catching fire Posted 3 months ago 3 months
on Whysp x Makzo - Tempest these drums are tripping me out. inspired Posted 3 months ago 3 months on It's Not Worth Your Life
i like you Posted 3 months ago 3 months
on Corners
taste Posted 3 months ago 3 months
on Corners
koipahnd Posted 3 months ago 3 months
on Heart Eyes x Coypond - Suppose hubba hubba. this is serene as fuck Posted 3 months ago 3 months
on Barrera - Salty [ᅉ001]
mista steal yo gur Posted 3 months ago 3 months
on TKOOO.
@hibe-davitian: thanks Posted 3 months ago 3 months on Skyscrapers (music video link in description) this is absolutely gorgeous. i want so desperately to make music like that Posted 3 months ago 3 months
on Arts & Leisure (feat. Kool AD)
rad rod Posted 3 months ago 3 months
on Arts & Leisure (feat. Kool AD)
okay okay yah Posted 3 months ago 3 months
on You Might Be (ft. Lils)
i feel bad for syllabic languages. their music suuuuucks Posted 3 months ago 3 months
on You Might Be (ft. Lils) hey.. huhuh can i get your... heheh autograf? hahahahah what a good one hahah so funny so funny Posted 3 months ago 3 months
on Mr Holmes (Colab Thomas F)
perilous cliffs and cascading valleys. it's like dinotopian skybacks meets rock orchestra. love it Posted 3 months ago 3 months
on Everything
l0rd have m3rcy 0n m3 Posted 3 months ago 3 months on Tulpa & BLANKTS - Kiss Fight ft. gnash
tiniest shaker in existence Posted 3 months ago 3 months
on Pupperino
better than deadmau5 Posted 3 months ago 3 months
on DIVERSA - lunatic
ass shakaa Posted 3 months ago 3 months
on Smoke & Mirrors
phenomenal. job well done... Posted 3 months ago 3 months
on Rich Boy (Said The Sky Remix)
this is a good'n Posted 3 months ago 3 months on Kasbo - Found You (Feat. Chelsea Cutler)
that roll up on those drums... nuts Posted 3 months ago 3 months on Jackal - Gunshot feat.Jammin (Jameston Thieves Remix) {buygore}
buddy Posted 3 months ago 3 months
on Mickey Valen - Wildcard (feat. Feli Ferraro)
impressed Posted 3 months ago 3 months
on Mickey Valen - Wildcard (feat. Feli Ferraro)
mickey your killed it. feli is slammin' as well Posted 3 months ago 3 months
on Shooters
pumper Posted 3 months ago 3 months
on Shooters
this shit make me wanna swang my dick round the city at night ghostridin Posted 3 months ago 3 months on Blithe.
@expand-dong-47677295: the classic insult followed by a half-hearted compliment Posted 3 months ago 3 months
on LOUD
d a n k Posted 3 months ago 3 months
on Snap Me (Prod. AYOTHEGAWD)
smooth talker Posted 3 months ago 3 months
on somethingslastforever
your majesty Posted 3 months ago 3 months
on Boombox Cartel - Alamo ft Shoffy (BVNDS flip)
bro your mix is ridiculous good Posted 3 months ago 3 months
on Boombox Cartel - Alamo ft Shoffy (BVNDS flip)
i just went blind Posted 3 months ago 3 months on rage logic & josh pan - feelin me
s l a m Posted 3 months ago 3 months
on Hungry Af
raunchy but spiritual Posted 3 months ago 3 months
on SPIRITED
this mix is fantastic Posted 3 months ago 3 months
on BACKWHEN - Racks
mad relaxing Posted 3 months ago 3 months
on BACKWHEN - Racks no ice please. i heard that on average restaurant ice is dirtier than their toilet bowl water Posted 3 months ago 3 months
on somewhere you call home
<3 Posted 3 months ago 3 months on somewhere you call home
grabbed me by the esophagus Posted 3 months ago 3 months
on TKOOO.
@west1ne: thanks Posted 3 months ago 3 months
on Drunk Feat. Reece
incredibly well made Posted 3 months ago 3 months
on thats my rule
tight Posted 3 months ago 3 months
on SUPERHARD
festival life Posted 3 months ago 3 months
on We With It (Prod. GRIME TRIBE) hard and clear. like bulletproof glass Posted 3 months ago 3 months on AllttA (20syl & Mr. J. Medeiros) - Match - Instrumental
wavy Posted 3 months ago 3 months on AllttA (20syl & Mr. J. Medeiros) - Match - Instrumental i love those 20syl stabs. they really get me going Posted 3 months ago 3 months
on skydoki - Impulse
bruuuuuuhhhh this is phenomenal Posted 3 months ago 3 months
on skydoki - Impulse
calm down vro ain't no reason to be this livid Posted 3 months ago 3 months
on Lizard
nice one caleb Posted 3 months ago 3 months
on TKOOO.
what does tko mean Posted 3 months ago 3 months on Background
dope ride. bro let me get another ticket Posted 3 months ago 3 months
on blvc svnd - backpack (prod. babe)
yuh Posted 3 months ago 3 months
on Noveaki
@abelationmusic: gotta get them jiggys boi Posted 3 months ago 3 months
on Moon River(Happy Birthday Anna)
<3<3<3 Posted 3 months ago 3 months
on In The Passing
forceful relaxation Posted 3 months ago 3 months
on Belvedere
your compositions are awe-inspiring Posted 3 months ago 3 months
on Belvedere dawg... you understand emotion on a different level than the rest of us. everything moves in unison and interlocks perfectly Posted 3 months ago 3 months
on Fourth Leg
lord Posted 3 months ago 3 months
on Fourth Leg
hnnnng Posted 3 months ago 3 months
on Fourth Leg
you deserve so much more recognition Posted 3 months ago 3 months
on Park Music
insanely gorgeous Posted 3 months ago 3 months
on always wednesday feat. zzzzoooo
where have you been my friend Posted 3 months ago 3 months on Cake it's rare you come across someone who's only posted gold Posted 3 months ago 3 months
on sad wedding 1, 2 + 3 (feat. soy)
...... Posted 3 months ago 3 months
on Ropes
who in the hell are you?? where did you come from scott james?? Posted 3 months ago 3 months
on night sky
soundcloud on fire today Posted 3 months ago 3 months
on joeshort¸ x sundrenched // auspicious
thanks for this time Posted 3 months ago 3 months
on touch
bold strokes. defining Posted 3 months ago 3 months on Long Day
best Posted 3 months ago 3 months
on them trees (beattape)
@oylo: p Posted 3 months ago 3 months
on them trees (beattape)
stay ouft Posted 3 months ago 3 months
on Noveaki
clanker's cavern Posted 3 months ago 3 months
on xxxtentacion likes pants
lmfaoooo Posted 3 months ago 3 months on REAL DEAL (Prod. by David Mordeci)
hail satan Posted 3 months ago 3 months
on keep sippin' w/ ted bruh you nasty Posted 3 months ago 3 months
on y o u .
evil spirits tauntin Posted 3 months ago 3 months
on WE AINT PLAYIN (with seventyseven)
deathray Posted 3 months ago 3 months
on felicita - Post Tenebras Lux that straight terrified me. i'm talkin' stone cold petrified Posted 3 months ago 3 months on careless cares .. (prod. haelen & cresce) ~ out on spotify now
i feel like sheddin tears Posted 3 months ago 3 months
on Taste of U
! ! Posted 3 months ago 3 months
on Tired Of U feel Posted 3 months ago 3 months
on Night Time Blues
fresher than 100% pineapple juice Posted 3 months ago 3 months
on Paradigm - Optical (prod. Weaver Beats)
never stop Posted 3 months ago 3 months
on IMSXRRY
gargantuan Posted 3 months ago 3 months
on Focus (feat. vlush)
beautiful Posted 3 months ago 3 months
on Focus (feat. vlush)
vlush, your voice is v lush Posted 3 months ago 3 months
on Focus (feat. vlush) where did you get this sample? golden corral? Posted 3 months ago 3 months
on A Tear in the Fabric
@pacificpatterns: synth-e-same Posted 3 months ago 3 months
on A Tear in the Fabric
shit... i didn't know it was already upped Posted 3 months ago 3 months
on frustration
@jaunabeats: <3 Posted 3 months ago 3 months
on jimmy v /ӂӍҀӌ ӁӈӍ (ϬϊλϷϬϐμφ)
stay surfin' clouds Posted 3 months ago 3 months
on JUNGLE w/ VOWL.
i'm wet Posted 3 months ago 3 months on simon eng & duendita - another time (world$tar money)
juiced up. refreshments Posted 3 months ago 3 months
on Lord Pretty Flacko Tesfaye III
righteous Posted 3 months ago 3 months
on Spring
: ) Posted 3 months ago 3 months
on Every Night Prod By Isaac Flame
f f f fire Posted 3 months ago 3 months
on Just let it all out awesome piece friend. clean vocals do it well! Posted 3 months ago 3 months
on Ambientskies
tense Posted 3 months ago 3 months
on Intergers
in love with the distorted industrial grime! Posted 3 months ago 3 months on Pure Feeling (Video on YouTube)
the guitar <3<3<3 Posted 3 months ago 3 months
on Painted Skies /Collab w Houman stunning composition. paints a wonderful scene Posted 3 months ago 3 months
on C.I.C x Broken Barrriers- Waves
hats bout to catch fire Posted 3 months ago 3 months
on C.i.C x Broken barriers Damn Remix ft.Sarah
up up up!! tight Posted 3 months ago 3 months
on This Arrow
wonderful! keep it going my man Posted 3 months ago 3 months
on Making Our Way
space travel Posted 3 months ago 3 months on Trapped In Time ( FULL INSTRUMENTAL/Lease for $9.99)
i'm absolutely taken away by your instruments. they fit so well together. this sounds beautiful Posted 3 months ago 3 months
on Taking Cortez
good god! killer Posted 3 months ago 3 months
on Concerto For Twisted Metal And Percussion
these drums are insane in the membrane Posted 3 months ago 3 months
on Boss Fight Pt.3
I HAD NO IDEA THEY MADE MORE GAMES AFTER UP YOUR ARSENAL. THIS IS A REVELATION. THANK YOU SO MUCH FOR OPENING MY EYES. THESE ARE THE BEST GAMES EVER MADE, AND NOW I HAVE MORE STORY TO UNFOLDADFDHFSDOGHOHGOAHGIOG YEEEAAHHAHAHAHAHAH!!!!!!! Posted 3 months ago 3 months
on Premiere: Noir & Olivier Giacomotto - Blackrays Feat. Hendrik Burkhardt (Original Mix)
soar Posted 3 months ago 3 months on Mika Nøme Ft. Marlena Shaw - Woman Of The Guetto(Rewrite)
dope af! Posted 3 months ago 3 months
on Mika Nøme - Acid Love(Original Mix) soft and solidified. cooling with constant movement. keep it up! Posted 3 months ago 3 months
on Have you ever seen the rain (cover by Miranda & Pierrou)
one of my all time favorites!! always great to hear others' take Posted 3 months ago 3 months
on Cocaine (cover by Miranda & Pierrou)
solid jam. blazing fingerwork Posted 3 months ago 3 months on SUMMERTIME ~ SUMMER TIME IS ALMOST HERE ~ YES IT'S TIME TO SMILE~ <3 xx
hooked me. i'm caught in the wave Posted 3 months ago 3 months
on YOU RAISE ME UP~ Sunnidayz~WE CARE FOR ALL COUNTRIES SUFFERING LOSSES FROM VIOLENCE~
wonderful cover sunnidayz! Posted 3 months ago 3 months
on Wishful Thinking (Sincerely Yours, Marianne 2016)
gorgeous Posted 3 months ago 3 months
on Soft Sea Breeze (Sincerely Yours, Marianne 2016)
you've placed me in a different location. amazing interlocking melodies Posted 3 months ago 3 months
on The Plug (Prod. DAViD)
sick. super interesting vibes Posted 3 months ago 3 months
on Tyme (Prod. Jay Kattz)
this beat is nuttttz Posted 3 months ago 3 months
on Hike yo you right 10 scars each ain't bad for a 10 mile hike with a grizzly no doubt Posted 3 months ago 3 months
on Magenta Doom By Digital Bionics - iZotope Remaster cyborg lyfe 4ever Posted 3 months ago 3 months
on Digital Bionics ~ Sleep Inducer ~ Slumber 3
icicles chilling and toms warming. sensational Posted 3 months ago 3 months
on superstructure
gargantuan Posted 3 months ago 3 months
on light pillar
thanks again for a great listen Posted 3 months ago 3 months
on light pillar you really don't hear much like this around here Posted 3 months ago 3 months
on we about 2 get hectic
we're already hectic up in this bitch Posted 3 months ago 3 months
on personnel
jewel Posted 3 months ago 3 months
on personnel
kuiters!!!1!!!!!!!!!111 Posted 3 months ago 3 months
on ESSENCE
masturbation Posted 3 months ago 3 months
on ESSENCE
i want to beat my meat to this Posted 3 months ago 3 months
on ESSENCE
punch ur clown type beat Posted 3 months ago 3 months
on ESSENCE
swing your golf club vibe Posted 3 months ago 3 months
on ESSENCE know what i mean? that choke your chicken kinda tune Posted 3 months ago 3 months
on ESSENCE
this that wax your dolphin type track Posted 3 months ago 3 months
on chances [bump]
<3<3 pure love Posted 3 months ago 3 months
on archway
this put me in the perfect mood Posted 3 months ago 3 months
on Swimful - Pearls
nothing but positivity vibration Posted 3 months ago 3 months on badgirl riri. ϛϛ (idk why but I miss youϛϛ out now)
yo lovibe how are you doing bro. Posted 3 months ago 3 months on badgirl riri. ϛϛ (idk why but I miss youϛϛ out now)
saaaaaaaame Posted 3 months ago 3 months on rzon. - For U
fancy rzon my left ear is jizzing Posted 3 months ago 3 months
on Datum
headspace removed. begin reinsertion Posted 3 months ago 3 months
on Woofboarding
street sailing!! Posted 3 months ago 3 months
on Rubin (Demo)
good feeling brother. i'm in it Posted 3 months ago 3 months
on It Will Be Alright castin' spells and drinking from magic wells. a d m b got powers we haven't seen. abilities we're not yet aware of Posted 3 months ago 3 months
on demonstrate (w/ who? & genesis)
n a a a a s t y Posted 3 months ago 3 months on demonstrate (w/ who? & genesis)
th9a4[8rvyu8432cunr2uc4cFDSAGSAG98 MJ UN ÓÔ ª∏ÍFNHZO Posted 3 months ago 3 months
on demonstrate (w/ who? & genesis)
hey! bitch how y'all gonna toss us around like this. Posted 3 months ago 3 months
on Dreams About Sun (New Album)
i want to scream that was so relaxing. how Posted 3 months ago 3 months
on steve harvey (ft. yung gravy)
yuuuuhhhhh Posted 3 months ago 3 months
on steve harvey (ft. yung gravy)
this is fucking clean Posted 3 months ago 3 months
on between us man that shit tasted great. thanks for a good time my friend Posted 3 months ago 3 months on ARMNHMR & Element - Wings ft. GRAYE (yitaku Remix)
heavier than this dicc Posted 3 months ago 3 months
on ARMNHMR & Element - Wings ft. GRAYE (yitaku Remix) dog this shit is charged the fuck up. i'm being electrocuted Posted 3 months ago 3 months
on little piano
brainmelt sundayy Posted 3 months ago 3 months
on shh053: Wuh Oh - Hairstyle
absolutely gorgeous. puring souls Posted 3 months ago 3 months
on met my weaboo bitch in asia town
why am i not following you Posted 3 months ago 3 months
on met my weaboo bitch in asia town
i'm ready Posted 3 months ago 3 months on Her (Airuei Mix)
liquid love Posted 3 months ago 3 months
on frustration
@gutterbeats: appreciate the kind words! Posted 3 months ago 3 months
on stuck like glue ,
milk Posted 3 months ago 3 months
on emma
heavy vibes Posted 3 months ago 3 months
on Meta *FREE DOWNLOAD*
dub plate gon rupture. waves is deep Posted 3 months ago 3 months
on Give Thanks oh my goodness... this feels good resonating in my ear liquid Posted 3 months ago 3 months on Toke
gang Posted 3 months ago 3 months
on i2i
desert murder Posted 3 months ago 3 months
on searchin'
<3<3 Posted 3 months ago 3 months on VIK/TRUE ("BLUR" CASSETTE OUT NOW)
always be true Posted 3 months ago 3 months
on Unknown
this album is choice Posted 3 months ago 3 months
on Spice
god damnnn Posted 3 months ago 3 months on Genesis this is painfully sweet. i'm serenaded Posted 3 months ago 3 months
on Addict
all day Posted 3 months ago 3 months
on DKVPZ - She Moves
didn't even notice the baille. sick Posted 3 months ago 3 months
on DKVPZ - She Moves
spiffy long dickin' Posted 3 months ago 3 months
on Pixelord - Metal Mutant VIP
dope Posted 3 months ago 3 months
on Pixelord - Gear Soul VIP (out now!)
savior of the rgb Posted 3 months ago 3 months on Shisto ೌৼ - The Gate (Akamu Remix)
nice job akamu Posted 3 months ago 3 months
on whats ya name?
oylo Posted 3 months ago 3 months
on Doppelgänger
the concrete jungle Posted 3 months ago 3 months
on HOW YOU KNOW
awesome vibe. rides so smooth Posted 3 months ago 3 months on FALL IN LOVE [PROD. GHOSTBOYSORA]
this shit it toooo catchy Posted 3 months ago 3 months on Beamon - Lil Yeezy (produced by jvst x)
<3<3 Posted 3 months ago 3 months on Lucid-
yum Posted 3 months ago 3 months
on all i know
this some fresh shit wize Posted 3 months ago 3 months
on taking over
@siniq: thanks man! Posted 3 months ago 3 months
on taking over
@ajm-15: the power within Posted 3 months ago 3 months
on taking over
@spiralizer: appreciate that! Posted 3 months ago 3 months
on "Without You", Lapalux.
@toomuchforhead: i feel you fam Posted 3 months ago 3 months on ..Run
@elaksi: no problem e. i got you Posted 3 months ago 3 months
on Duality (Feat. Swain)
wordsmith over here Posted 3 months ago 3 months
on lost ft.Rfen
goodness gracious!! run for cover!! Posted 3 months ago 3 months
on ..Run
@oylo: they gonna get you one of these days if you don't keep your guard up Posted 3 months ago 3 months
on ..Run
@elaksi: you pushin them mother fuckers to limit bro. you can hear how angry they are. all i'm sayin it watch your back homie! Posted 3 months ago 3 months
on do for u
so nice Posted 3 months ago 3 months
on do for u
good god man. this is just wonderful Posted 3 months ago 3 months
on MONA LISA
love them bg vox calls. great support Posted 3 months ago 3 months
on ..Run your instruments are livid man you better keep your lids peeled bc they gonna turn on you soon. never leave your daw open when you go to sleep Posted 3 months ago 3 months
on In Motion Ft. Japanese Wallpaper
clean and crisp. easy sailing Posted 3 months ago 3 months
on rough
jesus christ Posted 3 months ago 3 months
on rough
mans done gone off Posted 3 months ago 3 months on Smplyput- Yo Savior (Prod. JXMMY)[BLAZE IT.RECS EXCLUSIVE] Free Dl
your voice just cleared my sinus blockage Posted 3 months ago 3 months
on JaVonte - April's Fool (Mndsgn RMX)
absolutely gorgeous my friend. absolutely gorgeous Posted 3 months ago 3 months
on new directions
this makes me want to make music. gtg Posted 3 months ago 3 months
on Simon & Sowut SS - 晁㵕ਹᔜᐟ (baller) (prod. by rgry)
i don't speak this language but god daaaaamn Posted 3 months ago 3 months
on Simon & Sowut SS - 晁㵕ਹᔜᐟ (baller) (prod. by rgry)
bruhhh the pan just got me... fuck Posted 3 months ago 3 months
on Infuze - Alive feat. Brave (SINIQ Remix)
ouchhhhhh Posted 3 months ago 3 months
on Infuze - Alive feat. Brave (SINIQ Remix)
rape is not okay!!! Posted 3 months ago 3 months
on zoom i need a fucking butt plug. i'm about to blow shit out my ass Posted 3 months ago 3 months
on Her
sick and twisted fx in the background. sounds tight Posted 3 months ago 3 months
on Her
these vocals are heavenly Posted 3 months ago 3 months
on Inlove.
soothed Posted 3 months ago 3 months
on Inlove.
this put me in a mood Posted 3 months ago 3 months
on IN THE HILLS
interesting keys. providing a fresh change of taste. rope gang Posted 3 months ago 3 months
on 22
boy that tongue quick af. yo girl must love you Posted 3 months ago 3 months
on Ndovu do Sul
have i been transported. is this miami mami Posted 3 months ago 3 months
on Exalt
fresher than the prince of bel air Posted 3 months ago 3 months
on Exalt
daring. bold. brave. going where no soundcloud producer has gone before Posted 3 months ago 3 months
on KEEP U SWEET how the f u c k did you pump your mix up this high with no distortion?? these sounds are huuuge Posted 3 months ago 3 months
on PEEKABOO - REVENGE
icy Posted 3 months ago 3 months
on PEEKABOO - REVENGE
filth lord Posted 3 months ago 3 months
on CV022: Jaxan - Storm
smasha Posted 3 months ago 3 months
on CV022: Jaxan - Storm
dude this shit is gigantic Posted 3 months ago 3 months
on CV022: Jaxan - Storm sick combination. really fills the room nicely (room being my headphone) Posted 3 months ago 3 months
on wont u dat beepin' synth colder than an igloo Posted 3 months ago 3 months
on distracted
herzeloyde leaves a metallic taste in my mouth Posted 3 months ago 3 months
on josh pan shouted out my twitter raw footage. mans is breakin' windows and tossin frags out here watch it Posted 3 months ago 3 months
on GETTER - INHALANT ABUSE
lord Posted 3 months ago 3 months
on GETTER - INHALANT ABUSE
wreckin alllll the brain cells Posted 3 months ago 3 months
on litmas prod. lzr
7 7 7 Posted 3 months ago 3 months
on "Without You", Lapalux. @toomuchforhead: it's gonna be 2019 before you reply to this again Posted 3 months ago 3 months
on Runnin
dat voice like butter Posted 4 months ago 4 months
on Jug & The Trap Ft GunnzHAF(Prod. By Leon Lavvish)
good shit my friends Posted 4 months ago 4 months
on FRNCH BLACK - Cinderella
ballroom dances are keeey Posted 4 months ago 4 months
on Khalid - Location (Swell Remix)
happy belated birthday Posted 4 months ago 4 months
on Khalid - Location (Swell Remix)
swell Posted 4 months ago 4 months
on NONPLACES constancy Posted 4 months ago 4 months
on bad influence
nice. i too am a bunwatcher Posted 4 months ago 4 months on NIGHTOWLS - Blacked Out (feat. Brewski)
robots armed Posted 4 months ago 4 months
on Love FM
phonk Posted 4 months ago 4 months
on Sample Collection Demo [OUT NOW]
dope Posted 4 months ago 4 months
on Darci - Arts and Crafts
leave me spinning Posted 4 months ago 4 months
on Amphetamine
jam Posted 4 months ago 4 months
on Amphetamine
oh my goooo Posted 4 months ago 4 months
on Amphetamine
lobing i Posted 4 months ago 4 months
on Amphetamine
milkin me Posted 4 months ago 4 months
on Amphetamine
this beat is waaaay too chill Posted 4 months ago 4 months
on Melting Landslide
cutsie patootsie Posted 4 months ago 4 months on Kick It Ft. Duckwrth (Prod. Steeziak)
l0v3 Posted 4 months ago 4 months
on Interlude Ft. Steeziak
worth it tho Posted 4 months ago 4 months
on Stay Here (Prod. Verzache)
answer it dog it's s t e e z Posted 4 months ago 4 months
on Stay Here (Prod. Verzache)
massive Posted 4 months ago 4 months on Roses Ft. KEV, Natey, Ryan Vettel (Prod. Tastebreakers & KEV)
<3<3 Posted 4 months ago 4 months on Roses Ft. KEV, Natey, Ryan Vettel (Prod. Tastebreakers & KEV)
man you right chalk is always pastel ain't it Posted 4 months ago 4 months
on The Man Ft. KEV (Prod. KEV)
that switch bruhhh Posted 4 months ago 4 months on The Man Ft. KEV (Prod. KEV)
this shit is soo smooth Posted 4 months ago 4 months
on Assclap (Prod. Tastebreakers) is that the melody from the lawnmower??? dooope Posted 4 months ago 4 months
on See Thru Ft. Bowtye (Prod. Bowtye)
elegant stabs Posted 4 months ago 4 months
on See Thru Ft. Bowtye (Prod. Bowtye)
hahah holy shit! that's see-thru af Posted 4 months ago 4 months
on Thoughts (Prod. KEV)
never give up Posted 4 months ago 4 months
on Thoughts (Prod. KEV)
real shit Posted 4 months ago 4 months on Untitled Ft. Ryan Vettel (Prod. Ryan Vettel / Domino)
oh my god. i want to make something like this so badly... this is pure inspiration Posted 4 months ago 4 months
on Aye Ok Ft. Jamo (Prod. Chairgivers)
those background vocals are magnificent Posted 4 months ago 4 months
on Aye Ok Ft. Jamo (Prod. Chairgivers)
aye okayyy Posted 4 months ago 4 months
on Aye Ok Ft. Jamo (Prod. Chairgivers) this hotter than a baked potato wrapped in tin foil str8 off da grill Posted 4 months ago 4 months
on Orange / Prey Ft. Jenna (Prod. KEV / Medafiziks)
take it away jenna Posted 4 months ago 4 months
on Orange / Prey Ft. Jenna (Prod. KEV / Medafiziks)
whoooooa Posted 4 months ago 4 months on Intro (Prod. Natey) tick tock everybody. stay woke. you only got 1 life Posted 4 months ago 4 months
on Outro [For you] (Prod. Steeziak)
smackin snares like a fat booty Posted 4 months ago 4 months
on Caught Dead
got me in the right mood. appreciate that Posted 4 months ago 4 months
on HEFFYRAPS - Cobain (prod. HOUNDS)
in it to win Posted 4 months ago 4 months
on solstice
freshie sexy Posted 4 months ago 4 months
on CUTEBOICLIQUE - FIRST PLACE
rude daze Posted 4 months ago 4 months on riders. waveform so small but the mix so tall Posted 4 months ago 4 months
on Stuntin
yeuah Posted 4 months ago 4 months
on Stuntin
zoo zoo zoommmm Posted 4 months ago 4 months
on Tell Me
goooooood loooooooord Posted 4 months ago 4 months
on Repose
you messin' Posted 4 months ago 4 months
on Repose
clean pants are best pants Posted 4 months ago 4 months on OPF
speed Posted 4 months ago 4 months
on OPF
we livin now boys Posted 4 months ago 4 months
on juvenescence
fba;hoityuva ;98thv4a a Posted 4 months ago 4 months
on hit the pipe
the flavor Posted 4 months ago 4 months
on Only this is different, and i like it Posted 4 months ago 4 months
on Hiemal
foreign lands Posted 4 months ago 4 months
on Hiemal @beatsbyhalpe: is that the g-spot Posted 4 months ago 4 months
on Hiemal
gulp Posted 4 months ago 4 months
on Gangsta
@oylo: >gives out a bad vibe Posted 4 months ago 4 months
on Gangsta
@ogvfamily: "only good vibes" Posted 4 months ago 4 months
on Elevate the boogey man is real. he's hiding under this waveform Posted 4 months ago 4 months
on still think about you
@kanashiirobot: haven't heard of it, is that a good one? should i watch it? Posted 4 months ago 4 months
on Amelioration arp destroying me Posted 4 months ago 4 months
on Max Shylo & Fabio Masilla - That Moment
damn bro this shit be spaaaaankin Posted 4 months ago 4 months
on Lullaby *FOR SALE*
noice Posted 4 months ago 4 months
on Elona Jeta - Language
good work fam. super chill Posted 4 months ago 4 months
on Maximalist
i see you Posted 4 months ago 4 months on JNTHN STEIN - Silvertown (Mr Carmack Remix) [feat BXRBER]
wicked 666 <3<3 Posted 4 months ago 4 months
on wake up massive props Posted 4 months ago 4 months
on Faded... (prod. by Lean Diesel)
*gunshots* Posted 4 months ago 4 months
on Faded... (prod. by Lean Diesel)
huge prod Posted 4 months ago 4 months
on For3ign Savvy ~ Medusa (Prod. By Lescudi)
fillin' up them syllables Posted 4 months ago 4 months
on Questions
hell yeah i wish i had a beautiful voice Posted 4 months ago 4 months
on rich the kid - like this (ej flip) why you tryna make me so relaxed. what's your game dog Posted 4 months ago 4 months
on Fool
that was tight Posted 4 months ago 4 months
on she
beautiful riser.... i want that shit Posted 4 months ago 4 months
on she
this tune sounds like a timelapse of sex Posted 4 months ago 4 months
on VIRTUAL$UICIDE that kick is some window shattering shit right there Posted 4 months ago 4 months
on still think about you
pan caught me by the throat Posted 4 months ago 4 months
on still think about you
where y'all get all these sensual anime stills Posted 4 months ago 4 months
on MR COOL ICE (prod. C.Z.)
tighter than my rugrat Posted 4 months ago 4 months
on MR COOL ICE (prod. C.Z.)
mr dry ice Posted 4 months ago 4 months
on frustration
@artproject: thank you! Posted 4 months ago 4 months
on frustration
@z_w: low key thanks homie Posted 4 months ago 4 months
on frustration
@ecvilla-1: appreciate you brother Posted 4 months ago 4 months
on frustration
@negative-headphone: thanks! Posted 4 months ago 4 months
on frustration
@user-906048927: @kolada <3 Posted 4 months ago 4 months on ILY
awesome melodies. this is sick Posted 4 months ago 4 months
on ILY
10 - 4 mf Posted 4 months ago 4 months
on ILY
rogyr that shit!! yuuuuuh Posted 4 months ago 4 months
on Strngr. - Departure (ft. Wädé)
tight pauses. keeps me cpatured Posted 4 months ago 4 months
on i know
ever played carnival map on mw2? Posted 4 months ago 4 months
on i know i'm in love with your dark undertones. chills my spine Posted 4 months ago 4 months on thinkin of (day 9/15) if i could make this much music in a day, oh my fucking god...... Posted 4 months ago 4 months
on SHANGAI w/ SANE
are yall from a diff planet Posted 4 months ago 4 months
on Midwest Coast Love ft Kyndal J. (prod. By Mike Regal)
good stuff Posted 4 months ago 4 months
on Midwest Coast Love ft Kyndal J. (prod. By Mike Regal)
swoonin over here Posted 4 months ago 4 months
on HWLSxLOSCO_V01_*-*
guys...... Posted 4 months ago 4 months
on I Feel It Coming - (Zikomo Remix) you will always get me when you drive the bass up some stairs like that. mmph tasty Posted 4 months ago 4 months on Bob Ross Goes to Hollywood
dude. this is a fucking jaaaaam Posted 4 months ago 4 months
on Khary & Lege Kale - Too Fast
cool match Posted 4 months ago 4 months
on Khary & Lege Kale - Too Fast
elegant synthwork. woodland fairy shit Posted 4 months ago 4 months
on WAVEDASH & QUEST - Off Leash
r a w like my dicc after feb 14 Posted 4 months ago 4 months
on Jai Wolf - Like It's Over (Howle Remix)
great job howle. well done Posted 4 months ago 4 months on Bromar feat. Duava - Savage [BUY = FREE DL]
catchy i'm caught Posted 4 months ago 4 months on Bromar feat. Duava - Savage [BUY = FREE DL]
this is tight yalll Posted 4 months ago 4 months
on Pham & sober rob - Alibi (feat. Madi)
d Posted 4 months ago 4 months
on Pham & sober rob - Alibi (feat. Madi)
fresher than the laundry i needa fols Posted 4 months ago 4 months
on hoping.
@alex-simsky: i t ' s g o n n a b e m e n i g g a a a a a a Posted 4 months ago 4 months
on childhood vol. 1 - out now on splice!
oh wait Posted 4 months ago 4 months
on childhood vol. 1 - out now on splice!
this guy sounds like josh pan Posted 4 months ago 4 months on Rent Money (prod. Alex Lustig & Maki)
this works well. keep it up Posted 4 months ago 4 months
on Kap Slap - Gone (feat. Ezi) love love love the call and response. synths fit beautifully together Posted 4 months ago 4 months
on Mothica - Out Of It (Osza Remix)
i'm a fucking sucker for pitched vocal hits Posted 4 months ago 4 months
on I Got You (SNBRN Remix)
thought i just heard this... lol someone else reposted the same remix from snbrn Posted 4 months ago 4 months
on WhereUbeen
loving the whopping and the glooping Posted 4 months ago 4 months
on Bebe Rexha - I Got You (SNBRN Remix)
smooth talkin Posted 4 months ago 4 months on Bebe Rexha - I Got You (SNBRN Remix) my fingers hurt but i still want to comment on this Posted 4 months ago 4 months
on Post Malone - Congratulations (Ramzoid Edit)
this is a tight one rammy z Posted 4 months ago 4 months
on Surface (Feat. Nevve)
drive me home Posted 4 months ago 4 months
on Wuki ft. PRXZM - Let Me Go [Out Now]
these chops are gold Posted 4 months ago 4 months
on Beamon - Lil Yeezy (produced by jvst x)
dope vibes Posted 4 months ago 4 months
on hoping.
creep forest. come inside and see what you find Posted 4 months ago 4 months on Swim Tank #01 ft. Sofasound
@oylo: listening to this has only furthered my desire Posted 4 months ago 4 months
on Swim Tank #01 ft. Sofasound
@night-swim-radio: looking forward to the next one! i'm moving up to atl for a couple months soon, and i plan on doing this style of podcast with a bunch of local artists Posted 4 months ago 4 months
on By My Lonesome (prod. by Heffy)
@heffyraps: i'm just messing with you homie Posted 4 months ago 4 months
on thirteen (edit)
i like you Posted 4 months ago 4 months
on Swim Tank #01 ft. Sofasound
good god this is so true Posted 4 months ago 4 months
on Swim Tank #01 ft. Sofasound
1000x this! you have to be your own biggest fan dude. right there with you Posted 4 months ago 4 months
on WOLF
me too man, me too Posted 4 months ago 4 months
on BAKE SALE
dude you are evil Posted 4 months ago 4 months
on Treble
breh where am i Posted 4 months ago 4 months on "PIECE" - DUTCHBOY & ANFA ROSE (PROD. RYANJACOB + EERA)
fresher than cotton candy grapes Posted 4 months ago 4 months
on Hella Steez [Produced By Big Lo$]
plasma Posted 4 months ago 4 months
on Smoke (music vid in description)
the cloud is on fire this morning Posted 4 months ago 4 months on cup of noodle feat. j denim
nasty Posted 4 months ago 4 months
on cup of noodle feat. j denim
@mikkotsmaa: couldn't have put it better myself Posted 4 months ago 4 months
on By My Lonesome (prod. by Heffy)
good stuff homie Posted 4 months ago 4 months
on By My Lonesome (prod. by Heffy)
so you got... 4 connections? lol Posted 4 months ago 4 months
on Holiday w/ Tsuruda
raw power Posted 4 months ago 4 months
on MARCH 1 Alps
extremely well done Posted 4 months ago 4 months on i Jus prod. by ja burd
bustin like my nuts Posted 4 months ago 4 months
on ASPHYXIA
n Posted 4 months ago 4 months
on ASPHYXIA
kives Posted 4 months ago 4 months
on are you watching? i'm so glad this is the first thing i heard today Posted 4 months ago 4 months
on frustration
sorry if you hate lo-fi Posted 4 months ago 4 months
on taking over
@bigbushwolfpapa: i love you so much Posted 4 months ago 4 months on toasted
@666filthy: thanks man Posted 4 months ago 4 months on Kidä - Bone Mother (LOA REMIX) [XLR8R PREMIERE]
delicate Posted 4 months ago 4 months
on Peaceful James - L.O.V.E (Prod. AJMW)
i feel you Posted 4 months ago 4 months
on Eyes 4 U (3lo Rework)
dumb crazy perc game. super solid Posted 4 months ago 4 months
on STARTED - Gwen Bunn
cool style. interesting tang Posted 4 months ago 4 months
on patiently waiting
friendly Posted 4 months ago 4 months
on Rapper Chains this is some raw ass shit dude. like blowing ur nose for the 16th time in a day. or an asshole after 5 consecutive meals at taco bell Posted 4 months ago 4 months
on ghoul (prod. by visceral)
hell yeah guys Posted 4 months ago 4 months
on frumhere - dream tape
@oylo: too* Posted 4 months ago 4 months
on frumhere - dream tape
bro these liquid to asmr for me. sorry i can't listen any further. my mout is water and my spine is shivering Posted 4 months ago 4 months
on Elastic Heart
i i i i i i l l Posted 4 months ago 4 months
on Elastic Heart
i need to download the discog Posted 4 months ago 4 months on HALLS - Get To Know You ft. Darrick Atwater
whoa!! fresher than bounce dryer sheets Posted 4 months ago 4 months
on BLVK. X MFakka - Sundays those birds physically removed my stress and anxiety. tweet tweet Posted 4 months ago 4 months
on lido - dye (mossy. remix)
my dude. this one is dopeeeeeee Posted 4 months ago 4 months
on Divide And Conquer (Conover/Anmafean)
that subtle echo<3<3<3<3 Posted 4 months ago 4 months
on Palette Drum Kit 2 (BONUS FLP +) https://sellfy.com/p/Abtg/
oh yeah, this reminds me i need to post a track to adv my kit Posted 4 months ago 4 months
on ATIVAN COREA - 0001 59 - Audio
real truth is always revealed when them highs get dropped Posted 4 months ago 4 months
on skullkid - dear lord (w/ yourstrvly & saint.one)
earthword...... l o l Posted 4 months ago 4 months
on skullkid - dear lord (w/ yourstrvly & saint.one) boutta go earthword jim on they asses. watch out now Posted 4 months ago 4 months
on SofaSound - Good Intentions
<3<3 Posted 4 months ago 4 months
on SofaSound - Good Intentions
sub tryna talk to me Posted 4 months ago 4 months
on vibes i ii. (prod. by Krs. & iotosh)
nice. this some good shit Posted 4 months ago 4 months
on Thieves
scream your words to the world Posted 4 months ago 4 months on UP NOW
ha! tight Posted 4 months ago 4 months
on UP NOW
the droning vox shit is hoot Posted 4 months ago 4 months
on He Created a Monster
yeah yeah yeah Posted 4 months ago 4 months
on He Created a Monster this is a fine piece you've got here Posted 4 months ago 4 months
on criswell
i'm shaking scared for my life rn Posted 4 months ago 4 months
on The Sweet Spot (Akouo Remix)
akouo got da money Posted 4 months ago 4 months on Fuck A Hoe (Prod. By Onii)
vroom Posted 4 months ago 4 months
on Fuck A Hoe (Prod. By Onii)
what clout Posted 4 months ago 4 months
on Hawkeye Ft. Adrian Black (Prod. Cole Mayne)
don't cross the line. or be thrown in time Posted 4 months ago 4 months
on Unexotic & ZenAware - Solitude massive waves, then clear water, razor sharp chops and edging platinum lines surrounding the lows. prime Posted 4 months ago 4 months
on Typhoon
the evil within Posted 4 months ago 4 months
on Typhoon
over here murdering goons Posted 4 months ago 4 months on LET ME GO
wet snares are bae Posted 4 months ago 4 months
on Winnin' the harmonies are sweet n serenading Posted 4 months ago 4 months
on Winnin'
tiger blood Posted 4 months ago 4 months
on Winnin'
pullin' a charlie sheen Posted 4 months ago 4 months
on goodbye (ft. simon eng)
whoopin' me ass yuh Posted 4 months ago 4 months
on FijiWater
pourin' that fiji in the ice cube tray Posted 4 months ago 4 months on intentions. inventive. i like hearing fresh ideas Posted 4 months ago 4 months
on What U Need
gorgeous chaos Posted 4 months ago 4 months
on imagine/gvnglove
surrounding Posted 4 months ago 4 months
on NO GOOD
that's all it's about Posted 4 months ago 4 months
on GIRLS
i'm swoonin Posted 4 months ago 4 months
on TENFOLD
big ups filth Posted 4 months ago 4 months
on TENFOLD i want to collab with you, but idk if i can hold up to this level of quality Posted 4 months ago 4 months
on Kidd Loco-Beatin' Mah Dick
lmaooooo Posted 4 months ago 4 months
on Kidd Loco-Beatin' Mah Dick
this shit is savage Posted 4 months ago 4 months
on Initially human (Joey Badass remix)
reeeeal shit Posted 4 months ago 4 months
on AWAKE ᝁᯯ (+ Gvlvxy)
vrooooo Posted 4 months ago 4 months
on AWAKE ᝁᯯ (+ Gvlvxy)
i don't know how i got here, but i don't want to leave Posted 4 months ago 4 months on fuck yourself
this ratchet af Posted 4 months ago 4 months
on taking over
@aerogene: thank you! Posted 4 months ago 4 months
on Only Floating (Prod. Gummy)
slow n sweet Posted 4 months ago 4 months
on SWING
super clean Posted 4 months ago 4 months
on SWING you literally cannot go wrong when you start with chords like that Posted 4 months ago 4 months
on What If
enjoying these vibrations. keep feedin' 'em my way Posted 4 months ago 4 months on nasty
that kick gonna bust my pacemaker Posted 4 months ago 4 months
on nasty
scary tight spread Posted 4 months ago 4 months
on holding on
dope swing Posted 4 months ago 4 months
on holding on night time ride vibes slidin' thru all of time Posted 4 months ago 4 months
on ROAD BOI 7
@schaaka: bahahah Posted 4 months ago 4 months
on ROAD BOI 7
nasty but tasty. how? Posted 4 months ago 4 months
on floating over my city † Posted 4 months ago 4 months
on B.a.a.m
pound my damn fist boy Posted 4 months ago 4 months
on what u done.
cliccity cloogity i'm swangin' 4 day boogity Posted 4 months ago 4 months
on Generic. - Crackhead Bobby
tight one gen Posted 4 months ago 4 months
on Nai Br.XX - Adventure Time (jamie blake Remix)
yoiiii these stoobs r bomb af Posted 4 months ago 4 months on HAKA62 - LH4L - Bring Dat [DEER VIOLENCE ASSALARM EDIT] - @2dotthings_
i'm going to explode Posted 4 months ago 4 months
on where ya goin? tongue drippin' Posted 4 months ago 4 months
on 01-can-you-feel-the-sunshine
i need a pick me up rn Posted 4 months ago 4 months
on [not legal]
@vanrabeats: cerebral Posted 4 months ago 4 months
on Becking - Nostalgic Love
fills the air with stance Posted 4 months ago 4 months
on Iro ft. Mike Shapiro
full of beauty Posted 4 months ago 4 months
on Sofasound ~ Curiosity
@sofasound-beats: you're welcome son Posted 4 months ago 4 months
on show me w/ kolada @hereafter: where's my car Posted 4 months ago 4 months
on 246 (ft. Jordan Corey)
this is dope. i like it. thank you Posted 4 months ago 4 months
on in the middle of nowhere
@alonexxx: y o u h e a r d m e b i t c h] Posted 4 months ago 4 months
on wh!ppn the yayo
$ . ¢ Posted 4 months ago 4 months
on Blood In The Cut (Awoltalk Remix)
powerful subliminal stayin' shook Posted 4 months ago 4 months
on post alone
but u know i love u zacccc Posted 4 months ago 4 months
on post alone well that could be misconstrued as a bad thing Posted 4 months ago 4 months
on post alone
formulaic Posted 4 months ago 4 months
on "Slow Kill" feat. MattHill (prod. Kudzu)
spot on Posted 4 months ago 4 months
on hyuccboy - she love ft. cuteboiclique
in love with that cover Posted 4 months ago 4 months
on hyuccboy - she love ft. cuteboiclique we gon' get trapped in this pyramid maze if y'all don't hurry up and hit the other end. runnin' out of time guys pick it uppppppppp Posted 4 months ago 4 months
on There Is Hope, Yet
east you have a nice range of talent. a lot of people intentionally/accidentally (me) corner themselves into the same shit, but you have a diverse skillset my friend Posted 4 months ago 4 months on MAKJ x Max Styler - Knock Me Down Feat. Elayna Boynton wicked vocal power. done nicely. paired really well with the synths Posted 4 months ago 4 months
on This Little Mind
yup yup Posted 4 months ago 4 months
on tension
yuuuuuuh boi this is nice Posted 4 months ago 4 months
on Bilo 503 x cowode
world filled with wondrous pleasantries. go searching. explore, find, discover, inquire, give Posted 4 months ago 4 months
on Lido―Citi Bike―umru remix
yes Posted 4 months ago 4 months
on Lido―Citi Bike―umru remix
resurrection gang shit Posted 4 months ago 4 months on GINO & THE GOONS- Troubled
solid Posted 4 months ago 4 months
on GINO & THE GOONS- Troubled
fine wall you've built here Posted 4 months ago 4 months
on $now Bunnies (feat. jaco)
sick Posted 4 months ago 4 months
on Yellow Zone jeez my ginfers are just goofin' today idk Posted 4 months ago 4 months
on Yellow Zone
enohtem Posted 4 months ago 4 months
on Yellow Zone
meyjone Posted 4 months ago 4 months on Yellow Zone
cokeone Posted 4 months ago 4 months
on Yellow Zone
methtwo Posted 4 months ago 4 months
on [hereafter] - blue. (FREE DOWNLOAD)
yo? yo. yo yo yo yo Posted 4 months ago 4 months
on [hereafter] - blue. (FREE DOWNLOAD)
@hereafter: l0l Posted 4 months ago 4 months
on Pixelord - Axis VIP those snaps are wetter than vapor distilled duo hydrogs and an oxyg Posted 4 months ago 4 months
on $HE (PROD. KIDKEVA)
lord this is sav Posted 4 months ago 4 months on luculent
madness fills the air Posted 4 months ago 4 months
on Trapper point that kick at someone else dude i ain't tryna take no bullets Posted 4 months ago 4 months
on Morning Song
these them artery uncloggin' drums Posted 4 months ago 4 months
on Flexing (PROD. Vienna)
hahaah tight! Posted 4 months ago 4 months
on Flexing (PROD. Vienna)
because nigga. i stay flexin' holla @ me Posted 4 months ago 4 months
on in the middle of nowhere
spank me daddi] Posted 4 months ago 4 months on in the middle of nowhere shit i think i accidentally sent that as a reply instead of a reg comment Posted 4 months ago 4 months
on in the middle of nowhere
@night-swim-radio: prod fresher than fresh produce Posted 4 months ago 4 months
on Run Away
this boy feki gettin' goin' y'all Posted 4 months ago 4 months
on stories of the heart
sold Posted 4 months ago 4 months
on adhd
hottie lazotti with a swimmer's body Posted 4 months ago 4 months
on Perfume- Heavy Mellow Remix
boiling it upppp Posted 4 months ago 4 months on Special Re: Quest - Omniboi Remix
: ) : ) Posted 4 months ago 4 months
on In Motion
raw Posted 4 months ago 4 months
on In Motion
awesome drums Posted 4 months ago 4 months
on Long Beach
synth sayin wow i'm sayin wow Posted 4 months ago 4 months
on Long Beach
wipe the floor with em Posted 4 months ago 4 months
on Sofasound ~ Curiosity
w a v e s Posted 4 months ago 4 months on Sofasound ~ Curiosity
that sample sounds like a bit crushed king krule. dope Posted 4 months ago 4 months
on Sofasound ~ Curiosity
sooofaaa Posted 4 months ago 4 months
on Interstellar Dust
the tiniest most delicate little sounds <3 Posted 4 months ago 4 months on BUKU BANDZ X LIL TRACY - WIPE ME DOWN (PROD 16YROLD)
grah grah Posted 4 months ago 4 months
on i promise this will be my last cigarette
@bigdoggi: bro Posted 4 months ago 4 months
on AudioOpera - "Forever (Hot Sugar Remix)"
@oylo: i aim to have such a distinct sound Posted 4 months ago 4 months
on AudioOpera - "Forever (Hot Sugar Remix)" i knew it was hot sugar before i even saw the title Posted 4 months ago 4 months on BURT DOGG DRUM KIT VOL 1 OUT NOW!! (LINK IN DESCRIPTION)
did that dog appear in your room at 1am Posted 4 months ago 4 months
on Ride Around (feat. Adam Vida)
them kicks penetrate harder than ron jeremy Posted 4 months ago 4 months
on EASE (Lontalius Remix) [feat. Broods]
s(m)oothing Posted 4 months ago 4 months
on A.G. COOK - SUPERSTAR (DIVERSA REMIX)
these chords sound like friendship Posted 4 months ago 4 months
on A.G. COOK - SUPERSTAR (DIVERSA REMIX)
i have been waiting to hear this Posted 4 months ago 4 months
on røhaan - omen you have some cool ideas. i need to expand Posted 4 months ago 4 months
on switch (w/ james gent, akamu & shisto)
the unending descender Posted 4 months ago 4 months
on talk about our love
sidechain taking my breath away Posted 4 months ago 4 months
on tribulation whole track is super fresh. from the ploppin bubbles to the incredibly sick offset percs to those solid hoppin hats to the absolutely gorgeous vocal melodies to the panning synth. pure aesthetic Posted 4 months ago 4 months
on Distant W/ Vintage
flames Posted 4 months ago 4 months
on forget it...
elegant breeze with a touch of sultry grime peeking thru Posted 4 months ago 4 months on lets boogie
oooh yeahaheahhah Posted 4 months ago 4 months
on lets boogie i could dance to this for at least 12 minutes Posted 4 months ago 4 months
on Run Away
permeating every corner of the brain Posted 4 months ago 4 months
on disfnk - Wrist Motion
this is huge Posted 4 months ago 4 months
on kool aid jelly (www.traktrain.com/wize)
b be be okayyy Posted 4 months ago 4 months
on KISS ON ME *clean*
tingly dicc Posted 4 months ago 4 months on I Miss u
i ain't gone nowhere bb. dw i will never leave u Posted 4 months ago 4 months
on My System (The Next Galaxy) (Prod. by FREAKEY!)
awesome tune Posted 4 months ago 4 months
on My System (The Next Galaxy) (Prod. by FREAKEY!)
stay movin Posted 4 months ago 4 months
on My System (The Next Galaxy) (Prod. by FREAKEY!)
naaaaasty Posted 4 months ago 4 months
on My System (The Next Galaxy) (Prod. by FREAKEY!) these 808 sound like satan's farts on fast forward Posted 4 months ago 4 months
on My System (The Next Galaxy) (Prod. by FREAKEY!)
pass that shit over here Posted 4 months ago 4 months
on PAINT (visuals in description) jesus christ this is thug as fuck Posted 4 months ago 4 months
on Your Shirt
p Posted 4 months ago 4 months
on Your Shirt
melody goin' straightu uuu Posted 4 months ago 4 months
on Spirit Of Ardor
@weirdromance: can i be uncle oylo Posted 4 months ago 4 months
on Sunlight (Feat. Julia Lostrom) surround me with that warm embrace Posted 4 months ago 4 months
on find
chargin' Posted 4 months ago 4 months
on find goopy Posted 4 months ago 4 months
on Sharp Tongue - Benny Bun (Prod. Jinsang)
i like you Posted 4 months ago 4 months
on Hello Goodbye feat. MRSHLL stun gun on the end a whip tied to one of those giant fans on the back of a swamp boat Posted 4 months ago 4 months
on STAY WINNIN [prod. Juggman Rico]
stay livid, never stoppin Posted 4 months ago 4 months
on Ur Burnt - Pettros X Blackbear
nice nice Posted 4 months ago 4 months on Kid Trunks, ONLYPERC, & Bass Santana - SWOLE! (Free XXX) ~ KEYBLADEFLIP
stole on they asses yee Posted 4 months ago 4 months
on Delayed flight[89] goddamnpalnesalwaystyrnaperventusfromtgettingwherewen eedtogotwhatthefuckairorits Posted 4 months ago 4 months
on DontReallyCare
it's times like this that i wish i could rap with ease Posted 4 months ago 4 months
on apart
man... Posted 4 months ago 4 months
on Sadkey ~ Ought (Vincent Edit)
winning Posted 4 months ago 4 months
on Phonotecture 1k Sample Pack Teaser [FREE DL]
sex Posted 4 months ago 4 months
on Drevm & los - LoFi (JADŪ035)
@69los69: god tune my bro Posted 4 months ago 4 months
on Money Flip (feat. EndyEnds) [prod. Quazar Makeinu] all about them bands Posted 4 months ago 4 months
on O's [Produced By Drip-133]
all dayyyy Posted 4 months ago 4 months
on COZY CARTIER - VISION FT. JACKIE.NVM [PROD. JIMMY EDGAR]
chillls Posted 4 months ago 4 months
on darkside
this is good Posted 4 months ago 4 months
on Hotline Blang
dude...... beaut Posted 4 months ago 4 months
on can't reach me eerie... and you know i'm a sucker for that fucking gate pan shit omggg Posted 4 months ago 4 months
on Trippen ft Donald The Pharaoh (prod by. Timeline) heeeeell yeah Posted 4 months ago 4 months
on Wasted My Love
@axelmansoor: prayer hands Posted 4 months ago 4 months
on I can't see your shadow
@jo-johnston-1: in the same boat with you joe! Posted 4 months ago 4 months
on Crip Money (prod. by Ric & Thadeus)
nuttt Posted 4 months ago 4 months
on Crip Money (prod. by Ric & Thadeus)
brooo this is wonky. i'm on Posted 4 months ago 4 months
on Azide x J Swey ~ Kami
niiiice Posted 4 months ago 4 months
on what it do dmdmd Posted 4 months ago 4 months
on what it do
dap me dog mad dope Posted 4 months ago 4 months
on down on me
i literally just shivered Posted 4 months ago 4 months
on down on me
good god damn Posted 4 months ago 4 months
on gggg
spice evening Posted 4 months ago 4 months
on Slomo/Classic (prod.Mo Vibez)
maaaad bump mv Posted 4 months ago 4 months
on JULiA LEWiS - Awfully Close (feat. Rexx Life Raj) this tighter than them little bread clips they put on my english muffin bags Posted 4 months ago 4 months
on Fire Lily
put a smile on my face and in my brain Posted 4 months ago 4 months
on Tom & Laura Misch - Follow (FloFilz Remix)
well touched. love Posted 4 months ago 4 months
on Swooqy - Revelations (feat. Lakostik) this some massive shit right here fam y'all ever seen shit this massive?? don't think you have bc this the most massivest shit y'all ever did seen cuh ya feel me Posted 4 months ago 4 months
on GENER8ION - Malibu thoroughly enjoyed. appreciated my time here, thank tou Posted 4 months ago 4 months
on FANTASY
refreshing Posted 4 months ago 4 months
on treasure. hey alex Posted 4 months ago 4 months
on hush w/ cehryl
@epicuremusic: <3 Posted 4 months ago 4 months
on Posted
you do. yes you do Posted 4 months ago 4 months
on Messin Around
ummmmm?? Posted 4 months ago 4 months
on kiwi, with halpe holy smokes man that get sme Posted 4 months ago 4 months
on the let go
emotion prevalent Posted 4 months ago 4 months
on the let go you've got a sub in me Posted 4 months ago 4 months
on maybe one of these days
so smooth dude Posted 4 months ago 4 months
on maybe one of these days
absolutely chilling Posted 4 months ago 4 months
on CLICK ME! (prod. Takeaki Oda)
craycray Posted 4 months ago 4 months
on Chime҈ώϰαϭ (Rework) (Free DL from the description)
$$ Posted 4 months ago 4 months
on Chime҈ώϰαϭ (Rework) (Free DL from the description)
: ) : ) cute! Posted 4 months ago 4 months on From My Pillow To Your Pillow (A . B . Perspectives From Our Bedrooms Remix) filling the surrounding area with joyful expresssion Posted 4 months ago 4 months
on quickly, quickly - getsomerest/sleepwell (mini remix)
clonker fx prime time all the way Posted 4 months ago 4 months on Goldlink feat Ciscero - Fall In Love (Prestige Elite Remix)
tastebuds tinglin' Posted 4 months ago 4 months on Goldlink feat Ciscero - Fall In Love (Prestige Elite Remix)
i'm fallin' in love with these chordzz Posted 4 months ago 4 months
on manenough
dude this is naaaasty Posted 4 months ago 4 months
on manenough
saucin' Posted 4 months ago 4 months
on KRANE x DNMO - Sakura
i'm not sure how but this happened. jeez Posted 4 months ago 4 months
on Gucci Sweaters (Prod. Eugene Cam)
this is appreciated Posted 4 months ago 4 months
on Bitte... the industry never wants the individual to succeed. be the proof in the pudding Posted 4 months ago 4 months
on I'll Be Alright
magic fingers drizzling across me scalp. leaving wet dust trickling around me ears. arg Posted 4 months ago 4 months
on could be
killa Posted 4 months ago 4 months
on could be
sleep is for the dead Posted 4 months ago 4 months
on thinking about you merciful. you treat me right. danke Posted 4 months ago 4 months
on could be
_lo Posted 4 months ago 4 months
on mannequin (prod. senseiatl)
ill Posted 4 months ago 4 months
on PLAYINGWME
10000x better than cascade Posted 4 months ago 4 months
on PLAYINGWME
i can't believe what i'm hearing Posted 4 months ago 4 months
on PLAYINGWME
@coolidgesledge: sledge shit Posted 4 months ago 4 months
on PLAYINGWME
oh my fucking god Posted 4 months ago 4 months
on Strehlow & CSYSYK- Hyacinth (Original Mix)
mmph Posted 4 months ago 4 months
on JUSSRITE (feat. SACHI & Naji)
stay poppin' Posted 4 months ago 4 months on Strehlow & CSYSYK - Azure ft. SistaStrings & Bo Niemi (Original Mix)
friendships are important. let them know they're loved Posted 4 months ago 4 months
on playboi carti- fetti (skullkid remix)
fits my setting rn perfectly Posted 4 months ago 4 months
on LOWLIFE (JUDGE REMIX)
got daaaamn those harmonies got me Posted 4 months ago 4 months
on ᐟKami- no destiny
these percs are bout to wake from the matrix Posted 4 months ago 4 months
on ᐟKami- bor / come wit me
damn boy this shit is bangin Posted 4 months ago 4 months
on Uber <3 (feat. Princess Cyberspace & Gustave)
@º@ Posted 4 months ago 4 months
on Uber <3 (feat. Princess Cyberspace & Gustave)
@itsleemz: beeee Posted 4 months ago 4 months
on Dreamin'
i wish i could breakbustbumpnut Posted 4 months ago 4 months on iwannakillmyself (LEASE HERE) traktrain.com/basedantichrist
harder than this dicc Posted 4 months ago 4 months on iwannakillmyself (LEASE HERE) traktrain.com/basedantichrist
well dom Posted 4 months ago 4 months
on Super High [Produced by MadBliss]
blaaazed Posted 4 months ago 4 months
on 12345 (feat. Mo Cushle) got that elusive constant bob. flip my head on that 90º ish fam Posted 4 months ago 4 months
on dylAn – New Status Update [Rough/Demo]
yo this is mad dope Posted 4 months ago 4 months
on Reid Speed feat. Burnheart - Animal
speed Posted 4 months ago 4 months
on where do i go
wherever you want to Posted 4 months ago 4 months
on green tea in my slurpee
one of the best samples Posted 4 months ago 4 months
on green tea in my slurpee
cake bun Posted 4 months ago 4 months
on Sing Along (ft. KAINA and Ric Wilson)
wonderful piece. great vibes Posted 4 months ago 4 months
on Needing You
dope tune my brother. keep em' coming Posted 4 months ago 4 months
on Dirtyphonics X Virtual Riot - Beat Dem Up
jk kill it dp & vr <3 luv ya Posted 4 months ago 4 months
on Dirtyphonics X Virtual Riot - Beat Dem Up
buy gore? what is this?? spirit halloween??? Posted 4 months ago 4 months
on LMLY (4B x Teez Remix) all aboard we are blazin you gotta hop on b4 its too late bout to be goooone Posted 4 months ago 4 months
on Clockvice x Shurk - Unintentional
h u g e e e e eee e e e e e Posted 4 months ago 4 months
on post-panic
noise spin elastic dims Posted 4 months ago 4 months
on K.O. (feat. Duke Ducas) [prod. eugene cam]
d0pe Posted 4 months ago 4 months
on Evrdo - This Is Not You
whoa! that spread is trippin' me Posted 4 months ago 4 months
on ANH & quickly, quickly - Contrast
stratosphere shit Posted 4 months ago 4 months
on ANH & quickly, quickly - Contrast eagle's nest headquartahhs or hawk's ya feel whichever builds their home at a higher elevation Posted 4 months ago 4 months
on Idris Miles - FLGHT
damn how much i wish was under the rule of the queen Posted 4 months ago 4 months
on jewels
spun Posted 4 months ago 4 months
on i miss you
: ) but also : ( Posted 4 months ago 4 months
on SNOW PRINCE
travelling back in time to eata da samurai fodds Posted 4 months ago 4 months
on Pixelord - Gear Soul VIP (out now!) full. like me after i ate that bubba burger and half a bag of doritos for dinner Posted 4 months ago 4 months
on mcr020: Brainrack - Trying to fit in
turbine blew Posted 4 months ago 4 months
on crystal delight
soothe me Posted 4 months ago 4 months
on When You Left Me
<3 Posted 4 months ago 4 months
on When You Left Me
moments with you is goals Posted 4 months ago 4 months
on When You Left Me
dude. what have you done Posted 4 months ago 4 months on Once You've Met Someone, You Never Really Forget Them
cognitive imprints Posted 4 months ago 4 months on Once You've Met Someone, You Never Really Forget Them
permanent memories Posted 4 months ago 4 months on Through It All i wish i could make any music at all. anything i would be happy with anything good. anything any things Posted 4 months ago 4 months
on It's Hard To Do These Things Alone
i can literally taste this Posted 4 months ago 4 months
on It's Hard To Do These Things Alone
oh cavan Posted 4 months ago 4 months
on It's Hard To Do These Things Alone
got me elevated. floor 11 type shiz Posted 4 months ago 4 months
on Lost
<3<3<3<3<3<3 Posted 4 months ago 4 months
on Please Don't Forget Me, As I Can't Forget You.
anyone got some tissues Posted 4 months ago 4 months on crystal delight
egue egue Posted 4 months ago 4 months
on crystal delight
i mean Posted 4 months ago 4 months
on crystal delight
aki Posted 4 months ago 4 months
on SAINT WKND ft. Hoodlem - Golden (TRAILS Remix)
duuuuude cleeeeean Posted 4 months ago 4 months
on SAINT WKND ft. Hoodlem - Golden (TRAILS Remix)
cooler than a ziploc bag full of ice cubes Posted 4 months ago 4 months on Kygo - It Ain't Me (Selena Gomez) [SAXITY ft. Victor Perry Remix]
vocals placed well. good feeling Posted 4 months ago 4 months on repose (RIP NUJABES)
ear candies Posted 4 months ago 4 months
on Blood Brothers (w/ Hvgo) (prod. STAIN)
spookmaster Posted 4 months ago 4 months
on Face Yourself
lord help me Posted 4 months ago 4 months
on Face Yourself
tiny chops are my absolute fav Posted 4 months ago 4 months
on Face Yourself
nothing but class Posted 4 months ago 4 months
on Pollen Bullets you get an allergy, you get an allergy, you all gettin' allergiessssss Posted 4 months ago 4 months on Unplugged (Interlude) ft. White Punk & Noa
them strums make me had and sappy at the same damn time Posted 4 months ago 4 months
on Sober Rob - Sonder (William Crooks Remix)
push mastaa Posted 4 months ago 4 months
on Sober Rob - Sonder (William Crooks Remix) idk how i haven't really seen w crooks around until recently. mofo killin' game real talk Posted 4 months ago 4 months
on Wasted My Love soundcloud letting me down. all i want to do is listen to this song duuuuuudsfhdsdckjcdjks\ Posted 4 months ago 4 months
on headstone ft. Ca$h Bandicoot - Yacht Club [NEST HQ PREMIERE]
b b b b b b ang a Posted 4 months ago 4 months
on DELAY - Before The Storm
@takefivemusic: theistic level 99 Posted 4 months ago 4 months
on DELAY - Before The Storm
beyond eternal Posted 4 months ago 4 months
on josh pan & X&G - nowhere
breh Posted 4 months ago 4 months
on razor w/ mo vibez
tight percussion Posted 4 months ago 4 months
on razor w/ mo vibez
let the blades siiiiiink Posted 4 months ago 4 months
on Drevm & los - LoFi (JADŪ035)
jala dadu Posted 4 months ago 4 months
on Drevm & los - LoFi (JADŪ035) mechanical dogs eating mechanical hot dogs Posted 4 months ago 4 months
on Drevm & los - LoFi (JADŪ035)
i'm poured af Posted 4 months ago 4 months
on before you know it
interesting choice of instruments Posted 4 months ago 4 months
on before you know it
supa fresh tune! Posted 4 months ago 4 months
on M.I.A.
gorgeous Posted 4 months ago 4 months
on M.I.A.
@user-294098813: wow! awesome! guys this is totally legit! 100% not fake! Posted 4 months ago 4 months
on Herzeloyde - Outsider (Tiber Remix)
good one t. thanks Posted 4 months ago 4 months
on Herzeloyde - Outsider (Tiber Remix)
sidechain hooked me Posted 4 months ago 4 months
on Herzeloyde - Outsider (Tiber Remix)
release Posted 4 months ago 4 months
on beautifully underwhelming
andoandoaddandoaoodondanndoaododna Posted 4 months ago 4 months
on GRAVITY BEACON ACTIVATION
dude Posted 4 months ago 4 months
on GRAVITY BEACON ACTIVATION
drums decomposing atmos Posted 4 months ago 4 months
on Ouska - 5/4 push boundaries. let the masses in on the secret. push em further Posted 4 months ago 4 months
on playin cards (prod. smuv)
good pair Posted 4 months ago 4 months
on playin cards (prod. smuv)
same Posted 4 months ago 4 months
on eCUSSIONIST - Hortensia:redbelt jiggy wiggy's temple. you better solve the puzzle before time runs out if you want to advance to the next world brehh. take a ticket, take a number, get the gold, bangin' wondaaaaah Posted 4 months ago 4 months
on Diamonn Gurr - PT Cruiser
lord Posted 4 months ago 4 months
on Diamonn Gurr - PT Cruiser
dude. you're bout to put me in a coma Posted 4 months ago 4 months
on Marcuse - Tears frosty Posted 4 months ago 4 months
on Marcuse - Tears
marcuse!!!!!! this is gorgeous!! Posted 4 months ago 4 months
on lil traffic - Lights (Prod. internetBoi)
awesome flow Posted 4 months ago 4 months
on Lunar
dawg Posted 4 months ago 4 months
on Lunar
my oh my Posted 4 months ago 4 months
on Lunar drawing beautiful soundscapes before my very ears Posted 4 months ago 4 months
on Krs. ~ Bruk Out ft. Kes The Band
yusss bruk it up boys Posted 4 months ago 4 months
on Jhene Aiko - Vapors (MadBliss Rework)
doin numbas Posted 4 months ago 4 months
on modest with motion
good god damn Posted 4 months ago 4 months
on modest with motion
thook u done shook me Posted 4 months ago 4 months
on Dirt - Phoenix (prod. Seterah)
@dirtscythe: sarcophagus gang Posted 4 months ago 4 months
on Flume - Wall F**k (Mayke's 'Wall Frick' Flip)
power Posted 4 months ago 4 months
on Flume - Wall F**k (Mayke's 'Wall Frick' Flip) i will never not love them hollow breakin rimshots n shit omg Posted 4 months ago 4 months
on Flume - Wall F**k (Mayke's 'Wall Frick' Flip) mmmm son this some tasty ish u got right here yessiree Posted 4 months ago 4 months
on Head Off And On
<3 Posted 4 months ago 4 months
on Head Off And On
the air is thickening Posted 4 months ago 4 months
on _taukabou
pop out them lasers boys we gottta wreck these mechs before they destroy our homeland. ready?? Posted 4 months ago 4 months
on L O V E
@skug-1: always Posted 4 months ago 4 months
on Moh Flow ~ Give Me One [Free Download]
choice Posted 4 months ago 4 months
on Shivers N Gold (feat. Mascolo)
breh these vox thoooooo Posted 4 months ago 4 months
on Shivers N Gold (feat. Mascolo)
never fail to impress me Posted 4 months ago 4 months
on Dirt - Phoenix (prod. Seterah)
mausoleum life Posted 4 months ago 4 months
on sbtrkt- wildfire (skullkid remix)
@oylo: i always thought i'd never perform but my mind has changed Posted 4 months ago 4 months
on sbtrkt- wildfire (skullkid remix)
@thomhannum_skullkid: you have inspired me. that smile contagious dude Posted 4 months ago 4 months
on Grave [Video In Description] video was dope homie. good shit Posted 4 months ago 4 months
on park, lincoln
ancestral. killin boi Posted 4 months ago 4 months
on lotus born
wonderful! Posted 4 months ago 4 months
on cicadas
soft and sensual Posted 4 months ago 4 months on Catatonic Shuffle (aka the Zombie Boogie)
the guitar omfg Posted 4 months ago 4 months on Catatonic Shuffle (aka the Zombie Boogie)
i need that pair of squeak samples Posted 4 months ago 4 months
on BREEZES ['15]
fancy beaut Posted 4 months ago 4 months
on have you ever been in love (?)
jam lord Posted 4 months ago 4 months
on sbtrkt- wildfire (skullkid remix)
c u 2mrw fam Posted 4 months ago 4 months
on Spirit Of Ardor
boooooyyyy Posted 4 months ago 4 months
on afternoon nap
wizard Posted 4 months ago 4 months
on A Mile Past Mars
gorgeous! Posted 4 months ago 4 months
on Hate To Remember. caleb belkin? eevee? i can't recall... Posted 4 months ago 4 months on The Middle - Jimmy Eat World (Success Boys Cover)
teun Posted 4 months ago 4 months on The Middle - Jimmy Eat World (Success Boys Cover)
etnu Posted 4 months ago 4 months on The Middle - Jimmy Eat World (Success Boys Cover)
nute Posted 4 months ago 4 months on The Middle - Jimmy Eat World (Success Boys Cover)
classic utne Posted 4 months ago 4 months
on blk mirror
finally i can breathe Posted 4 months ago 4 months
on Love Da Way
soooo damn fresh... jeez Posted 4 months ago 4 months on Love Da Way i wish there was a god to have mercy on my soul rn Posted 4 months ago 4 months
on i've been dreaming since i woke up today
how the fuccccccc Posted 4 months ago 4 months
on when she knows how to roll
bang Posted 4 months ago 4 months
on when she knows how to roll
i'm reminded of x-files Posted 4 months ago 4 months
on signs of a struggle they find the scene but not the individuals involved Posted 4 months ago 4 months
on Glory
keep it up asha. this shit is great Posted 4 months ago 4 months on Glory
money money money. i can smell the greenery Posted 4 months ago 4 months
on rzon. - For U
@rzonn: love* not low Posted 4 months ago 4 months
on SWEAT
post tokyo madoran velo Posted 4 months ago 4 months
on LICKERS these lows lickin' me i'm botu to be black nand bruised Posted 4 months ago 4 months
on Drillwave (prod. by Heffy)
pant dick Posted 4 months ago 4 months
on BLACK OPAL
rising out the sarcophagus Posted 4 months ago 4 months on july15 2016
eerie powerdraw Posted 4 months ago 4 months
on rzon. - For U cool project rzon! low the whippin 808s in combo with the lightflute Posted 4 months ago 4 months
on Jowin - Kids Food For Jane And Jeff
cutie baby bounce Posted 4 months ago 4 months
on HOUNDS & Holly - WARHEAD
filthy as fuck Posted 4 months ago 4 months
on HOUNDS & Holly - WARHEAD
o______o am i dead Posted 4 months ago 4 months
on Rinse & Repeat
sound like you're torturing a baby elephant Posted 4 months ago 4 months on Rinse & Repeat
this man got the goods Posted 4 months ago 4 months
on some lofi valentines day thing
hotboxin Posted 4 months ago 4 months
on Bright Side
nice one bud Posted 4 months ago 4 months
on Invert (feat. Oshi.)
@rashaonsc: fancy seein' you here verzachebot Posted 4 months ago 4 months
on wetouched
bruh tell me already Posted 4 months ago 4 months
on ⌭
fluid Posted 4 months ago 4 months
on stockholm totototoro Posted 4 months ago 4 months
on ABSTRACTION
@doktar-andrey: i'm dazed and confused Posted 4 months ago 4 months
on H E A R T B R E A K
wondrous vibrations Posted 4 months ago 4 months
on Peace (Prod. By False Ego)
dunk Posted 4 months ago 4 months
on sayuw - cherry blossom (lust retouch)
nice n icy Posted 4 months ago 4 months
on samsin - Ache [Free Download Series]
samsin always on the inspiring shit Posted 4 months ago 4 months
on me n mii bih fam your bassline is livid. sounds like someone kickin' their shit into hyperdrive a couple blocks away Posted 4 months ago 4 months
on Sandor - Holy Ghost (Original Mix)
saaaaandooooooooor Posted 4 months ago 4 months
on Who Am I?
dreams Posted 4 months ago 4 months
on Who Am I?
melancholic. dreary. i like it Posted 4 months ago 4 months
on what u do to me
when i grow up i want to be geotheory Posted 4 months ago 4 months
on BESIDE
sta y grindin' Posted 4 months ago 4 months
on Vic Alexis - In Touch happy Posted 4 months ago 4 months
on dilo w/ evryn
u shall be saven Posted 4 months ago 4 months
on Noer the Boy - Generator
brain gettin' fried Posted 4 months ago 4 months
on MY-ONE-MAN-BAND-FUNK-JAM
you're all we need Posted 4 months ago 4 months
on 2-18-16 absolutely wonderful piece of work my dude Posted 4 months ago 4 months
on BXXMVX´- OZARi
is that point point i hear??? <3<3 Posted 4 months ago 4 months
on Older
nice one d Posted 4 months ago 4 months on Keys N Krates & KRANE - Right Here (Saen. Remix)
jet plane Posted 4 months ago 4 months
on Blvk Sheep - Insanity
u just kill me Posted 4 months ago 4 months
on Blvk Sheep - Insanity
i'm talkin' vantablack Posted 4 months ago 4 months
on Blvk Sheep - Insanity
ebony Posted 4 months ago 4 months
on Blvk Sheep - Insanity
obsidian Posted 4 months ago 4 months
on You Glow
your majesty Posted 4 months ago 4 months
on inutile love the mix of two completely different styles. fits nicely Posted 4 months ago 4 months
on hz
trying to do homework but i can't do pay attention to anything but what i am listening to Posted 4 months ago 4 months
on LA GIRLS
hahahahahahahah omfg Posted 4 months ago 4 months
on LA GIRLS
this that beat yo meat type beat Posted 4 months ago 4 months
on LA GIRLS
"ordinary" lol as if Posted 4 months ago 4 months
on i dream of things that never were
keep the brain healthy Posted 4 months ago 4 months
on i dream of things that never were
j r j r j a r Posted 4 months ago 4 months
on Curl Up Into A Ball
beautiful piece Posted 4 months ago 4 months
on Curl Up Into A Ball
hold the phone Posted 4 months ago 4 months
on SORCERER'S PRELUDE/SIGHTS + FEELINGS
oylo loves you too Posted 4 months ago 4 months
on xxxtentacion - YuNg BrAtZ Prod. STAIN
this comment section is cancer Posted 4 months ago 4 months on SPOZE X Kareful - DayByDay [ VISUAL IN DESCRIPTION }
this beat is iller than niggas with zika Posted 4 months ago 4 months on Streetware
blowin' bubbles of rubber trouble dog Posted 4 months ago 4 months
on Invert (feat. Oshi.)
what happened to soundcloud. everything used to be top quality shit like this. every single track was incredible. now it's all garbage Posted 4 months ago 4 months
on Invert (feat. Oshi.)
@cubanitonobeat: hahahah Posted 4 months ago 4 months
on Syne
been a good minute. beautiful piece Posted 4 months ago 4 months
on genie
whoooooooooooooooa hold up Posted 4 months ago 4 months
on princess peach (w/ R.O.M)
always tasty Posted 4 months ago 4 months
on poetic justice
@oylo: ssey Posted 4 months ago 4 months
͡ ͘ on I ̴̙N͙S̺O̗ ͏͓͕̝̫͎̣M̷̰͓N̖͎ I ̷̯͉A ͉̫ ̘̳ ̺͈ ͎ͅ ̪ classic elegance penetration Posted 4 months ago 4 months
on Gems & Roses
pump power Posted 4 months ago 4 months
on Purpose w/ MAYZiN
tighter than a virgin asshole Posted 4 months ago 4 months
on fog boy this here sure is a purty 1 Posted 4 months ago 4 months
on PRESCRIPTION FEAT. FAUNA
these chords are money Posted 4 months ago 4 months on Think Twice
whaaaaaa Posted 4 months ago 4 months
on vat?!
you've peaked my interest Posted 4 months ago 4 months
on rafala
you should be very proud of this Posted 4 months ago 4 months
on rafala love how the drums keep it moving along. lows pop in and give it that golden touch every few division Posted 4 months ago 4 months
on rafala
incredibly fresh composition! Posted 4 months ago 4 months
on Lay u down ft. P HEIR
keep up the good work Posted 4 months ago 4 months on instupendo play pack 3 out now! sellfy.com/p/zKlz/
da break Posted 4 months ago 4 months
on dreams (drumkit in description)
got some bailleish drums Posted 4 months ago 4 months
on dreams (drumkit in description) bass bout to bust out my headphones and eat my eardrums Posted 4 months ago 4 months
on EazyBaked - Move Forward [PREMIERE]
raunch monster Posted 4 months ago 4 months on i stole my brothers car keys to grab a regular spicy chicken grilled burrito
sound the alarms, they handin' you a regular unspicy chicken grilled burrito Posted 4 months ago 4 months
on woke
@dintyslop: cheers brother <3 Posted 4 months ago 4 months
on Благословенная Оптина - Свете тихий /☦ / Песнопения братии древней обители
i don't understand the lyrics but it's still beautiful Posted 4 months ago 4 months
on Благословенная Оптина - Псалом Второй /☦ / Песнопения братии древней обители
fill us up homie Posted 4 months ago 4 months
on Благословенная Оптина - Псалом Второй /☦ / Песнопения братии древней обители
i haven't heard many things like this on soundcloud Posted 4 months ago 4 months
on callie reiff & ronaissance - tin machine (empyrean tears remix)
i think i may have died Posted 4 months ago 4 months
on Lil Texas - I'm Yours [THUMP Premiere]
firing energy roda Posted 4 months ago 4 months
on R E M E M B E R stay alert Posted 4 months ago 4 months
on R E M E M B E R
so dreamy Posted 4 months ago 4 months
on R E M E M B E R
so creamy Posted 4 months ago 4 months
on absence☁ w/ cresylic
sakesakesakesakesake Posted 4 months ago 4 months
on Beauty
savage Posted 4 months ago 4 months
on prudent y'all never seen such elegant use of a bitcrusher Posted 4 months ago 4 months
on prudent . . . Posted 4 months ago 4 months
on divine gardens
<3 Posted 4 months ago 4 months
on divine gardens
omg where did we go Posted 4 months ago 4 months
on On My Own
dope as fuck Posted 4 months ago 4 months
on On My Own
yooo this is super tight Posted 4 months ago 4 months on Great Northern Aurora Borealis
dude this is very relaxing Posted 4 months ago 4 months
on Into The Darkness cool Posted 4 months ago 4 months
on Into The Darkness taking advantage of all available space in the room while staying tethered to a central theme Posted 4 months ago 4 months
on Children Of The Garden Collab w/ Collecting Pool
constant movement. i like this Posted 4 months ago 4 months on SeKwence X BIGBABYGUCCI - ''TWENTY4HRS'' (prod. Splndid)
nicely done Posted 4 months ago 4 months
on Hour of Darkness-A Break in the Clouds
very full Posted 4 months ago 4 months
on Solemn Cry Feat. Clara Sorace
<3<3 Posted 4 months ago 4 months
on Flame Spitter - Keep Ya Head Up beat by Pedregulho you sure spat some flame homie Posted 4 months ago 4 months
on Take Off High Ft. K Bandz (Prod. ThoVoBeatz)
awesome feel Posted 4 months ago 4 months
on Frankenskank
fucking banging Posted 4 months ago 4 months
on TOFUKU - Taipei (OhLookItsBubbaJ Remix)
those shooting star scream thoo Posted 4 months ago 4 months
on TOFUKU - Taipei (OhLookItsBubbaJ Remix)
yussssss Posted 4 months ago 4 months on Mr Bill - The Best Comment Ever (Track Is Forest Settings)
hahah tight Posted 4 months ago 4 months
on Conte - Pedals (OhLookItsBubbaJ Remix)
sick! Posted 4 months ago 4 months
on Conte - Pedals (OhLookItsBubbaJ Remix)
mad dubb Posted 4 months ago 4 months
on L.E.S. N.Y.C. 10009
@linnon: ^ Posted 4 months ago 4 months
on Venus
peaks my interest Posted 4 months ago 4 months
on Pistol Star trills percussion. the keys are wilin out Posted 4 months ago 4 months
on Sunset
the music speaks to me Posted 4 months ago 4 months
on Dad's Mind
massive guitar Posted 4 months ago 4 months
on Mom's Trees
awesome sound Posted 4 months ago 4 months
on Mom's Trees
you've put me in a different headspace Posted 4 months ago 4 months
on 0 0 0 Lochman Remix - Sublime - Bling Dawg - Reggae 0 0 0
that echo is prriiime Posted 4 months ago 4 months
on 0 0 0 Lochman Remix - Sublime - Bling Dawg - Reggae 0 0 0
interesting combinations Posted 4 months ago 4 months
on Get Ready For Rock ✔
whoa Posted 4 months ago 4 months
on Get Ready For Rock ✔ i want to make something like this Posted 4 months ago 4 months
on Can U Feel iT
$$$ Posted 4 months ago 4 months
on Can U Feel iT
god damn miranda... Posted 4 months ago 4 months on Poisoned Words (Roberto Sass & copyc4t) keep up the groundbreaking innovation Posted 4 months ago 4 months
on Twilight Garden 4
straight magic Posted 4 months ago 4 months
on Twilight Garden 4
pan me up buddy Posted 4 months ago 4 months
on Twilight Garden 4
waveform like a damn bullet train Posted 4 months ago 4 months on "FunkyBackStreet" With Jh0st / Please, read the description... ;)
wonderful composition. packed with feeling Posted 4 months ago 4 months
on "Streetlights"© (original) *See the description+VIDEO link!* ;)
stereo spread wowin me Posted 4 months ago 4 months
on "Streetlights"© (original) *See the description+VIDEO link!* ;)
poppin hops family Posted 4 months ago 4 months
on The Train ( Dedicated to Jean Rochefort and Johnny Hallyday )
forever waiting Posted 4 months ago 4 months
on CWD & RSS - Or The Start Or The End
tight drums. this makes me want to play ssx on tour Posted 4 months ago 4 months
on The Inner World ( Surround sound )
very interesting piece. ever changing soundscape Posted 4 months ago 4 months
on Gloom and doom
psychy wonder Posted 4 months ago 4 months
on Same Name
love yuor flow Posted 4 months ago 4 months
on Freestyle(Young God)
awesome job man Posted 4 months ago 4 months
on 20170211_voicedata0007.amr
emotional piece terrell Posted 4 months ago 4 months
on Crafted Love
sort of reminds me of something i used to listen to when i was very young. russia privjet or something like that. happy vibes Posted 4 months ago 4 months
on dead or alive 5
distort me bby Posted 4 months ago 4 months
on dead or alive 5
one one one one one one Posted 4 months ago 4 months
on dead or alive 5
um cha cha um cha Posted 4 months ago 4 months
on dead or alive 5
oh you baille? Posted 4 months ago 4 months
on 02 Thirteen Ways That You Don't Get It (man)
stay drummin Posted 4 months ago 4 months on 01 You Just Don't Get It (feat. Zach Holte And Dale)
fresh sounds. they fit together well Posted 4 months ago 4 months on 01 You Just Don't Get It (feat. Zach Holte And Dale)
cool arrangement Posted 4 months ago 4 months
on show me w/ kolada
@maxproaudio: thank you! Posted 4 months ago 4 months
on flow
@onsubeats: <3 Posted 4 months ago 4 months
on basement bugs
upload more!! Posted 4 months ago 4 months
on icanhearyouwhispering
super dope Posted 4 months ago 4 months on It's Almost December, Where's All The Snow? (Quickie)
your drums are finna catch fire homie Posted 4 months ago 4 months
on Eetee - Versailles
bumpin af Posted 4 months ago 4 months on November 23rd 1963: The Day After
well done friend Posted 4 months ago 4 months
on MyOwnStory [Original Demo Song] (ver.2017-01-11)
hyper happy Posted 4 months ago 4 months
on cs_gaz_yakukara(wip)
those bells stole my soul Posted 4 months ago 4 months
on Tennyson x Mr. Carmack - Tuesday
welp Posted 4 months ago 4 months
on show me w/ kolada
@lonemoon: *blushes* Posted 4 months ago 4 months
on flow i'm gonna need you to post some more music for me to listen to fam. please and thank you Posted 4 months ago 4 months on Slwmo - Flower Of The Mind
i'm die Posted 4 months ago 4 months
on Slwmo - Flower Of The Mind
energized Posted 4 months ago 4 months
on Slwmo - Flower Of The Mind oh my good lord. this is inspiring, saddening, overwhelming, willful, serene, delicious, and Posted 4 months ago 4 months
on max fry - Timeless
watch it max. you bout to summon a dremora Posted 4 months ago 4 months
on oh/god.
god damn Posted 4 months ago 4 months
on antisocial.
fill game incredulous Posted 4 months ago 4 months on antisocial.
enter the machine Posted 4 months ago 4 months
on Guaraldi Chops [Free Download]
@lonemoon: wassup fam Posted 4 months ago 4 months
on morose 1 [Free Download]
anyone down to take a hike and roll a j Posted 4 months ago 4 months
on Andy Mineo - You Will (SeizeTheBeat Remix)[Updated]
sick Posted 4 months ago 4 months
on De Primera Clase
happenin Posted 4 months ago 4 months on XENOS x EVANS DESIR x IZZO KENPACHI - FALLIN (PROD. BY: UNDERRATE)
420 Posted 4 months ago 4 months on XENOS x EVANS DESIR x IZZO KENPACHI - FALLIN (PROD. BY: UNDERRATE)
caught in hail Posted 4 months ago 4 months
on XENOS x IZZO KENPACHI - SHADOW THUGGIN (PROD. BY : UNDERRATE)
the raw 808s tickle me Posted 4 months ago 4 months
on XENOS x IZZO KENPACHI - SHADOW THUGGIN (PROD. BY : UNDERRATE)
damn son. nasty Posted 4 months ago 4 months
on Just A Little Bit feat. Cory Enemy
@vibe-sensational: i've never seen anything with enough comments Posted 4 months ago 4 months
on Sorority (DRUMKIT VOL1 : https://sellfy.com/p/MCyK/)
classic offset orphan snares panning round my head Posted 4 months ago 4 months
on overspace & whysp - microscopic (feat. lonemoon) this track is harder than it made my dick Posted 4 months ago 4 months
on overspace & whysp - microscopic (feat. lonemoon)
d 0 0 0 d Posted 4 months ago 4 months
on overspace & whysp - microscopic (feat. lonemoon)
charged as hell Posted 4 months ago 4 months on Great Dane & Deffie - Timecapsule (NEST HQ PREMIERE)
drums are literally fucking slamming Posted 4 months ago 4 months on Great Dane & Deffie - Timecapsule (NEST HQ PREMIERE)
my nuts bout to slip out they sack Posted 4 months ago 4 months
on Fall Asleep
magical invigoration Posted 4 months ago 4 months
on chills (down my spine) @xeightmusic: cook up da grill to 710 Posted 4 months ago 4 months
on ABSENT ft. Godzthought
got the freqqs Posted 4 months ago 4 months
on Power Button - Curren$y
fr3sh Posted 4 months ago 4 months
on simon eng - yes
falling in love but only on a sunday Posted 4 months ago 4 months
on FUCK ~ W/ JAKE MILLS
hell yeah clean that shit out Posted 4 months ago 4 months
on FUCK ~ W/ JAKE MILLS
ummm... yes Posted 4 months ago 4 months
on WeirdRomance - Rsvp
bruh you are so creative Posted 4 months ago 4 months
on WeirdRomance - Faceless oh my gooooood that synth is crying for help, let him go bro. it's not fair to keep wave slave Posted 4 months ago 4 months
on WeirdRomance - Faceless
you > me Posted 4 months ago 4 months
on WeirdRomance - Faceless
dog! this drop...... Posted 4 months ago 4 months
on WeirdRomance - Faceless
spank my cheeks and call me turdo Posted 4 months ago 4 months
on A High Place - Akii/Myrh
ridevibe Posted 4 months ago 4 months
on A High Place - Akii/Myrh
in love with these vox Posted 4 months ago 4 months
on A High Place - Akii/Myrh
mysterious trails Posted 4 months ago 4 months
on does it have to be
@myrhyum: <3 Posted 4 months ago 4 months
on Hyperloop
fresher than bread from tutorial island Posted 4 months ago 4 months
on Hyperloop
infuturistic Posted 4 months ago 4 months
on liefor w/ LDMA
thunder god Posted 4 months ago 4 months
on time to go (feat.Vada) cut daaaaa tape whattt famo famo faayyyyym yall stay on da slay game nahmsayn Posted 4 months ago 4 months
on gloom
x Posted 4 months ago 4 months
on gloom
la Posted 4 months ago 4 months
on Cranberry
best Posted 4 months ago 4 months
on Human Movement - Right Thang [Tregs Remix] (feat. Eliot Porter)
got an awesome groove Posted 4 months ago 4 months on EVIL NEEDLE & MO VIBEZ - Move (Red Bull Studios Paris Exclusive)
great feeling Posted 4 months ago 4 months
on pulse w/ hubrex (NOW ON SPOTIFY + ITUNES, LINKS IN DESCRIPTION)
who knew there were oceans on other planetary bodies Posted 4 months ago 4 months
on I'm Addicted (Feat. Jessi Lee)
i see you Posted 4 months ago 4 months
on Depth Charge
harley understands the wave Posted 4 months ago 4 months on How Could I Know? Feat. Lil West (Prod. Dylan Brady)
@radioexplosion: yep, that Posted 4 months ago 4 months
on show me w/ kolada
@gutterbeats: appreciate it! : ) Posted 4 months ago 4 months
on show me w/ kolada
@onsubeats: thank you onsu Posted 4 months ago 4 months
on Pale Fire
i should open a coffee shop Posted 4 months ago 4 months
on Spires
got dayummmm Posted 4 months ago 4 months
on ditty [prod. visceral]
well done Posted 4 months ago 4 months
on ditty [prod. visceral]
duuuuuuuuuudes this is mad Posted 4 months ago 4 months
on KRANE x Oceans - Silencio
sass Posted 4 months ago 4 months
on KRANE x Oceans - Silencio
destruction Posted 4 months ago 4 months
on KRANE x Oceans - Silencio sort of reminds me of the jolly roger's lagoon soundtrack when you dive into the lake Posted 4 months ago 4 months
on BOWTYE & Avalon Young - To Me
@therealbowtye: no problemo family Posted 4 months ago 4 months
on I Wanna Be
@oylo: you have a good ear man Posted 4 months ago 4 months
on I Wanna Be
@its_the_anka: yo i should thank you, some of the cymbals i use most are your cymbals Posted 4 months ago 4 months
on Legs And Arms
release some more music fam!!! Posted 4 months ago 4 months
on Legs And Arms
interesting piece! breath of fresh air Posted 4 months ago 4 months
on Herbie Hancock - Artist Advice
true that my friend Posted 4 months ago 4 months
on Carry On (Wave Racer Remix) [feat. Killer Mike]
ave wracer Posted 4 months ago 4 months
on it's different - Will You I Will (feat. HVNNIBVL)
you ain't never heard a snare this wet Posted 4 months ago 4 months
on Dugong Jr - See You Again (Ft. Northside & Mayowa)
@itsleemz: me and kolada had taco bell a little bit ago... <3<3<3<3<3 Posted 4 months ago 4 months
on idle [free download]
dark n deep Posted 4 months ago 4 months
on smle - By My Side
smle is a l w a y s solid Posted 4 months ago 4 months
on Sitting here at night,gotta work tomorrow
have fun at work, if you can manage Posted 4 months ago 4 months
on Memorecks - Raging Dreams
awesome composition. whole Posted 4 months ago 4 months
on zoned
them 808s are lude as fucc Posted 4 months ago 4 months
on Dugong Jr - See You Again (Ft. Northside & Mayowa)
@itsleemz: nm breh, just saw your avi. been a minute. how you doing Posted 4 months ago 4 months
on swindail's cheesecake pack ii - demo track (now 25% off ^_^)
wonk Posted 4 months ago 4 months
on Dugong Jr - See You Again (Ft. Northside & Mayowa)
vocals cut really well Posted 4 months ago 4 months
on Dugong Jr - See You Again (Ft. Northside & Mayowa)
@itsleemz: hey dude Posted 4 months ago 4 months
on shattered hands
dang...... this part right here...... Posted 4 months ago 4 months
on 4080
chords bring the spine tingling Posted 4 months ago 4 months
on billie eilish - ocean eyes (vowl. redo)
@inter-vene: have you ever left a comment other than "+1" because i really admire your commitment Posted 4 months ago 4 months
on Hati 'Anthology' Sound Pack
god Posted 4 months ago 4 months
on Hati 'Anthology' Sound Pack
@soncia-munoz: 2 l8 Posted 4 months ago 4 months
on I Wanna Be
$$$ cashflow $$$ Posted 4 months ago 4 months
on Bloom & Staygo - Frothin
i need to wash my ears Posted 4 months ago 4 months
on Bloom & Staygo - Frothin
loud n strong. just how i like my bison Posted 4 months ago 4 months on sumthin sumthin - Bloom [Noiseporn Premiere]
ruuuude Posted 4 months ago 4 months
on TroyBoi feat David Stewart - Showbiz
madness Posted 4 months ago 4 months
on TroyBoi feat David Stewart - Showbiz
@tubbz-435513939: truth Posted 4 months ago 4 months
on TroyBoi feat David Stewart - Showbiz
! ! ! !/\ Posted 4 months ago 4 months on WIZE - escobar [FREE DOWNLOAD] damn you bro i wasn't finna rewatch Posted 4 months ago 4 months
on Promises [Robots Can't Dance Version]
*great time Posted 4 months ago 4 months
on Promises [Robots Can't Dance Version]
you just done sunk me. i'm gone Posted 4 months ago 4 months
on It Don't Matter (feat. Anderson .Paak)
up Posted 4 months ago 4 months
on It Don't Matter (feat. Anderson .Paak)
@wuxirecords: sure is Posted 4 months ago 4 months
on It Don't Matter (feat. Anderson .Paak)
@umru: ikr Posted 4 months ago 4 months on George Pt. 2 (2011) i can't wait until the future. it must be awesome listening to music from your somewhat distant past Posted 4 months ago 4 months
on Twos
hell yeah maxo Posted 4 months ago 4 months
on 3 Chips From 2013
@biohannya: 2 kewl 4 skewl Posted 4 months ago 4 months
on JOYRYDE - DAMN ft. FREDDIE GIBBS
fart nasty Posted 4 months ago 4 months
on that miserable man milligan (feat. mr. carmack)
such consistency Posted 4 months ago 4 months
on that miserable man milligan (feat. mr. carmack)
lol what the fuck. i'm not following you?! Posted 4 months ago 4 months on TimeTravel w/ Duckwrth
2 hard Posted 4 months ago 4 months
on TimeTravel w/ Duckwrth
@noah-slen: SOAD Posted 4 months ago 4 months on Would I? w/ Martin J. Ballou & Mūdī
dissection Posted 4 months ago 4 months on Would I? w/ Martin J. Ballou & Mūdī
16-100 in an instant Posted 4 months ago 4 months
on cursed (w/ racine)
the panning moan is too sick Posted 4 months ago 4 months
on cursed (w/ racine) soundcloud belongs to the nords! Posted 4 months ago 4 months on cursed (w/ racine)
lofi skyrim Posted 4 months ago 4 months
on cursed (w/ racine) dude... i want to make something like this Posted 4 months ago 4 months
on Synesthesia
energetic Posted 4 months ago 4 months
on Synesthesia
oh my!! :) Posted 4 months ago 4 months
on admit it.
good lord. this is fresh Posted 4 months ago 4 months
on admit it.
okay okay i'll admit it Posted 4 months ago 4 months
on admit it. spank round Posted 4 months ago 4 months
on Don Pablo (3lo Flip)
fill level 99 Posted 4 months ago 4 months
on Don Pablo (3lo Flip)
sidechain bout to knock me out cold Posted 4 months ago 4 months
on Don't Be Gone
this that trippin over your own feet type flow Posted 5 months ago 5 months
on Alone
@sirridead: nah g, i was just talking about the hi hat itself Posted 5 months ago 5 months
on light pillar
@williamcrooks: many do not know this but charles nimbus is actually a hagraven who doesn't produce, but wills music into existence Posted 5 months ago 5 months on Torn Pages
@latejune: :4 Posted 5 months ago 5 months
on Alone is it a different sample or you have your hi hat in a sampler? Posted 5 months ago 5 months
on Money Up (p.excdus)
makes me wanna go chop down some trees Posted 5 months ago 5 months
on Dubble Clutch iii (DJ Mix)
dubble clutchin in da dutch dub club bubble Posted 5 months ago 5 months
on SWOOP NEB - WAYBETTER (prod. stunnah beatz)
hahaha lyricism 100 1000 Posted 5 months ago 5 months
on Torn Pages
gorgeous keys Posted 5 months ago 5 months
on BOWTYE & Avalon Young - To Me good shit Posted 5 months ago 5 months
on BOWTYE & Avalon Young - To Me
bowtye you're mad Posted 5 months ago 5 months
on BOWTYE & Avalon Young - To Me why doesn't anyone interact with major label tracks? Posted 5 months ago 5 months
on never waste a ❤ 's time
the liquidity in the percs *cry emojis* Posted 5 months ago 5 months
on slip
@oylo: damn them claps tasty Posted 5 months ago 5 months
on slip
@oylo: ight fam, go ahead Posted 5 months ago 5 months
on slip @oylo: i want to call them claps Posted 5 months ago 5 months
on slip
@oylo: or snares i guess whatever you want to call them Posted 5 months ago 5 months
on slip
damn them claps tasty Posted 5 months ago 5 months
on Thanatopsis (feat. Hrishikesh Hirway)
this is really cool Posted 5 months ago 5 months
on Escape
clever tag Posted 5 months ago 5 months
on BRING IT TO ME.AquaStoneThrone
heeeeel yeah. this is what i'm talking about Posted 5 months ago 5 months
on Long Day i can fuck to this Posted 5 months ago 5 months
on out yall need to wake the fuc k up ya feel me?? stayin woke is the only way to feel the real!!! 1! know what i'm saying family man okay now be still and watch the reel of feel ya feel dig dog frog hog Posted 5 months ago 5 months
on Surdi
intriguing process friend Posted 5 months ago 5 months
on Pleasure
bro keeping hopping all over me pls Posted 5 months ago 5 months
on The Gellaitry
jinkies Posted 5 months ago 5 months on YOOKiE - Subs (Milano The Don Remix) **Supported by YOOKiE**
low sweep made me think someone was pulling in the driveway so i paused it. twice Posted 5 months ago 5 months on Got It Bad (Sho Nuff Remix) mmmm this might be one of the best tunes on the comp...? Posted 5 months ago 5 months
on Ghosttown
sparkin Posted 5 months ago 5 months
on Numa
i dig your style. don't get to hear much original content on soundcloud nowadays Posted 5 months ago 5 months
on Come Inside
my dick wet Posted 5 months ago 5 months
on Makit Outhe 530
neva Posted 5 months ago 5 months
on missy ftw
perfect end Posted 5 months ago 5 months on missy ftw
awesome vox!! this is cool Posted 5 months ago 5 months
on Dead Till Monday - I Dnt (Free Download)
tight Posted 5 months ago 5 months
on Dead Till Monday - I Dnt (Free Download)
mad lazy. loving the vibe Posted 5 months ago 5 months
on Start It Up [Prod. J.Eliaye, Smash David & The Mekanics]
backroom vibes lit Posted 5 months ago 5 months
on Wave Wave & Blinded Hearts - Repeat (feat. Richard Walters)
good god slay Posted 5 months ago 5 months
on Wave Wave & Blinded Hearts - Repeat (feat. Richard Walters) that lowering sweep is destroying everything i know about transitions Posted 5 months ago 5 months on Wave Wave & Blinded Hearts - Repeat (feat. Richard Walters)
richard has a fitting tone Posted 5 months ago 5 months
on No Doubt
real funk spreading from that bassline Posted 5 months ago 5 months
on Reminisce (off 'Crumbs: Leftover Timbits')
fance lay Posted 5 months ago 5 months
on martin j ballou x falcxne x william crooks - drive ft. olukara & sophie meiers
legendary collab Posted 5 months ago 5 months
on william crooks drumkit [now with even more sounds!]
barebackin it Posted 5 months ago 5 months
on i've been here before
fuc Posted 5 months ago 5 months on i've been here before
d0000000d Posted 5 months ago 5 months
on Squadpack x Samplified - Inspire Crate (Sample Pack)
scawwwwwwww Posted 5 months ago 5 months
on verzache - wild
now i'm dehydrated \ Posted 5 months ago 5 months
on verzache - wild
death by pan Posted 5 months ago 5 months
on possible
been a good sec since i heard this Posted 5 months ago 5 months
on lantte - skyline that perc in the bg that sound like a car rolling over seams in a bridge at high speeds got me tripping out Posted 5 months ago 5 months on lantte - skyline
fr3sh 4f Posted 5 months ago 5 months
on yuh yuh (ft.otxhello)
yeah yeah only ever on real shit Posted 5 months ago 5 months on STéLOUSE - Lovers (Dabow Remix) [Premiered on Nest HQ]
dabow slayin this ish Posted 5 months ago 5 months
on CRNKN - The Grip feat. Sara Kendall (Ramzoid Remix)
holding that intensity Posted 5 months ago 5 months
on migos - get right witcha (josh pan remix)
josh Posted 5 months ago 5 months
on tied together [ep]
damn...... Posted 5 months ago 5 months on tied together [ep]
bro those fingers sliding on them strings hnnnnnnng <$ Posted 5 months ago 5 months
on I Cant Stop - Flux Pavillion i used to blast this track leaving the parking lot in highschool every single day Posted 5 months ago 5 months
on 2 - Lo. L E A F - S E X A F O A M
tuggin them heartstrings Posted 5 months ago 5 months
on zinfandel rosé
only truths Posted 5 months ago 5 months
on show me w/ kolada
@aerogene: thanks fam!! Posted 5 months ago 5 months
on show me w/ kolada
@david-paganin: thank you david! Posted 5 months ago 5 months on show me w/ kolada
@samuel-belman: appreciate that sam Posted 5 months ago 5 months
on show me w/ kolada
@bruce-conover: #lazygang Posted 5 months ago 5 months
on wavy lebron space jam for the culture
@kevyzero: rope gang Posted 5 months ago 5 months
on Mndsgn – GOTEEM!
funkdertones Posted 5 months ago 5 months
on Mndsgn – GOTEEM! i'd like to see how your mind is designed Posted 5 months ago 5 months on To Live My Life Again Conover/Steen/Wiggs
yusssss that break was cleeeaaan Posted 5 months ago 5 months on Wearin' The Crown (((Morgan Grealish))
nice!! Posted 5 months ago 5 months
on Wearin' The Crown (((Morgan Grealish))
feeling powerful Posted 5 months ago 5 months
on Wearin' The Crown (((Morgan Grealish))
that harmony sets a great mood Posted 5 months ago 5 months
on Shared A Dream
energized tune spiralizer Posted 5 months ago 5 months on Pryze Official - Business (Must Listen Fire Banger FreeDownload)
daaaamn Posted 5 months ago 5 months
on Y4SSINE Ft. Farisha - Rewind (Original Mix)
damn boy you got them explosive detonation mass destruction saws Posted 5 months ago 5 months on BOWDEN-audiophile MIX
stam stompin Posted 5 months ago 5 months
on Peter Kuli & Rogyr - Detached
damn it all fits together like glue Posted 5 months ago 5 months
on Peter Kuli & Rogyr - Detached
where is trinidad & tobago Posted 5 months ago 5 months
on William Crooks - Sleep (Peter Kuli Remix)
merciful Posted 5 months ago 5 months
on Esquimaux [EP]
yooo this the one Posted 5 months ago 5 months
on Jane
@rogiermuller: soundcloud says you've got 7 tracks but all i see are this and that ep? what's up w/ that Posted 5 months ago 5 months on Esquimaux [EP]
unf... i can taste the air Posted 5 months ago 5 months
on Adventure
top Posted 5 months ago 5 months
on Adventure
you know how it's done Posted 5 months ago 5 months
on Jane
got spunk homie Posted 5 months ago 5 months
on wud mood - tsnd mrk ♥
spread them wings and take off Posted 5 months ago 5 months on Ontario & Frequency - Ashes (Feat. Holly Drummond)
holly bells Posted 5 months ago 5 months
on Acid Clinic - Runaway i can easily dance to this Posted 5 months ago 5 months
on Resurrection
the kick just broke my arm Posted 5 months ago 5 months
on Element & MY BAD - Spells
classy drop Posted 5 months ago 5 months on Douglas Holland- Shame (Free Download)
spank chops Posted 5 months ago 5 months
on Gone
melody str8 glydin my man Posted 5 months ago 5 months
on 1'00
sk Posted 5 months ago 5 months
on inix altering our states of mind Posted 5 months ago 5 months
on Driving Through Fog to Røyken (Happy Birthday Lind) soft clouds being dispersed from a god's vapor machine Posted 5 months ago 5 months
on Shadow Man
grant. keep it up. this is intriguing Posted 5 months ago 5 months
on At Axon Terminal
jak! Posted 5 months ago 5 months
on At Axon Terminal
do you need help Posted 5 months ago 5 months
on At Axon Terminal
i can't understand you Posted 5 months ago 5 months
on At Axon Terminal
are you stuck in the computer Posted 5 months ago 5 months
on At Axon Terminal
where did you come from Posted 5 months ago 5 months
on X - aXis 101
these sparkling bells keep morphing my understanding of the mix's presence. coo Posted 5 months ago 5 months
on Thoughts becoming Things Part 13 it's like you're repairing the piece of my brainweb that have been damaged Posted 5 months ago 5 months
on Adrift
beautiful Posted 5 months ago 5 months
on New Dawn
well-composed. wrapping atmosphere Posted 5 months ago 5 months
on Sprinky Sachenmacher danger danger danger Posted 5 months ago 5 months
on Sprinky Sachenmacher
whoa fam. how you spin this fast Posted 5 months ago 5 months
on Impossilble marshmallow
much enjoyed Posted 5 months ago 5 months
on Au Revoir Bébé Au Revoir
gorgeous work Posted 5 months ago 5 months
on Au Revoir Bébé Au Revoir
find me an empty lounge. i'm there Posted 5 months ago 5 months
on Babylon the Great has Fallen
industry has ruined us Posted 5 months ago 5 months on "Pointless Orbits": Mix from Earsheltering release at earsheltering.free.fr/earsheltering085.htm you're passing out alternate headspaces left and righ Posted 5 months ago 5 months
on "Pointless Orbits": Mix from Earsheltering release at earsheltering.free.fr/earsheltering085.htm
beyond unique Posted 5 months ago 5 months
on Frankenstein's Psychedelic Jam Has Risen from the Grave
okay i'm getting kind of scared Posted 5 months ago 5 months
on Frankenstein's Psychedelic Jam Has Risen from the Grave
the throat singing <3 Posted 5 months ago 5 months
on Days (ft. Samuel) prod. by solo beats
windy Posted 5 months ago 5 months
on Tuxedo Black ft. A.Mo x Samuel - Hyphy Remix 2017 [BayAreaCompass] @TXEDOBLACK this that tiptoe bounce round the corners of the room gang shit Posted 5 months ago 5 months on World Calling (Feat. Samuel) [Future - Perkys Calling Remix] (Prod. by Southside)
all these effects got me trippin like i ain't tied my shoes in years Posted 5 months ago 5 months
on Hollow By Samuel [Prod. Vini G.]
bruh these drums are about to combust Posted 5 months ago 5 months
on Logic - The Jam Freestyle
spit spit spit fast Posted 5 months ago 5 months
on J. Cole - Everybody Dies (Remix)
them chords are flllyyyy Posted 5 months ago 5 months
on Migos - Bad And Boujee (Remix)
cookin' up dope in the crock pot! Posted 5 months ago 5 months
on a Dream of in Cloud
only ever step forward Posted 5 months ago 5 months on Kangarojack feels like the kick hittin the ground so hard the drums gotta hop lol seriously dope Posted 5 months ago 5 months
on Soul Field
i thoroughly enjoyed this piece Posted 5 months ago 5 months
on Orange Juice
yeah buddy squeeze that synth Posted 5 months ago 5 months
on Dormir Sur Mon Grind ft. Ph Vendou [Prod. ROUSSEAU]
slam bam thank you ma'am Posted 5 months ago 5 months
on C Pas De T Affaires ROUMIX
fam* Posted 5 months ago 5 months
on C Pas De T Affaires ROUMIX
keep it up am Posted 5 months ago 5 months on C Pas De T Affaires ROUMIX
scary Posted 5 months ago 5 months
on Ϣΰϐτϲ cool idea! i haven't really heard anything like this. i appreciate fresh Posted 5 months ago 5 months
on Wat U Mean Remix Ft. Lil Yachty
bumpin Posted 5 months ago 5 months
on I.D.H.T (idonthavetime) (feat. Rheehab)
stay ez Posted 5 months ago 5 months
on Mask (feat. Rollyboi)
paired nicely Posted 5 months ago 5 months on P HEIR & DamienTheArchitect - Cloud 9 ( Prod. C Y G N )
respect. well made Posted 5 months ago 5 months on Childish Gambino - Redbone (Modified)
dadfam!!! Posted 5 months ago 5 months
on evenin sea
@oylo: hope you had* Posted 5 months ago 5 months
on evenin sea
have a good birth anniversary day Posted 5 months ago 5 months
on hz
load me up on them keys dog Posted 5 months ago 5 months
on Mo Vibez - Drank (feat. Namuuna)
yoooooooooo real Posted 5 months ago 5 months
on Mo Vibez - Drank (feat. Namuuna)
lightly tapping us Posted 5 months ago 5 months on POLO - bunny
polo Posted 5 months ago 5 months
on POLO - bunny
marco Posted 5 months ago 5 months
on Can You Stay The Night..
i'd love to take a look at your petri dish Posted 5 months ago 5 months
on Can You Stay The Night..
wh? ?s sh?m? Posted 5 months ago 5 months
on Begin Again (prod. Shahly) these chords carry tons of energy. some of it seeps out every couple divisions Posted 5 months ago 5 months
on Sunrise (D.J.P)
harmonies are sick too Posted 5 months ago 5 months on Sunrise (D.J.P)
cool flow dude Posted 5 months ago 5 months
on hold on
stabs in my heart Posted 5 months ago 5 months
on hold on
dang boy Posted 5 months ago 5 months
on POWER
da eerie note <3 Posted 5 months ago 5 months
on POWER
bang samples Posted 5 months ago 5 months
on POWER
lord have mercy. solidified drums Posted 5 months ago 5 months on DRUM KIT VOL. 2 (Link In Description) dunkin Posted 5 months ago 5 months
on india arie bro these synths stay encompassing. and those swangin ass claps are pulverizing me Posted 5 months ago 5 months
on Playhouse x Lukas x Cresce - Playgurl (prod. BVLLVH)
trill lane Posted 5 months ago 5 months
on Playhouse x Lukas x Cresce - Playgurl (prod. BVLLVH)
notice Posted 5 months ago 5 months
on Fireflies (ft. KB, @lackhoney, Noah Luna, Lucy Davies-Kumadiro, Curt., Matt Zhang)
mad lax Posted 5 months ago 5 months
on drip
awesome comp dude. really interactive Posted 5 months ago 5 months on Big Wild - Empty Room (feat. Yuna)
the tuneeeeeé Posted 5 months ago 5 months
on Big Wild - Empty Room (feat. Yuna)
gud 2 here frum ya Posted 5 months ago 5 months
on Big Wild - Empty Room (feat. Yuna)
hey mami Posted 5 months ago 5 months
on chill
aptly labeled Posted 5 months ago 5 months on Koni ft. Danelle Sandoval - Mad About You
mangoes falling from the trees Posted 5 months ago 5 months
on ice cream
boggled Posted 5 months ago 5 months
on ice cream why anybody else even trying Posted 5 months ago 5 months on Green Day - Boulevard of Broken Dreams (Lukas Cover) Prod. Cresce & Hauntxr
dope cover Posted 5 months ago 5 months
on ye. - canunot (JADŪ034)
livid squealin Posted 5 months ago 5 months
on kudo & twuan - flip mode squad
warm Posted 5 months ago 5 months
on kudo & twuan - flip mode squad
spectacle vibes Posted 5 months ago 5 months
on Blair - Planetary (feat. argonaut&wasp) [Ardency Remix]
we're spacewalking Posted 5 months ago 5 months
on Findhorn Burst awesome drums. lots of swing in every hit Posted 5 months ago 5 months
on infinity
bro this spread is wavy Posted 5 months ago 5 months
on Khary & Lege Kale - Stronger
that fillll tho Posted 5 months ago 5 months
on faucets w/ healy
tighter than a nordic 18 yo Posted 5 months ago 5 months
on Rage
nice. really elegant, classy Posted 5 months ago 5 months
on Rage yo this that new gylzey i heard about earlier on twitter????? Posted 5 months ago 5 months
on FOOTSTEPS wreccn me Posted 5 months ago 5 months
on dead and beat
@kenny_dyer: hahah <3 just saw this Posted 5 months ago 5 months
on worn out
@lee-lucas: appreciate the kind words!! thank you! Posted 5 months ago 5 months
on SiR "The Real"
thisshowasafreshselectmyfriend Posted 5 months ago 5 months
on F l o a t Z o n e ("Hyper" album out NOW)
wicked Posted 5 months ago 5 months
on 2Proud2
nicely performed Posted 5 months ago 5 months
on Benta - Radio (Gill Chang Remix)
pumplightning Posted 5 months ago 5 months
on baby boy
montba boyker Posted 5 months ago 5 months
on Boxcutter
yooooo Posted 5 months ago 5 months
on slanga
wave Posted 5 months ago 5 months
on shh051: Howie Lee - Bankers
hold me Posted 5 months ago 5 months on Ony x HH x Downtime - Now I Know
well made Posted 5 months ago 5 months
on Pick Up
tight pull Posted 5 months ago 5 months
on PP
handled Posted 5 months ago 5 months
on Do U
^ Posted 5 months ago 5 months
on _whereismydocumentsboutlove앨범누락featollihomeboy
spooky vox. well met Posted 5 months ago 5 months
on _whereismydocumentsboutlove앨범누락featollihomeboy the snare been talkin' at me this whole time. why is it so vocal dude Posted 5 months ago 5 months
on Light (Anh Redo)
bam! @yunganh comin' in with the light Posted 5 months ago 5 months
on Groovy (Prod. Steelix & Riclaflare)
gratatatat Posted 5 months ago 5 months
on ukulele and chill incredible penetrating good vibes Posted 5 months ago 5 months
on Forget
cool vox oo Posted 5 months ago 5 months
on Ex Machina
for greenbeans Posted 5 months ago 5 months
on Ex Machina
we all scream Posted 5 months ago 5 months
on Ex Machina
you scream Posted 5 months ago 5 months
on Ex Machina
i scream Posted 5 months ago 5 months on bird
monstrous Posted 5 months ago 5 months on TRAPjavi - MUSCLE ft. EDDIE VEGA, KRIS LESHAUN & CLOUD2800 (prod. TRAPjavi)
me too Posted 5 months ago 5 months
on Blind (Prod. Skater)
very catchy Posted 5 months ago 5 months
on Blind (Prod. Skater)
damn skater.. props Posted 5 months ago 5 months
on Something different
enveloping Posted 5 months ago 5 months
on Something different
very cool piece Posted 5 months ago 5 months on H W N D U
dang Posted 5 months ago 5 months
on Small Steps
this is earth Posted 5 months ago 5 months
on Small Steps
get that ufo outta here Posted 5 months ago 5 months
on bad and boujee
time to rolll up Posted 5 months ago 5 months on Cap & Bagpack (Remix Suit & Tie)
cool take Posted 5 months ago 5 months
on Light (Anh Redo)
@oylo: in any case, great ear Posted 5 months ago 5 months on Light (Anh Redo)
@cerspence: might not be?... could possibly just be same bpm and and unfortunately (by chance) same chord sequence... not saying it is or isn't a rip, just saying that this has happened to me before Posted 5 months ago 5 months
on Lit In Here (Prod. GHXST)
hell yea Posted 5 months ago 5 months
on hola
cutie patootie vibes Posted 5 months ago 5 months
on State Of Mind W/ Ezkiel
0 \/ 3 /\/ Posted 5 months ago 5 months
on i know you're probably not home (morgue remix)(NOW ON SPOTIFY)
no actually i am at home Posted 5 months ago 5 months
on Now hell yeah this man knows a good mix Posted 5 months ago 5 months
on MY SLIME
rope gang Posted 5 months ago 5 months
on BAD MOOD
those roars tho... damn' Posted 5 months ago 5 months
on REAPERS DIE TOO
this is fucking way evil Posted 5 months ago 5 months
on REAPERS DIE TOO little salad are you the boy in the picture Posted 5 months ago 5 months
on GENERATION Y [Prod by Taysty]
fuckn nasty Posted 5 months ago 5 months
on osho [.ep]
sparkling clean my boy Posted 5 months ago 5 months
on osho [.ep]
mid ocean rift bacteria life near the hot vents' rim Posted 5 months ago 5 months
on Ulterior
garaj Posted 5 months ago 5 months
on halpe - jade tearz (awkward island redo)
you gon rupture my sub dog Posted 5 months ago 5 months
on Wasted Lands
insightful Posted 5 months ago 5 months
on No More No Less ft. Emily Makis anyone else ever been on that giant ship pendulum ride at king's island?? shit's bomb Posted 5 months ago 5 months
on deadhead
thank you Posted 5 months ago 5 months
on deadhead
okay you got me Posted 5 months ago 5 months
on oh my
awesome job arctkt Posted 5 months ago 5 months
on oh my
mollywhopp gang Posted 5 months ago 5 months on Tsuruda, Chrome Republic & Untitld - racksONracks
how you get your bass so wide Posted 5 months ago 5 months
on Blocked/Unblocked
solid Posted 5 months ago 5 months
on games.
elegant Posted 5 months ago 5 months
on quisa turn off the tv tony. it's time for bed Posted 5 months ago 5 months
on Adore U
tiiiight Posted 5 months ago 5 months
on EGZOD - Fly (ft. Caiti Patton)
heavy Posted 5 months ago 5 months
on EGZOD - Fly (ft. Caiti Patton)
charged Posted 5 months ago 5 months
on Chao Adventures
shifted into 14th gear Posted 5 months ago 5 months
on Zombie (Prod. by OB)
mad evil Posted 5 months ago 5 months on Zombie (Prod. by OB)
dank Posted 5 months ago 5 months on Medasin & X&G - The Zoo (Tycoon 2: umru Expansion Pack)
@officialloki: that's mw1 Posted 5 months ago 5 months
on Soundpatrol & VDG - Petrichor
dang boys Posted 5 months ago 5 months
on Sebastien feat. Bright Sparks - Gold (Steen Remix)
i can smell the ocean breeze fam Posted 5 months ago 5 months
on daddy
damn i wish i was a rapper. i am spittin gold rn Posted 5 months ago 5 months
on Columbus
i can see columbus from my house Posted 5 months ago 5 months on Negai
vocal melody just absolutely superb Posted 5 months ago 5 months
on Negai
straight up jam Posted 5 months ago 5 months
on Negai
awesome!!!!! Posted 5 months ago 5 months
on Sia - The Greatest (KALM Remix) this that song that plays during an inspirational and physically active montage Posted 5 months ago 5 months
on Sensei
dog Posted 5 months ago 5 months
on andromeda
keep it going!! Posted 5 months ago 5 months on Medasin & X&G - The Zoo (Tycoon 2: umru Expansion Pack) what's the map on the mw2 expansion pack in the forest? Posted 5 months ago 5 months
on Lost Emerald (12-inch Mix) ["Collected, Vol. 1" OUT NOW]
bruh this synth on some wooonkk shit Posted 5 months ago 5 months
on Makzo - Table Tennis
mad hop Posted 5 months ago 5 months
on Makzo - Table Tennis
i thoroughly enjoyed the way you filled this room Posted 5 months ago 5 months
on Highlight
8 0 8 0 8 0 8 0 8 Posted 5 months ago 5 months
on did you just wake up
chop on da block Posted 5 months ago 5 months on heart placement w/ nav
caring Posted 5 months ago 5 months
on YAYO
explosive. tons of energy packed in Posted 5 months ago 5 months
on BACKSEAT FREESTYLE (JUDGE REMIX) duuuuude this beat is so damn grimy Posted 5 months ago 5 months
on ꊲꋏꋔꋇꋒ
i can't even Posted 5 months ago 5 months
on H A Z E W/ Hydrecta
ain't nobody stormin' this castle Posted 5 months ago 5 months
on Snake Charmer (w/ Yogi Split)
well done guys. real dope flow Posted 5 months ago 5 months
on does it have to be @lee-lucas: thank you!! Posted 5 months ago 5 months on Lido - Only One (adeoson flip) good god man the keeeeeeys Posted 5 months ago 5 months
on embrace
utter destruction Posted 5 months ago 5 months
on distance w/ otxhello
charming Posted 5 months ago 5 months
on VELO-CITY 127
@zimbolt: nuttin' on em' Posted 5 months ago 5 months
on Knowhow
stab me fam! Posted 5 months ago 5 months
on Cold Blooded ft. XIX wicked Posted 5 months ago 5 months on Cold Blooded ft. XIX
fancy sus walk Posted 5 months ago 5 months on Cold Blooded ft. XIX
tiiiight Posted 5 months ago 5 months
on VELO-CITY 127
spazzing Posted 5 months ago 5 months
on self-conscious
great swing Posted 5 months ago 5 months
on Sprung
damn herzy Posted 5 months ago 5 months
on comfort
hot to Posted 5 months ago 5 months
on comfort
malé Posted 5 months ago 5 months
on comfort
my body bymps Posted 5 months ago 5 months on San Holo - Light (Tonton Remix)
nice Posted 5 months ago 5 months on San Holo - Light (Tonton Remix)
roll along Posted 5 months ago 5 months on Kíruma - How Did We Get Here
got me clear headed Posted 5 months ago 5 months
on TWYN - James
good god Posted 5 months ago 5 months
on TWYN - James
that bassline is too damn livid Posted 5 months ago 5 months
on TWYN - James
supreme chop game Posted 5 months ago 5 months
on savage, ruthless
cozy Posted 5 months ago 5 months
on Beat Slayer
lord have mercy on my soul Posted 5 months ago 5 months
on new sun man i'm covered in your pixie dust quit it Posted 5 months ago 5 months
on numb.
brothea Posted 5 months ago 5 months on i don't wanna do this anymore
ew jordan!! Posted 5 months ago 5 months
on <3 Sosa
nasty Posted 5 months ago 5 months
on no coincidence
the spread is super dope Posted 5 months ago 5 months
on The Guest (w/THÉOS & Inas) when you gotta skrr but your brake got icicles on em Posted 5 months ago 5 months
on Squeeze
this is amazing Posted 5 months ago 5 months
on Squeeze
$ $ $ Posted 5 months ago 5 months on WIZE'S FINAL SOUND KIT | track: the gamble (demo)
have a swampy christmas Posted 5 months ago 5 months
on Touch Of You
money Posted 5 months ago 5 months
on Migos - T-Shirt (Y2K & AVIDD Remix)
nicely done Posted 5 months ago 5 months
on Migos - T-Shirt (Y2K & AVIDD Remix)
2015 called... salt pouring out the phone Posted 5 months ago 5 months
on Migos - T-Shirt (Y2K & AVIDD Remix)
these them turd shittin' horns Posted 5 months ago 5 months
on get dis $$.
@skug-1: same Posted 5 months ago 5 months on Wayside (m/v in description)
cool mix Posted 5 months ago 5 months
on show me w/ kolada
@jubekyth: <3<3<3<3 Posted 5 months ago 5 months
on I Am King (Cypher Remix)
@visualpoeticsmusic: appreciate the kind words bro! Posted 5 months ago 5 months
on porch sits & night shifts
@579: words of wisdom Posted 5 months ago 5 months
on Cosmo's Midnight - History (Bohkeh Remix)
bohkehh Posted 5 months ago 5 months
on wavy lebron space jam for the culture
thugod Posted 5 months ago 5 months
on eat u alive wonderful job fl! Posted 5 months ago 5 months
on How Could I Know? Feat. Lil West (Prod. Dylan Brady)
how do autotune Posted 5 months ago 5 months
on just be friends remix (buy = free dl)
anime me Posted 5 months ago 5 months
on good mourning
wow Posted 5 months ago 5 months
on FLOOD
boy u nasty Posted 5 months ago 5 months
on FLOOD
jesus christ Posted 5 months ago 5 months on king henry - don't stay away ft naations (alpha method remix) good work man Posted 5 months ago 5 months
on king henry - don't stay away ft naations (alpha method remix) honk them rude ass fucking horns at me one mo god damn time Posted 5 months ago 5 months
on king henry - don't stay away ft naations (alpha method remix)
king henry is bae Posted 5 months ago 5 months
on Lvl9999
did you divide by zero Posted 5 months ago 5 months
on Lvl9999
error. does not compute Posted 5 months ago 5 months
on Oceans Ft. Joe Sofia
good lord. incredible Posted 5 months ago 5 months
on Travelz w/ Noize u got me Posted 5 months ago 5 months on Sofasound X broski - Come Home To Me Darling - FREE DOWNLOAD
dude Posted 5 months ago 5 months on Sofasound X broski - Come Home To Me Darling - FREE DOWNLOAD
oh my fucking god Posted 5 months ago 5 months
on Sofasound x broski - Say ( Free Download )
yuhhh fam Posted 5 months ago 5 months
on Sofasound x broski - Say ( Free Download )
i'm twerking. you happy? Posted 5 months ago 5 months
on Sofasound x broski - Say ( Free Download )
sass ass clap boy Posted 5 months ago 5 months
on bEGOne keep up the beats pete Posted 5 months ago 5 months
on bEGOne
f l a n g t h a t s h i t o u t o f e x i s t e n c e Posted 5 months ago 5 months
on Olmos - I'm Sorry (Ft. Yumi) (metsä Remix)
@madebymetsa: doing alright. don't have as much time to produce as i used to, but i've got a couple things planned for the year Posted 5 months ago 5 months
on high on you. X Chloe Gendrow - Follow the Leader
chloe fits so well Posted 5 months ago 5 months
on high on you. X Chloe Gendrow - Follow the Leader
sick!!! Posted 5 months ago 5 months
on porch sits & night shifts
on the search for the new Posted 5 months ago 5 months on Thoughts (feat. Sara Diamond) [prod. Lyric Walls & Jamvvis]
@thisiscreepa: ikr Posted 5 months ago 5 months
on Thoughts (feat. Sara Diamond) [prod. Lyric Walls & Jamvvis]
@user-857661671: click this link guys it's super legit Posted 5 months ago 5 months
on San Holo - Light (Deon Custom Remix)
got them custom deons Posted 5 months ago 5 months
on San Holo - Light (Deon Custom Remix)
lightning mcqueen ass shit Posted 5 months ago 5 months on Allen Thomas - WIF (A Joint For Decatur) [prod. @juugbeets]
cool tune. flow is dope too Posted 5 months ago 5 months on Allen Thomas - WIF (A Joint For Decatur) [prod. @juugbeets]
breathe a little wider Posted 5 months ago 5 months
on VGM SAMPLER 2015-2016 da maxo platter Posted 5 months ago 5 months
on vacation
sick Posted 5 months ago 5 months
on vacation
that teeth chattering knees shaking sample tho Posted 5 months ago 5 months
on IAMNOBODI & Insightful - Wassup
gung gun gun gungn ug Posted 5 months ago 5 months
on IAMNOBODI & Insightful - Wassup
this good exercise Posted 5 months ago 5 months
on IAMNOBODI & Insightful - Wassup unf... that opening hooked me like a damn catfish Posted 5 months ago 5 months
on Panda Remix madonna is bad tho its true Posted 5 months ago 5 months
on Panda Remix
@miles-thomas-4: slidewipe Posted 5 months ago 5 months
on Bone Marrow (Azide x MorrisCode Remix)
@jsin99: ok Posted 5 months ago 5 months
on SLUMP w/METHONE
good fucking lord Posted 5 months ago 5 months
on SLUMP w/METHONE
did i die Posted 5 months ago 5 months
on Olmos - I'm Sorry (Ft. Yumi) (metsä Remix)
@madebymetsa: how you been yung metsä Posted 5 months ago 5 months
on GUCCI GHOST (PROD BY. RONNYJLI$TENUP) the quick glide on them melody keys whippin my feelings like a wooden rollercoaster Posted 5 months ago 5 months
on GUCCI GHOST (PROD BY. RONNYJLI$TENUP)
ronny you are crazy Posted 5 months ago 5 months on BAD AND BOUJEE BUT ITS JUST OFFSET SAYING "WOO WOO WOO WOO WOO"
better than original Posted 5 months ago 5 months
on Flume - Wall Fuck (CRNKN Edit)
bustin' nuts all over my keyboard rn Posted 5 months ago 5 months
on Cavaro ft. Faheem - Lost In You (Heuse remix)
toss that break up in the air like a stack of bologna Posted 5 months ago 5 months
on Olmos - I'm Sorry (Ft. Yumi) (metsä Remix)
@madebymetsa: bro it's so rare that i leave an intentionally negative comment. maybe given out like 4 in history Posted 5 months ago 5 months
on jaguar pyramids - goose (prod 16yrold & tony seltzer) yahhh Posted 5 months ago 5 months
on JAVASCRIPT - Hottt (Yung Death Ray Remix)
@itsleemz: p o w p o w p o w Posted 5 months ago 5 months
on Halpe & horror.vacui - Espacio y Tiempo
raw Posted 5 months ago 5 months
on Halpe & horror.vacui - Espacio y Tiempo
i don't think i've heard this Posted 5 months ago 5 months
on Lately
finish me Posted 5 months ago 5 months
on Lately
i'm gonna tell your mother that you're making noises like this. she's gonna make you wash your damn mouth out with soap Posted 5 months ago 5 months on Alltta - The Woods (Sumerz Remix)/BUY=FREE WAV/
very intriguing Posted 5 months ago 5 months
on Alltta - The Woods (Sumerz Remix)/BUY=FREE WAV/
neat Posted 5 months ago 5 months
on Blake Skowron - Distracted
what's going on now Posted 5 months ago 5 months
on Blake Skowron - Distracted
trip e Posted 5 months ago 5 months
on San Holo - Light (Eastghost Remix)
eastghost is literally cooler than any of us can ever be Posted 5 months ago 5 months
on Ne·ver Break Feat. Alyss those synths burping at me from the other rooms are goals Posted 5 months ago 5 months
on The Storm feat. Deffie & Romderful stop drop and roll Posted 5 months ago 5 months
on The Storm feat. Deffie & Romderful
nice one guys! cohesive Posted 5 months ago 5 months
on POSTPRO
you def live that's for sure Posted 5 months ago 5 months
on feel so down for
p u m p Posted 5 months ago 5 months
on feel so down for
excellent chopping brethren Posted 5 months ago 5 months on Fukuro (Feat. Jåmvvis) [Finesse Freestyle]
rope gang Posted 5 months ago 5 months
on Intro. [instrumental] i need to step my game up Posted 5 months ago 5 months
on Intro. [instrumental]
wuvy folla Posted 5 months ago 5 months
on turmoil
rimshot cookies Posted 5 months ago 5 months
on tool-e-yo (exshtendo)
brooo this is super sick Posted 5 months ago 5 months
on i can't dance
that arp got me like x Posted 5 months ago 5 months
on i can't dance cool! raunch effect but light and happy go moving at the same time Posted 5 months ago 5 months
on nafy - wallflower what the holy Posted 5 months ago 5 months
on Olmos - I'm Sorry (Ft. Yumi) (metsä Remix)
tiptoe tiptoe. can't wake the cycli Posted 5 months ago 5 months
on Routine [Prod. Rayman On The Beat x WEI]
laz bounc Posted 5 months ago 5 months
on Routine [Prod. Rayman On The Beat x WEI]
that whop back there tight Posted 5 months ago 5 months
on Flamingosis - A Luv Song
flamin'. goes. Posted 5 months ago 5 months
on Savoy - Living Color (feat. Fatherdude) why am i outside it's so damn cold out here Posted 5 months ago 5 months
on Savoy - Living Color (feat. Fatherdude)
savoy this is magical Posted 5 months ago 5 months
on am. man my connect iffy af idk if my comments even going thru Posted 5 months ago 5 months
on am.
let me sing on this Posted 5 months ago 5 months
on memory
yus Posted 5 months ago 5 months
on memory
the power took that quick build.... omg nice Posted 5 months ago 5 months
on memory
zottster this some next level arrangement Posted 5 months ago 5 months
on booling
will be downloading this for sure Posted 5 months ago 5 months
on booling
i'm trying so hard to get some fresh shit like this. well done homie. the panning glassy hits are mad Posted 5 months ago 5 months
on booling every time i try to comment it says my newtwork connection seems to be disabled Posted 5 months ago 5 months
on show me w/ kolada
@blue-attitude: thank you dave! that's great to hear Posted 5 months ago 5 months
on William Crooks - Sleep (umru remix)
@oylo: feel me Posted 5 months ago 5 months
on William Crooks - Sleep (umru remix)
@oylo: ...in, my g... Posted 5 months ago 5 months
on William Crooks - Sleep (umru remix)
@umru: sure has. you are slaughterin my guy. keep it up! Posted 5 months ago 5 months
on show me w/ kolada
@mike-spring: thanks!! Posted 5 months ago 5 months
on show me w/ kolada
@miss_prizz: we got them wiccan genes nahmsayin Posted 5 months ago 5 months
on show me w/ kolada
@boon-suzuki: thank you greatly! Posted 5 months ago 5 months
on show me w/ kolada
@kenny_dyer: appreciate that kenny! Posted 5 months ago 5 months
on show me w/ kolada
@christoffersen-weber: aw damn bro <3 Posted 5 months ago 5 months
on perfect child (demo)
this inspired me Posted 5 months ago 5 months
on perfect child (demo)
dude this my jointtt Posted 5 months ago 5 months
on Love Of Mine
got me dizzy Posted 5 months ago 5 months
on Beamon - Baby Blue (produced by Mana)
squad Posted 5 months ago 5 months on Electric greWVeeland (Spinner Production)
message received Posted 5 months ago 5 months on Electric greWVeeland (Spinner Production)
psychy Posted 5 months ago 5 months
on Trust
thoroughly enjoyed this one homie Posted 5 months ago 5 months on TIMELESSNESS - Bellwoods (2016)
smooth Posted 5 months ago 5 months
on No One Else's - Repeat Pattern (beat) X Ta-ku (vox)
very unique sound. well appreciated Posted 5 months ago 5 months
on asset.trip
420 Posted 5 months ago 5 months
on gurl... (thank you for 4k)
sick Posted 5 months ago 5 months
on gurl... (thank you for 4k)
yo this is maaaad Posted 5 months ago 5 months
on Honey oh my god that glistening city oozing hustle and bustle in the background got me like Posted 5 months ago 5 months on Mamacita
bruh that kick is so thick Posted 5 months ago 5 months
on Mamacita
thug shit Posted 5 months ago 5 months on William Crooks - Sleep (umru remix)
@umru: hey bud how ya been Posted 5 months ago 5 months
on pictochat
awesome vocal fx Posted 5 months ago 5 months
on (You)niverse.
mystical Posted 5 months ago 5 months
on i'm thinking about a lot of things
oh, olli Posted 5 months ago 5 months on Soul II Soul - Back To Life (Zikomo Remix)
$ $ $ Posted 5 months ago 5 months on Brian Puspos - Murder She Wrote (MYRNE Remix)
awesome transition. took it all out really well Posted 5 months ago 5 months
on MATRIX
tight Posted 5 months ago 5 months
on MATRIX
them snares pupeteering Posted 5 months ago 5 months
on Chances w/ dxwntxwn
filthy Posted 5 months ago 5 months
on Chances w/ dxwntxwn
absolute destruction Posted 5 months ago 5 months on Chances w/ dxwntxwn magnificent. i award you with the most evil thing so far this week award Posted 5 months ago 5 months
on two time
superfluids on tha rise Posted 5 months ago 5 months
on two time
ayeeee Posted 5 months ago 5 months
on street lo-fighter
yuh boi!!! dope Posted 5 months ago 5 months
on street lo-fighter
take me away all day please bae Posted 5 months ago 5 months
on with u
late night horror tunnel bump Posted 5 months ago 5 months on The Chainsmokers - Paris [ Ben Maxwell & SCRVP Remix ]
okay i'm gonna be real chainsmokers and all associated remixes always sound exactly the same. well produced, not creative tbh Posted 5 months ago 5 months
on William Crooks - Sleep (umru remix)
raw nasty punk raunch fun you got Posted 5 months ago 5 months
on William Crooks - Sleep (umru remix)
aye bro i heard fam left some money in the top of his dresser Posted 5 months ago 5 months
on William Crooks - Sleep (umru remix)
nigga i been dead for years Posted 5 months ago 5 months
on fly away
clunka don't want jinjo goulash for dinner today Posted 5 months ago 5 months
on grapes
fruitful. got all the bounty i need up in hea Posted 5 months ago 5 months
on liefor w/ LDMA
i need to wash my ears Posted 5 months ago 5 months
on liefor w/ LDMA
nuts Posted 5 months ago 5 months
on Glorius (Lullaby)
sick drums palette Posted 5 months ago 5 months
on Glorius (Lullaby)
i'm enjoying Posted 5 months ago 5 months on Lou Phelps - Average feat. KALLITECHNIS [Prod. By KAYTRANADA]
fresh track Posted 5 months ago 5 months on Lou Phelps - Average feat. KALLITECHNIS [Prod. By KAYTRANADA]
wow this is tight Posted 5 months ago 5 months on Da-P & Mars Today - No More
deep Posted 5 months ago 5 months
on JAVASCRIPT - Hottt (Vices Remix)
potato hotter than mug of hotchoc str8 out the mic Posted 5 months ago 5 months
on where ya goin?
yus Posted 5 months ago 5 months
on where ya goin?
jers all of mey Posted 5 months ago 5 months on Great White - Scott Nelson / guitar, Mirko "Stringburner" Borach / bass and Jamie Rhind / keyboards
awesome work guys Posted 5 months ago 5 months
on Deep Down In Me /featuring Chris Spruit
wonderful track. guitar constantly slaying Posted 5 months ago 5 months on Counting Hours /featuring Chris Spruit
loving you style dave Posted 5 months ago 5 months
on What Could I Do? /featuring Chris Spruit fucking straight power. this would destroy live Posted 5 months ago 5 months
on Lift Me Up /featuring Chris Spruit
dang boyyy Posted 5 months ago 5 months
on Lift Me Up /featuring Chris Spruit
nice harmonies! Posted 5 months ago 5 months
on Kaleidoscope
cool switchin nice Posted 5 months ago 5 months
on Output For Release - Feat. Miranda Foxx
awesome job Posted 5 months ago 5 months on Output For Release - Feat. Miranda Foxx
butter Posted 5 months ago 5 months
on When Love Was Young - feat. FLoHBoLD easy to track the groove. soaring through the sky on a dragon type tune Posted 5 months ago 5 months
on An Almost Forgotten Song - Mark J.Bennett & Me
flamin Posted 5 months ago 5 months
on An Almost Forgotten Song - Mark J.Bennett & Me
fresh feel. centered Posted 5 months ago 5 months
on Curl And Die (original) (Guitar folk / easy listening)
tasty Posted 5 months ago 5 months
on Tainted Heart feat. Jimena(EDM)
awesome work Posted 5 months ago 5 months on Tainted Heart feat. Jimena(EDM)
advanceeee Posted 5 months ago 5 months on PM DAWN - I'd Die Without You (ACOUSTIC Guitar & Vocals)
nice touch louie Posted 5 months ago 5 months
on Old Friends - drunkeninstrumentcorp. 'n Cw
@cw-reposts: you and me both...x Posted 5 months ago 5 months
on Streets of Barcelona [Music Video]
relaxing set Posted 5 months ago 5 months
on Rhythm of Moon Rising
mad groove omcb Posted 5 months ago 5 months
on Winter Melancholy [Music Video]
extremely satisfying Posted 5 months ago 5 months on Lovers (Moonbeat Remix) [feat. Brave]
this one's a good'n Posted 5 months ago 5 months
on My Account Has Been Hacked
wahve Posted 5 months ago 5 months
on food.
train comes a clickinting down the trickitacks Posted 5 months ago 5 months
on Bring Them Out
awesome story ur tellin famo Posted 5 months ago 5 months
on Can't See Me (Prod. Ivan Jackson)
stunnin left and right Posted 5 months ago 5 months
on simon eng - yes
what a beaut u got here buddy Posted 5 months ago 5 months on Valleyz, Tessellated & Amindi K. Fro$t ~ Pine & Ginger island gangg Posted 5 months ago 5 months
on Drop ~ Born In The Slums ~ Prod By Lil t
get hard Posted 5 months ago 5 months
on Bad Bitch
swummin with tha dolphos Posted 5 months ago 5 months
on Oracular
crush it Posted 5 months ago 5 months
on Oracular
magic mystery for all to see Posted 5 months ago 5 months
on Coubo - Sunset i'm pretty sure you've never missed @coubo honestly, i have loved everything i have ever heard from you Posted 5 months ago 5 months
on Milky (Bomberman Remix) - Marcus D SNIPPET milkay i'd say Posted 5 months ago 5 months
on Hallelujah
machining them kicks like thye bullets Posted 5 months ago 5 months
on QB9 - Hey Baby
yuhh Posted 5 months ago 5 months
on QB9 - Hey Baby
chqse tha sex drive Posted 5 months ago 5 months
on Lake awesome tune janee. super relaxing. fulfilling Posted 5 months ago 5 months
on Don't †rip
tight Posted 5 months ago 5 months
on SALT (w/ wax god) saltier than canadian roadways Posted 5 months ago 5 months
on SALT (w/ wax god)
^ Posted 5 months ago 5 months on how that go .. w/ lukas (out on spotify now)
deep drippin Posted 5 months ago 5 months
on Act Like That (This Time)
buji paving the damn way Posted 5 months ago 5 months
on Act Like That (This Time)
i can ride this all day Posted 5 months ago 5 months
on Free Fall
i have always wanted to go skydivin Posted 5 months ago 5 months
on Sonia Calico - Fish Dish [PREMIERE]
fishy dishayyyy Posted 5 months ago 5 months
on WaWa
i'm on the vibe train Posted 5 months ago 5 months
on Palastic - Side Note (Ark Patrol Remix)
ark patrol inhuman? plausible Posted 5 months ago 5 months
on stop/play (ft. ghost boy sora)
y e s ! ! ! ! !! ! !1 1!1 1! !!!!!! Posted 5 months ago 5 months
on Lovers (AIRWAV Remix) [feat. Brave]
heir waveeeeeeeeee Posted 5 months ago 5 months on The Kount & Memorecks - Far and Near
beauty Posted 5 months ago 5 months on The Kount & Memorecks - Far and Near omg squeeze them synths to d e a t h Posted 5 months ago 5 months on The Kount & Memorecks - Far and Near
brehhhhh Posted 5 months ago 5 months
on Mo Vibez & Siki - Samba Ye
winnaaa Posted 5 months ago 5 months
on 1052PM
intense Posted 5 months ago 5 months
on 1052PM
why you so mad thoo?? cchilll Posted 5 months ago 5 months on Crayon x Gracy Hopkins - Ocean 7 Pt. 2
these strummin ass chords thooo Posted 5 months ago 5 months
on XYLØ - Get Closer (SHADES Remix)
lividd Posted 5 months ago 5 months on get yourself together
sick groove btw Posted 5 months ago 5 months
on get yourself together hahahahhh!! oh my god! on bar 5 of the drop i sung out loud a very similar oooohhohoh to the vocal the followed shortly after. hahah funny coincidence. must mean you chose a great sample <3 Posted 5 months ago 5 months
on Euro Dinero - Gold (Fluke Nukes & Leemz Remix)
ballin' like an athlete ain't even got no jumper Posted 5 months ago 5 months
on Jeepie
sick Posted 5 months ago 5 months
on Jeepie
fluid Posted 5 months ago 5 months
on I Don't Wanna Die hell yeah. good stuff Posted 5 months ago 5 months
on searching
how how come i'm not following you Posted 5 months ago 5 months
on The John Hill Interview
really glad you had john on. great episode! Posted 5 months ago 5 months
on show me w/ kolada
@the-glen-granthem-band: thanks glen!! just a one man show on the production! Posted 5 months ago 5 months
on Adieu Paris (starring Dédé Djeune)
enchanting love story feelings Posted 5 months ago 5 months
on Tastebreakers - City Country Grammar (Feat. XIX and JAMO!)
thanks for putting me on to this @steeziakbeats Posted 5 months ago 5 months
on DJ Smokey - Do Tha Damn Thing tight Posted 5 months ago 5 months
on Melt
what is happening to me Posted 5 months ago 5 months on Appeal & Kris Rod - Masuka (BUY = FREEDOWNLOAD)
ever heard of satan? bc this what he sound like Posted 5 months ago 5 months on What So Not & Ganz - Lone Ft JOY.(Slow Hours Remix)
taught Posted 5 months ago 5 months
on music sounds better (wntr remix)
turn the fuck up Posted 5 months ago 5 months
on need u
poundin' Posted 5 months ago 5 months
on JUSSRITE (feat. SACHI & Naji)
just riteeee Posted 5 months ago 5 months
on rain dance you could lease like for a hundred bucks bet Posted 5 months ago 5 months
on rain dance
suspended animatino Posted 5 months ago 5 months
on Hellion & Fifty Grand - Secret Garden
hellfitt Posted 5 months ago 5 months
on Late Nights, Early Mornings
overl0ad Posted 5 months ago 5 months
on Timeti & lysodrome - Plura
charged Posted 5 months ago 5 months
on Over These Clouds
rock Posted 5 months ago 5 months
on Dream In Color (Featuring Janine Levinson)
neat! Posted 5 months ago 5 months
on Wou-Wou & the Wormling, Pretzels Malone, Jam York & the Couch King - Dedication To The Hypocrites
absolutely undoubtedly fantastic Posted 5 months ago 5 months
on S.Yamagishi / Steve Vercelloni / Augenmerk / Couch King - Don't Take / Blooming Garden w/Bonus Track
i have no idea what this channel is about. but every single artist i've heard in these uploads has been fire Posted 5 months ago 5 months on Steph Sweet, Unearth Noise, Calebass, the Couch King - Summer is Gone, Hail the Sun (Ill Dub Master)
wondrous drums. blowing me mind at every division Posted 5 months ago 5 months on Mark Rodriguez, She's Excited, Gordon M, and the Couch King - You Know (What Guides You)
haha sick fam Posted 5 months ago 5 months on Mark Rodriguez, She's Excited, Gordon M, and the Couch King - You Know (What Guides You)
wonderful piece!1! Posted 5 months ago 5 months
on Infinite Bey/NayJ/SouL Muzick/Angelo Annicchiarico/TCM/Couch/ Wizardshoes - My Heart Is Vulnerable
the spread is wild af Posted 5 months ago 5 months
on Black Eyed & Broken
gnarly piece of work my friend Posted 5 months ago 5 months
on The God In Me Just Evaporated
rope gang Posted 5 months ago 5 months
on Soul Power (The Feeling Begins)
cool pump spread. different Posted 5 months ago 5 months
on Concrete Monkeys (James Kevin and Lawrence Farr)
awesome vibe lawrence Posted 5 months ago 5 months on Let's Dance Now (Ft Lauren) - Reworked
nice Posted 5 months ago 5 months
on Let's Dance Now (Ft Lauren) - Reworked
hashin' out a dispute type feel Posted 5 months ago 5 months
on Skillet Brother Blues w Alex Hendrix
keep them coming Posted 5 months ago 5 months on More Than You'll Ever Know (Cover) w Miss Prizz (Video by Polly Cambron)
miss prizz is destroying this track!! awesome job! Posted 5 months ago 5 months
on Stand Up/ w Mrs Rhymes & TCM Underground
mad tight Posted 5 months ago 5 months
on Twilight
$$$$ Posted 5 months ago 5 months on Get Me Firework
fruitful Posted 5 months ago 5 months
on Get Me Firework
boon-suzuki you fiery madman. this is insane Posted 5 months ago 5 months
on Wild Night ( Van Morrison Copy )
awesome!! Posted 5 months ago 5 months
on The Christian (original) the drums encapsulate the guitar so nicely. your vocals are whipped cream on top Posted 5 months ago 5 months
on The Day You Died ( original )
incredible fingerwork Posted 5 months ago 5 months
on O Mal Em Cada Um
sick Posted 5 months ago 5 months on De Segunda à Sexta Feira
call the police this track illegal Posted 5 months ago 5 months
on The Last Of...
oh buddy. the claps Posted 5 months ago 5 months
on Gods Of Science
rock and mother fucking roll Posted 5 months ago 5 months
on IntroVersioN
i enjoy the headspace you place on thais Posted 5 months ago 5 months
on Moments Denied the fried vox sound is seemingly unachievable for me!! lovely Posted 5 months ago 5 months
on Done Thinking Of You
tell it Posted 5 months ago 5 months on Ray Of The Sun - Adrian and Cw
i like you cam-o Posted 5 months ago 5 months on This Is How It Is Out A L'Ouest WITH CHRIS WEBER - OLIVIA & JOERXWORX
soothing. makes me want to meditate Posted 5 months ago 5 months
on Come On (ft. Olivia & Christoffersen Weber)
gorgeous!!! Posted 5 months ago 5 months
on Sun Comes Up (Collaboration with OCA & C.Weber)
nicely constructed! Posted 5 months ago 5 months
on La Soumission - Submission - (Collaboration featuring OCA & C.Weber)
well-made. well-directed. well-played. well-thought-out. well-met. Posted 5 months ago 5 months
on It was just an Illusion (Featuring Christofferson Weber)
<3<3<3<3 Posted 5 months ago 5 months on Old Friends - drunkeninstrumentcorp. 'n Cw
sweet idea guys. this is cash Posted 5 months ago 5 months
on Amazing Possiblities - Bonetender/Cw
i'm bumpin' hell yea Posted 5 months ago 5 months
on Amazing Possiblities - Bonetender/Cw
mad indie brother Posted 5 months ago 5 months
on Life's Big Drip
slayerrr Posted 5 months ago 5 months
on Today's The Day
great mix. well compressed Posted 5 months ago 5 months
on It's What You Wanted
the spread is perf g Posted 5 months ago 5 months on Grey Beard Blues
this is fine listening friend Posted 5 months ago 5 months
on the cat and la lune
definitely on that fresh shit Posted 5 months ago 5 months
on show me w/ kolada
@heartscore: thank you heartscore! Posted 5 months ago 5 months
on Shleepy's Hypercube (Bass Minimix)
bruh this is wicked Posted 5 months ago 5 months
on knyvez - atlas
madness Posted 5 months ago 5 months
on Bamf - Portrait
wow this is outstanding Posted 5 months ago 5 months on Luovodifaberge - Lucy
omfg panning mode activated Posted 5 months ago 5 months
on misirlou mash-up (cover)
these drums are soaring Posted 5 months ago 5 months
on Dance Me To The End Of Love (cover)
rickydickydoo you are doing well Posted 5 months ago 5 months on 02 Track 2 - Passage Through The Ethereal Ambient Ether
the spread is encompassing Posted 5 months ago 5 months
on Nomadic Feelings
awesome effect Posted 5 months ago 5 months
on Nomadic Feelings
mongolian throat singing is the best type of singing Posted 5 months ago 5 months on Repetitive Reflection
love this one! super sick Posted 5 months ago 5 months
on Wolfsland
cool Posted 5 months ago 5 months
on Wolfsland
this is final titan battle music Posted 5 months ago 5 months on # 1- Afro Soul (INTRO)REMASTERED - Amalfitani & The Borderlines Groovy's.
stompin' Posted 5 months ago 5 months
on # 3 - Gringo Mambo (Latin Funk)- Amalfitani & The Borderlines Groovy's.
such sass. nice Posted 5 months ago 5 months
on # 9 - In Trance -(ENDIG /REMASTERED)-(Afro Hard Trance)- Amalfitani & The Borderlines Groovy's.
knocc them hans Posted 5 months ago 5 months on Dreamtime-Floaterz-Colours-In-Space-Instrumental 3
entranced Posted 5 months ago 5 months
on Waterworld Feat. Shes Excited! 4
gang ragg without the pitched vox <3<3 Posted 5 months ago 5 months
on Should Have Waited
wow! Posted 5 months ago 5 months
on Strange Balloons
you're an absolute mad man Posted 5 months ago 5 months
on Fugitive Color
so natural/airy/uplifting/bright/trusting Posted 5 months ago 5 months
on Helix
man you are a beast wit them sticks Posted 5 months ago 5 months on Assemblage
theatrical mirror's edge type ish Posted 5 months ago 5 months
on The Vosges 01.24.17_1967GB
oh man, this one soundin' good my g Posted 5 months ago 5 months
on Sweet Dreams (Sketch: 01.25.17)-1972GB my sketches be like "beep boop *snare* boop bop" Posted 5 months ago 5 months
on I Love You Goodbye (01.01.17)
top tier Posted 5 months ago 5 months
on I Love You Goodbye (01.01.17)
warm, calming mix Posted 5 months ago 5 months
on Ink on paper - free download -
ooh Posted 5 months ago 5 months on Ink on paper - free download -
i wish i could play guitar Posted 5 months ago 5 months
on Why we should avoid *** TFB & Mike Spring ***
in love with your range of sound Posted 5 months ago 5 months
on How About Us?
wonderful piece of music. fun to listen to. super clean mix Posted 5 months ago 5 months
on RootsWings & Two Legs (+ video links)
absolutely gorgeous! Posted 5 months ago 5 months
on Greek Dubby Dinner
drumwork is lightning Posted 5 months ago 5 months on If I had a Hill so Green (Veranda Velha)with Janine Levinson (Voice and Lyrics)
<3<3<3<3 Posted 5 months ago 5 months on Lee Lucas & Heartscore - In Love With A Rotting Corpse
love the storytelling orchestral type experience Posted 5 months ago 5 months
on Lee Lucas & Warm Jet - Smokey Joe & His Cadillac
fire as hell Posted 5 months ago 5 months
on So This Is Spring. Torbjørn Vagle and Oddrun Eikli
nicely done. well composed Posted 5 months ago 5 months
on Under the sun (Bentcousin remix)
wondrous Posted 5 months ago 5 months
on 8. Free At Last ( Excerpt : See Track Notes )
p o w e r Posted 5 months ago 5 months on Sweet Sue - with Soundwanderer, Couch King & Fingerstyle_guitar
fresh basil on my spaghetti Posted 5 months ago 5 months on Fridges Brew And The Crooked Kitchen Orchestar
genuine Posted 5 months ago 5 months
on Neli CoKo - Enjoy
out of this world Posted 5 months ago 5 months
on A man saw a ball of gold in the sky
fast paced. tons of energy. sick Posted 5 months ago 5 months
on dead and beat
@jandretedj: appreciate that homie!! Posted 5 months ago 5 months
on The Scarce Interview was trying to play rocket league while listening on youtube, and it kept lagging so i watched at 144p lol. didn't know you had a soundcloud Posted 5 months ago 5 months
on worn out
@myrhyum: oh stop <3 Posted 5 months ago 5 months on Δ$$Δ´ - E Desce Até o Chão (Original Mix)
@assarodrigo: you gonna impregnate me with this tracc Posted 5 months ago 5 months
on show me w/ kolada
@daniel-pulse: thanks dan! Posted 5 months ago 5 months
on does it have to be
@michael-taylor-319: all day fam Posted 5 months ago 5 months
on Invading My Game
oh my Posted 5 months ago 5 months
on Taru
cool tunes homie. keep it up Posted 5 months ago 5 months
on NASA i really liek the funky synths you used on this. very different from most of the cookie cutter shit on soundcloud right now Posted 5 months ago 5 months on X Ray Mirror the beat sort of ratchet-and-clank-esque imo. which i fucking loooove Posted 5 months ago 5 months
on CROOKED MESSENGERS
drumwork = superb Posted 5 months ago 5 months
on Going Down In Flames
nice job on those vocals Posted 5 months ago 5 months
on Cassiopeia [Inner Noise EP]
banger Posted 5 months ago 5 months
on Cassiopeia [Inner Noise EP]
rad Posted 5 months ago 5 months
on Tangled Hair Slope
sick. i admire your creativity Posted 5 months ago 5 months on Snolt
am i being brainwashed Posted 5 months ago 5 months
on Fancy Panic Sleep
this is trippy as fuck Posted 5 months ago 5 months
on Fancy Panic Sleep
dude Posted 5 months ago 5 months
on Particles --Richard Alfaro And Cesium Swimsuit this guitar makes me sad and happy at the same time Posted 5 months ago 5 months
on Particles --Richard Alfaro And Cesium Swimsuit
good stuff Posted 5 months ago 5 months
on Cosmic Balance
really well done Posted 5 months ago 5 months on Cosmic Balance
sick bump! Posted 5 months ago 5 months on Robot Heart -- Walrus Tales and Cesium Swimsuit
damn this one sure is a smacker Posted 5 months ago 5 months
on Mood Exhibit- Soaring from Darkness
dark atmosphere is the perfect tag Posted 5 months ago 5 months
on Elura - Past Ghosts ( Fornicata remix)
them satellites whizzing by! tight Posted 5 months ago 5 months
on The Ending
good shit tho Posted 5 months ago 5 months
on The Ending
fucking scary tune Posted 5 months ago 5 months
on Alcoholic Astronaut cool! i'm likin' it Posted 5 months ago 5 months
on Step it up
hell yeah dude this is wild af!!! Posted 5 months ago 5 months
on Step it up this sound like optimus prime fucking a garbage truck Posted 5 months ago 5 months
on Step it up
this is disgusting Posted 5 months ago 5 months
on Revolution (feat. Steelyvibe)
$$$$$$$ cash monayyyyy Posted 5 months ago 5 months
on Crystal Cave
keep it up man! cool melody! Posted 5 months ago 5 months
on A Distant Light In The Space this breakdwon thooo f;ehfaew Posted 5 months ago 5 months
on A Distant Light In The Space
af Posted 5 months ago 5 months
on A Distant Light In The Space
your cover photo is sick ad Posted 5 months ago 5 months
on Haunted House Entering
hell yeah yup Posted 5 months ago 5 months
on Strings Intro them chords let you know shit's gonna get real Posted 5 months ago 5 months
on Lose Myself
dreams Posted 5 months ago 5 months
on Indigo
awesome! lots of power! Posted 5 months ago 5 months
on Quiet Noise - Diamond Rain in a Paper Forest
freshitites Posted 5 months ago 5 months
on QUIET NOISE | The Scenic Route
awesome adam~ Posted 5 months ago 5 months
on Quiet Noise - Teamwork Is Paramount
very chill. love it Posted 5 months ago 5 months
on Quiet Noise - Teamwork Is Paramount
wow! messing with me ears Posted 5 months ago 5 months on Georgia Ruth - Supermoon | QUIET NOISE REMIX
this is coo Posted 5 months ago 5 months on Georgia Ruth - Supermoon | QUIET NOISE REMIX
splickity clickin. help me figure it out Posted 5 months ago 5 months
on ӌӉӅӂӍ ӂӇ ӍӐӈ
these chords carry so much emotion Posted 5 months ago 5 months
on She's my jazz
smooth as can be Posted 5 months ago 5 months on Matziz - Amalthee [feat. Emily Coy] (Fox & Mew remix)
wow! now this is what i'm talking about Posted 5 months ago 5 months
on I Am King (Cypher Remix)
brehhhh these percs are dumb tight Posted 5 months ago 5 months
on Happy Mother's Day
cool track. different from the usual stuff Posted 5 months ago 5 months
on A Little While In (FREE DOWNLOAD)
real talk Posted 5 months ago 5 months on A Little While In (FREE DOWNLOAD)
truth being told Posted 5 months ago 5 months
on Dance Floor Love
u got spunk Posted 5 months ago 5 months
on You Are
this is mad ill my friend Posted 5 months ago 5 months
on Mass Particle
whoa Posted 5 months ago 5 months on Numbers in the Mirror | Belial Pelegrim & Dark Fidelity HiFi
very creative! nice variety of fx Posted 5 months ago 5 months
on Proclamation
these synths are so organic Posted 5 months ago 5 months on A0000001
rainforest bump Posted 5 months ago 5 months
on (lhbb 10)
the tuning how i n c r e d i b l e! Posted 5 months ago 5 months
on lofi.hiphop [ 1 yr ] good god damn this tap is fiiiiiiiire Posted 5 months ago 5 months
on imported waveform ∴
is that a lamb Posted 5 months ago 5 months
on imported waveform ∴
the lowest in fidelity technology Posted 5 months ago 5 months
on /|\5
sicccccck Posted 5 months ago 5 months on FranklyStyle & Danny Playamaqui - Gotmail (MintLab Exclusive)
stunning Posted 5 months ago 5 months
on four/t/eight
!!!! !!!!! Posted 5 months ago 5 months
on yardsale
what a beautiful array of tracks you have Posted 5 months ago 5 months
on FranklyStyle - This Goes (MintFam Exclusive)
seriously awesome perc work frankly Posted 5 months ago 5 months
on KFred & FranklyStyle - Igniting the Fire (MintLab Exclusive)
wonderful Posted 5 months ago 5 months
on KFred & FranklyStyle - Igniting the Fire (MintLab Exclusive)
this is tight as fuck! Posted 5 months ago 5 months on GAVE UP!!!! (Creative Commons)
cooling Posted 5 months ago 5 months
on How Many Roads Lead to One - mlouw/myrh
these vox are gorgeous Posted 5 months ago 5 months
on Portrait Of A Dying Colibri - FREEDOM DUB RMX
wicked almost scary Posted 5 months ago 5 months
on Golden city pt 3
quaint Posted 5 months ago 5 months
on Δ$$Δ´ - E Desce Até o Chão (Original Mix) who funk tone it down a little bit. i'm not tryna have no kids Posted 5 months ago 5 months
on PACMAN* - Extermination (The 9Deep Beat Squad Remix)
those drums are eeeevil Posted 5 months ago 5 months
on COLOROFTHECROSS(HIPHOPEDITION) this is really unique man Posted 5 months ago 5 months
on Brotherhood (In The Third Millennium)
awesome piece -o Posted 5 months ago 5 months
on In Those Woods
hair raising on the back of me neck m8 Posted 5 months ago 5 months
on iTz Holi FooK rAh! ://: ft Toshiya Kobayashi
ego jungle Posted 5 months ago 5 months on Soundshift - Have A Little Fun (Toshiya Kobayashi Remix)
awesome stereo spread Posted 5 months ago 5 months
on stargazer
awesome breath of icy cold fresh o2 Posted 5 months ago 5 months
on I Live In Your Eyes - eSyrup, Rehearsals and Spade very unique Posted 5 months ago 5 months
on Supernatural-The-Exper-T-Ft-Yana G-(Prod.By Soul Muzick)
this beat is sick!! Posted 5 months ago 5 months on The-Exper-T-Undiscovered-Ft-Yana G-(Prod.By Untracked And Soul Muzick)
great stuff Posted 5 months ago 5 months on The-Exper-T-Undiscovered-Ft-Yana G-(Prod.By Untracked And Soul Muzick)
yana killin this shit Posted 5 months ago 5 months
on The-Exper-T-Sleepless Nights-(Prod.By Sir Name)
soarin' Posted 5 months ago 5 months
on On The Fire
rad Posted 5 months ago 5 months
on The Love Of A Child © gorgeous Posted 5 months ago 5 months
on Serenity © awesome vibes! beautiful drums. they play so well together Posted 5 months ago 5 months
on Dawn ©
incredible mix level! Posted 5 months ago 5 months
on Freestyle Tools (Full Tape in Description)
such versatility Posted 5 months ago 5 months
on Heaven (feat. Da'Misi x Deuce Valentino)
and that guitar is deathhhh Posted 5 months ago 5 months
on Heaven (feat. Da'Misi x Deuce Valentino)
nice one guys. this is tight Posted 5 months ago 5 months
on West of the Nile fresher than tropifuckingcana Posted 5 months ago 5 months
on ha!
the spread is n u t s Posted 5 months ago 5 months
on ha!
damn a this fucking viiibes Posted 5 months ago 5 months
on San Onofre this makes me want to ditch everything i make and start ove ragain Posted 5 months ago 5 months
on San Onofre
bruh your hats bout to catch fire Posted 5 months ago 5 months
on Thomas Reid - Howling (Folded Voices Remix)
sick Posted 5 months ago 5 months
on purposelessness these chords are absolutely gorgeous Posted 5 months ago 5 months
on twuan x flavors - wind
yo Posted 5 months ago 5 months
on twuan x flavors - wind
bang gang Posted 5 months ago 5 months
on twuan - nah man
good god! this shit buuuuuumps Posted 5 months ago 5 months
on twuan ~ worth
special tides Posted 5 months ago 5 months
on flavors x flori x twuan- tropics
nice breath of fresh air Posted 5 months ago 5 months
on twuan x zonekidd - loving words
<3<3 Posted 5 months ago 5 months
on twuan x zonekidd - loving words
damn how deep can u dive Posted 5 months ago 5 months
on i get it.
i'm lost Posted 5 months ago 5 months
on i get it.
this is groundbreaking Posted 5 months ago 5 months on Mr. Carmack - Free Baby (Lege Kale Remix)
classic Posted 5 months ago 5 months
on C Y G N TRAP KIT Vol.3
rad bump Posted 5 months ago 5 months
on What Little Time
illin like a chilled villain Posted 5 months ago 5 months
on Flight (feat. Tiber)
!!!!!!! Posted 5 months ago 5 months
on Mickey Valen - Meet Me ft. Noé (Midas Touch-Up)
seriously catchy Posted 5 months ago 5 months
on show me w/ kolada
@jasonito-el-bueno-1: merlus? Posted 5 months ago 5 months
on does it have to be
@wolfgang-schwarz-1: thanks man! Posted 5 months ago 5 months
on comfort chain.
wow Posted 5 months ago 5 months on PuffMAN ft. KUBA WYLE ~ WOAH WOAH (PROD. KUBA)
tight Posted 5 months ago 5 months on Lain & Kultur - Feathers
telling a heartfelt story Posted 5 months ago 5 months
on midnight
awesome job Posted 5 months ago 5 months
on midnight
these drums are wiliin Posted 5 months ago 5 months
on What Was Will Be
nice. very extra terrestrial Posted 5 months ago 5 months on What Did She Do (Featuring Janine Levinson)
fun surf feel! excellent work guys Posted 5 months ago 5 months
on Through The Fire
piano killin Posted 5 months ago 5 months on All We Were
good work sebastian Posted 5 months ago 5 months
on Monster (Radio Edit)
well-composed Posted 5 months ago 5 months
on Leaving This Paradise
intense work Posted 5 months ago 5 months
on Hey Lulu
or is it hand hitting the wood?? who knows sounds good Posted 5 months ago 5 months
on Hey Lulu
love the frequencies at which the drums are operating. that and the vocals combined bring an awesome living feel to the tune. great work! Posted 5 months ago 5 months
on EVA
sick effects Posted 5 months ago 5 months on Preludio Semplice
great Posted 5 months ago 5 months
on Preludio Semplice
fantastic piece Posted 5 months ago 5 months
on Ribattino (Take I + II) each low note milks a tear Posted 5 months ago 5 months
on Laminar flow
<3 Posted 5 months ago 5 months
on Laminar flow
wonderful track friend Posted 5 months ago 5 months
on Laminar flow
bc these keys sure don't Posted 5 months ago 5 months on Laminar flow
lord have mercy Posted 5 months ago 5 months
on Laminar flow
bud this turn rips Posted 5 months ago 5 months
on Time Passes (disquiet0264)
awesome job Posted 5 months ago 5 months
on Time Passes (disquiet0264)
sort of hercelot-esque Posted 5 months ago 5 months
on Time Passes (disquiet0264) these sounds are absolutely wonderful!! Posted 5 months ago 5 months
on Glass
where are we Posted 5 months ago 5 months on Boilerplate 1893
this is interesting ahornberg Posted 5 months ago 5 months on B.Infinite vs Chris Cowley - Der Erdbeermund (B.Infinite´s SPACE Remix) [Snippet]
i'm entranced Posted 5 months ago 5 months
on All Around
got me groovi Posted 5 months ago 5 months
on All Around
cool tune man Posted 5 months ago 5 months
on Rhodes X J Sucry - Your Soul(Sunshine)
awesome vibe oozing out of every pore of this track Posted 5 months ago 5 months
on TURRINI/DENTON feat KEEFIER UNZIPPED "WHO OWNS PLANET EARTH?"
damn Posted 5 months ago 5 months on bridge in the sky(from 2nd single"image from a picture" free download!!)
game time Posted 5 months ago 5 months
on BETHY - honey bee(the humachine mix)
delicious Posted 5 months ago 5 months
on BETHY - honey bee(the humachine mix) in love with the whale speaking to me from the background Posted 5 months ago 5 months
on His Magick
that pad is goregous Posted 5 months ago 5 months
on Bad Witch.MP3
this make me want to ttwerk Posted 5 months ago 5 months
on Music Revolution
spread game sickkk Posted 5 months ago 5 months on Music Revolution
yuuuuhhh Posted 5 months ago 5 months
on Music Revolution i'm picking up the frequencies you're putting down fam Posted 5 months ago 5 months
on Funk It Up 'til You're Breathless
awesome tune Posted 5 months ago 5 months
on Funk It Up 'til You're Breathless
hell yeah! this sure is funky jub Posted 5 months ago 5 months
on The Elm
makes me want to play elder scrolls Posted 5 months ago 5 months
on The Elm
calming as fuckkkkkk Posted 5 months ago 5 months on Youth
this should be on the radio tbh Posted 5 months ago 5 months
on Sebwahwah - 140002 -
very cool! love the way the instruments interlock at such high speeds. i learned about something similar once. i think it was called kotakan or something on indonesian gamelan. sounds dope over here! good work sebwahwah Posted 5 months ago 5 months
on Been Dubbed
drums are on that real groove Posted 5 months ago 5 months
on tick tock
awesome beat Posted 5 months ago 5 months
on tick tock
unique Posted 5 months ago 5 months
on tick tock
this is cool. i like the grunge whisper Posted 5 months ago 5 months
on Summer Meadows
relaxed. taking that load off Posted 5 months ago 5 months
on Severed
tight Posted 5 months ago 5 months
on Back This Way
nice n full Posted 5 months ago 5 months
on New Year, Old Blues (Instrumental)
you're a monster Posted 5 months ago 5 months
on New Year, Old Blues (Instrumental)
andy!!!! Posted 5 months ago 5 months on Soulfire - TTM & KarNeVor - Brain Pain Mix
the bell synths <3 dayum Posted 5 months ago 5 months on (18+) Into The Mind Of A Mad Man - KarNeVor - Beats by Jay Fehrman - Lost It Mix
cool style homie Posted 5 months ago 5 months on (18+) DEATH By Speed - KarNeVor - Beats by Anonymus Beats - Remix
420 blaze it Posted 5 months ago 5 months
on Lost in you (Free Download)
such poppy chords :D Posted 5 months ago 5 months
on Learning to fall (Free Download)
this tune drives harder than formula 1 Posted 5 months ago 5 months
on You (Free Download)
the wah wah <3<3<# Posted 5 months ago 5 months
on You (Free Download)
beeautiful vox chops Posted 5 months ago 5 months
on Unjay_feat. Hooly Cal_Dream Catcher (free DL)
thug bangin on the net Posted 5 months ago 5 months
on show me w/ kolada
@step5: appreciate that my man! Posted 5 months ago 5 months
on Rabbit Hole
well done Posted 5 months ago 5 months
on Stigmatized if i stormed nations via silent montages, i would come to your to score my life Posted 5 months ago 5 months
on Never Always
sick hats damnnn Posted 5 months ago 5 months
on Never Always
digging your style plike. keep it up Posted 5 months ago 5 months
on The Proving Grounds
cool! Posted 5 months ago 5 months
on The Proving Grounds
awesome atmosphere!! Posted 5 months ago 5 months
on System Restored (Jimena & Doc Jon)
good mix guys Posted 5 months ago 5 months
on Abyss Of Agony (Jimena & Alexander Yakunin)
catchy Posted 5 months ago 5 months
on Life Once More (EXCORDE: Jimena & Jonnie)
cool track! unique experience Posted 5 months ago 5 months on Morgan Everett - Make Love to your Body (AudioVisual Exclusive)
feelsgood.jpeg Posted 5 months ago 5 months on Morgan Everett - Make Love to your Body (AudioVisual Exclusive)
awesome synth! it's emitting beams of light into my eardrums Posted 5 months ago 5 months
on Lilac - Carbon (AudioVisual Exclusive)
that kick just killed my grandma Posted 5 months ago 5 months
on Red
damn michelle this is tight Posted 5 months ago 5 months
on HYMERO - Best Year
jfc mix game astounding Posted 5 months ago 5 months
on Mood Exhibit- Solitude Dawn
nice Posted 5 months ago 5 months
on Mood Exhibit- Sora Eden
you've got a fresh sound here dude Posted 5 months ago 5 months on now we are free
this would go hard live Posted 5 months ago 5 months
on never give up i am alllllll about that downbeat boyoyoooo Posted 5 months ago 5 months
on dark side
sick!!! Posted 5 months ago 5 months
on KURO
it's like dancing with a water robot Posted 5 months ago 5 months
on Sunburst
awesome work polsteam fam!@ Posted 5 months ago 5 months
on Cold Comfort
love it Posted 5 months ago 5 months on Ocean
<3 Posted 5 months ago 5 months
on Ocean
thundering wonder Posted 5 months ago 5 months
on Warning
those slaps are heavenly Posted 5 months ago 5 months
on Warning how did you create such a deep composition?? Posted 5 months ago 5 months
on Sparks
sass ass claps Posted 5 months ago 5 months
on Don't Let Go
hard drive Posted 5 months ago 5 months on Don't Let Go
wizard sky painting hhuuhh Posted 5 months ago 5 months on Borgeous & BRKLYN Ft. Lenachka - Miracle (KINETIIK Remix)
i can feel the sand between my toes Posted 5 months ago 5 months
on BASSREKT - Rap Queen ft. Liza Soberano
str8 to tha heeead Posted 5 months ago 5 months
on BASSREKT - Rap Queen ft. Liza Soberano
slam that gas niggaaaaaa Posted 5 months ago 5 months
on A Party With Me
yes! yes! yes! yes! Posted 5 months ago 5 months
on Iced Dreams
mad spooked over here bruh. captivating track Posted 5 months ago 5 months
on Assassinate by a rhino preview funkdub all day Posted 5 months ago 5 months
on Glow
lavish Posted 5 months ago 5 months
on Glow
these tracks are so well comprehended. i mean jesus christ. the fades are just magical Posted 5 months ago 5 months
on Glow
engine farm! why haven't i been to your page before? Posted 5 months ago 5 months
on Are You New?
fuck Posted 5 months ago 5 months
on Are You New? w o w w h a t t h e h e l l i h i t e n t e r o n m y c o m m e n t a n d t h e n t h e s o n g g o t b e t t e r ? ! ! ? ? ! Posted 5 months ago 5 months on Are You New?
<3<3<3<3<3<3<3<3<3<3<3<3<4 Posted 5 months ago 5 months
on Forever Kisses - ft. Erin Pellnat
beautiful vox!! Posted 5 months ago 5 months
on All Eyes On Me - feat. IPG1 & Paploviante
yes Posted 5 months ago 5 months
on All Eyes On Me - feat. IPG1 & Paploviante real cartridge shit. this how it's supposed to be Posted 5 months ago 5 months
on La Montagne (French cover song)
i don't understand it but i like it Posted 5 months ago 5 months
on Deplore
tasty surroundings Posted 5 months ago 5 months
on SpiceKraft (100Followers) showdown town Posted 5 months ago 5 months
on ?:1
dang bruh what is that an oboe?? sounds gorg Posted 5 months ago 5 months
on Never Ride The Lonely Road [ youtube video]
000OOOooo.. Posted 5 months ago 5 months
on Never Ride The Lonely Road [ youtube video]
sick bass droops Posted 5 months ago 5 months
on ISSHO NI [ TOGETHER ] youtube video
whoa now! rollin Posted 5 months ago 5 months
on Hallelu planetary expansion undergoing construction?? Posted 5 months ago 5 months
on Supply Fi & Twobob - Social Sciences good work!! Posted 5 months ago 5 months
on Mein Auto Ist Schnell
tight Posted 5 months ago 5 months
on Wannseekonferenz
cool concept bruh Posted 5 months ago 5 months
on Wannseekonferenz
hi hats bout to catch fire Posted 5 months ago 5 months
on Skyes Interlude waves of ice in a neverending artic wonderland Posted 5 months ago 5 months
on Solstice
fantastic! fingers are are fire Posted 5 months ago 5 months
on Unrequited Love
experiential Posted 5 months ago 5 months
on One More Suicide - acoustic - Angelo Annicchiarico #DavidLeeLouthan
it's got soul Posted 5 months ago 5 months
on ubiq - scriptkiddie (MintFam Exclusive) clicky filler percs are something i just can't seem to get a grasp on... great stuff Posted 5 months ago 5 months
on ubiq - scriptkiddie (MintFam Exclusive)
sick tune fam Posted 5 months ago 5 months
on Unless
quite unique. the drums are the perfect kind of lazy. excellent swing Posted 5 months ago 5 months
on Subway
this gives some crazy visuals Posted 5 months ago 5 months
on Crackler tight Posted 5 months ago 5 months
on Crackler
spaceman jamstation Posted 5 months ago 5 months
on Drawing Blood +++ New Electronic Frontier *** MonkEyDM
synth is like glue for the drums tryna break out of existence Posted 5 months ago 5 months
on Santa Cruz Swap +++ What's Good for Willis? aka HomieTron ElectroGrip the Chronic Electronic
damn this is moneyy Posted 5 months ago 5 months on A Warm Hearth +$$$+ MetaLectro Progtronica NEF Fresh Disco aka "Sensual Juices Mix"
eerie synthwork bro Posted 5 months ago 5 months on A Warm Hearth +$$$+ MetaLectro Progtronica NEF Fresh Disco aka "Sensual Juices Mix"
arms a thrashin Posted 5 months ago 5 months on show me w/ kolada
@ichardbrown: thank you richard! Posted 5 months ago 5 months
on Kites
@elle_minuscule: grynpyret is leagues above me loool Posted 5 months ago 5 months
on they are
@elle_minuscule: wtfff who are you?? hahah you can still find it on bandcamp i think! Posted 5 months ago 5 months
on Gaia ... reprise
creative influence Posted 5 months ago 5 months
on Confusion
that drum rolls were handed down from god himself Posted 5 months ago 5 months
on 2014 UZ224
sw1tch 1t up Posted 5 months ago 5 months on 2014 UZ224 and the laserssssssss <3 Posted 5 months ago 5 months
on 2014 UZ224
beautiful intricacies Posted 5 months ago 5 months
on Back (Original Mix)
you're a funky dude Posted 5 months ago 5 months on Jump Start (Original Mix)
k1lowaTT! k1lowaTT! Posted 5 months ago 5 months on Jump Start (Original Mix)
who got tha wub?? Posted 5 months ago 5 months on Jump Start (Original Mix)
this is righteous Posted 5 months ago 5 months on Jump Start (Original Mix)
i can't drop my body and lower Posted 5 months ago 5 months
on Jump Start (Original Mix)
whoa bro you injected the groove in me Posted 5 months ago 5 months on The Sound Is In The Iron, Ambient, Deep House Version
space travel at the speed of light??? Posted 5 months ago 5 months
on Moeghea / Shine So Bright IN DUB (1 keV Version)
inspiring Posted 5 months ago 5 months
on Moeghea / Shine So Bright IN DUB (1 keV Version)
these vocals are tight as fuck Posted 5 months ago 5 months
on Moeghea / Shine So Bright IN DUB (1 keV Version)
sick!! Posted 5 months ago 5 months on Moeghea / Shine So Bright --- Soul, Roots Reggae, EDM really cool Posted 5 months ago 5 months
on Moeghea / Shine So Bright --- Soul, Roots Reggae, EDM
sick concept! and perfect reverb Posted 5 months ago 5 months
on soundZ
l<3ve that echo! Posted 5 months ago 5 months
on world in a bubble (pls read description ;)) your compositions use a wide variety of sounds. well done Posted 5 months ago 5 months
on spacey_tabla_synth_fusion
where have you taken me Posted 5 months ago 5 months
on little deep sea dub
it's like an orbiting coffee shop shuffle Posted 5 months ago 5 months
on little deep sea dub we've gone digital my friends Posted 5 months ago 5 months on Xavier Wulf - Weatherman (Chopped and Screwed)
truth Posted 5 months ago 5 months
on ah well ft. looms. [video: http://bit.ly/ahwell]
i like your style homie Posted 5 months ago 5 months
on ah well ft. looms. [video: http://bit.ly/ahwell]
damn...... Posted 5 months ago 5 months
on spin & shoot
hell yeah Posted 5 months ago 5 months
on b i t c h
@biohannya: hi biohannya Posted 5 months ago 5 months
on b i t c h
word Posted 5 months ago 5 months
on All About You
is that a banjo?? Posted 5 months ago 5 months
on All About You
super catchy Posted 5 months ago 5 months on SATELLITE FT. DESPOT (PRODUCED BY SHAWN KEMP)
mad Posted 5 months ago 5 months
on Siberia
illin' round the block Posted 5 months ago 5 months
on Pleasure
these slows jams are all vibe Posted 5 months ago 5 months
on Pleasure
hell yeah bruh do your thing Posted 5 months ago 5 months
on Air
tight Posted 5 months ago 5 months
on Air whoa! wonderfully interlocking countermelodies Posted 5 months ago 5 months
on Air
beauty Posted 5 months ago 5 months
on Air
love the long echoes!! Posted 5 months ago 5 months
on Rouler la Nuit
sick Posted 5 months ago 5 months
on Rouler la Nuit
oh my fuck Posted 5 months ago 5 months on Rouler la Nuit
i damn near just had a heart attack Posted 5 months ago 5 months
on does it have to be
@bigbushwolfpapa: i'm sitting in class trying my hardest to contain my smile but it's just not happening Posted 5 months ago 5 months
on worn out
@bigbushwolfpapa: oh stop, you! Posted 5 months ago 5 months
on dead and beat
@theoretical-being: the thought of performing terrifies me Posted 5 months ago 5 months
on worn out
@theoretical-being: appreciate you Posted 5 months ago 5 months
on all yours
@bigbushwolfpapa: bruh i'm beyond flattered Posted 5 months ago 5 months on asmote
@bigbushwolfpapa: holy shit!! <3 thank you! that really means a lot to me dude Posted 5 months ago 5 months
on worn out
@theoretical-being: whoa bro!! almost missed this. thank you!! Posted 5 months ago 5 months
on dead and beat
@negative-headphone: thanks man! Posted 5 months ago 5 months
on dead and beat
@the-oracles-music: thank you! Posted 5 months ago 5 months
on does it have to be
@the-oracles-music: <3<3<3<3<3 Posted 5 months ago 5 months
on show me w/ kolada
@cosmos6666: thank you, i appreciate that! Posted 5 months ago 5 months
on show me w/ kolada
@jnmrg: appreciate it brother! i think 120? Posted 5 months ago 5 months
on show me w/ kolada
@franco-galateo: thanks franco! Posted 5 months ago 5 months
on show me w/ kolada
@arsivall: livin' in the shade fam Posted 5 months ago 5 months
on show me w/ kolada
@theoretical-being: thanks! me too! Posted 5 months ago 5 months
on show me w/ kolada
@bigbushwolfpapa: thank you so much!! appreciate your kind feedback Posted 5 months ago 5 months
on ASHES TO ASHES - David Bowie
@phil-mcwalter: just as valuable Posted 5 months ago 5 months
on BLUE PLANET (New CLIP > see Link Below)
loving atmosphere. fantastic chords!! Posted 5 months ago 5 months
on John Sense & Special Cecilia - Deep Vibrations
get dat trance booyyyy Posted 5 months ago 5 months
on Away from Myself (Unfinished 2010) - Emmazen
beautiful Posted 5 months ago 5 months on Until We Meet Again > Glen W. Vox feat. Jaime Webb Ross
icy melody Posted 5 months ago 5 months
on So Far Away
light on the stomach Posted 5 months ago 5 months
on So Far Away
great job! very relaxing and unique Posted 5 months ago 5 months on Corner Of The Eye (Tribal Techno Mix)
open and let it consume you Posted 5 months ago 5 months
on Positively Positive
good shit fudge nutz Posted 5 months ago 5 months
on Josey Jo - what do she know [soundboard tinkerers - original]
my ears are melting this track so hot Posted 5 months ago 5 months
on Josey Jo - what do she know [soundboard tinkerers - original]
tight! Posted 5 months ago 5 months on us in beatness [soundboard tinkerers and deeny beats - original]
most evil tune i've heard this week Posted 5 months ago 5 months on us in beatness [soundboard tinkerers and deeny beats - original]
this is mad af Posted 5 months ago 5 months on JasmineBond - the swift [soundboard tinkerers ft Bluebird]
cool one guys Posted 5 months ago 5 months
on JasmineBond - the swift [soundboard tinkerers ft Bluebird]
whoa! Posted 5 months ago 5 months
on JasmineBond - the swift [soundboard tinkerers ft Bluebird]
bond always a spooky progression Posted 5 months ago 5 months
on Bounce - ft. Mrs Rhymes. Lost Angel Of Havik & Cyba. (Prod. By Danny E.B.)
this beat is literally fire Posted 5 months ago 5 months on Do It Like That (EXPLICIT) Ft Shorty Mic, Mrs Rhymes, Lost Angel & Cyba. Prod by D.j.-KOOLBREEZE
hell yeah stay rippin rhymes Posted 5 months ago 5 months
on Stand Up/ w Mrs Rhymes & TCM Underground
guitar fucking slaying Posted 5 months ago 5 months on Stand Up/ w Mrs Rhymes & TCM Underground
constant spits Posted 5 months ago 5 months
on This Christmas
serenity Posted 5 months ago 5 months
on SAME KISS
dope bounce Posted 5 months ago 5 months
on Vesta this is taking me deep inside the waveform Posted 5 months ago 5 months
on Never Stop
interesting concept friend Posted 5 months ago 5 months
on Free
bass is fucking ripping! good stuff Posted 5 months ago 5 months on Sampled by God
eee Posted 5 months ago 5 months
on Sampled by God
is the key Posted 5 months ago 5 months
on Sampled by God
you see Posted 5 months ago 5 months
on Sampled by God
fluidity Posted 5 months ago 5 months on Technical Mind (RIP Dad; Notes in Track Description)
salmmin Posted 5 months ago 5 months on Technical Mind (RIP Dad; Notes in Track Description)
engrossing chords Posted 5 months ago 5 months on Technical Mind (RIP Dad; Notes in Track Description)
best wishes Posted 5 months ago 5 months
on The Main Point
sick work bud Posted 5 months ago 5 months
on Behind Everything
the tiny hand drums <3<3 Posted 5 months ago 5 months
on Behind Everything
you create such intricate compositions Posted 5 months ago 5 months on Light Hits the Eye (Theoretical Being & Justyna Collab)
reel time keep it rollin Posted 5 months ago 5 months on Light Hits the Eye (Theoretical Being & Justyna Collab)
this is awesome guys Posted 5 months ago 5 months
on Sequitur - Step5 good concentration tune Posted 5 months ago 5 months
on Adaptive - Step5 (Radio Edit)
sick concepts step5. i am liking your stuff Posted 5 months ago 5 months
on Cruising - Step5
perfect amount of echo Posted 5 months ago 5 months
on Cruising - Step5
awesome melody! Posted 5 months ago 5 months
on Cruising - Step5 shakers bout to start a damn fire up in here Posted 5 months ago 5 months
on Walking On Galaxies - Step5
cool tune my friend Posted 5 months ago 5 months
on Walking On Galaxies - Step5 i wish i could be more creative Posted 5 months ago 5 months
on Rainbow Echoes
damn that bass sure drives Posted 5 months ago 5 months
on Circle Of Winners (Ft. Klassic)
hop hop Posted 5 months ago 5 months
on Circle Of Winners (Ft. Klassic)
tight sound! interesting style Posted 5 months ago 5 months
on Victory Lap
good story Posted 5 months ago 5 months
on Victory Lap
kick keepin on Posted 5 months ago 5 months on I'm fine thank you and you must die
damn son this is sick Posted 5 months ago 5 months
on Entities by steph sweet and drunkeninstrumentcorporation it's like pulling stress out of my body through my ears Posted 5 months ago 5 months
on Entities by steph sweet and drunkeninstrumentcorporation
swamping me Posted 5 months ago 5 months
on ASHES TO ASHES - David Bowie
cash money Posted 5 months ago 5 months
on Gelow Foster - THE WAVE
keep it real Posted 5 months ago 5 months
on Hours
<3<3 Posted 5 months ago 5 months
on Hours
the glitchy voxy synth is g o r g e o u s Posted 5 months ago 5 months
on Hours
absolutely love your style gelow Posted 5 months ago 5 months
on What you say
captivating Posted 5 months ago 5 months
on What you say damn those drums are really moving Posted 5 months ago 5 months
on What you say
digging it!! Posted 5 months ago 5 months
on Peace
deprivation tank feel Posted 5 months ago 5 months
on Bossa Nova Rainbow Love
lead like strawberry creme Posted 5 months ago 5 months on Bossa Nova Rainbow Love
fruitful Posted 5 months ago 5 months
on worth
@oylo: lllll Posted 5 months ago 5 months
on yuyu rainy ft Laydown
droid Posted 5 months ago 5 months
on w a r n i n g
(OoO) Posted 5 months ago 5 months on Ca Va Bien (ft. lausse the cat) ***FREE DOWNLOAD***
sick bending Posted 5 months ago 5 months
on the cat who came for tea
tight Posted 5 months ago 5 months on the cat who came for tea
yo this is really cool Posted 5 months ago 5 months on NYC Window (ft. Seraiah Nicole & Steve Chandy)
gold Posted 5 months ago 5 months on NYC Window (ft. Seraiah Nicole & Steve Chandy)
those bg ad libs omg Posted 5 months ago 5 months
on RAIN DROP, DROP TOP
damn dark Posted 5 months ago 5 months
on RAIN DROP, DROP TOP
fresh sound Posted 5 months ago 5 months
on MAD//TING
aquathrust Posted 5 months ago 5 months on Dislocated L'amour
@user-396210125: banjo kazooie Posted 6 months ago 6 months on Eli Way & Ian Ewing ⁃ Happy With U (feat. Naji) (Icarus Moth Remix)
boy this goes Posted 6 months ago 6 months
on FADER Mix: Elaquent
piece n luv is riteee Posted 6 months ago 6 months
on Pressure (Lost Club Remix)
tasteful Posted 6 months ago 6 months
on Pressure (Lost Club Remix)
tight Posted 6 months ago 6 months
on BLIZZARD
fat Posted 6 months ago 6 months on foramen magnum
what a magnificent masterpiece you have created Posted 6 months ago 6 months on LOFI DREAMs ∞∞ 12-BIT ultra lofi realtime arcade sampler // granular device & live audio dreamscape
dreamy for sure Posted 6 months ago 6 months
on NP Curations 017 // 3lo
well curated Posted 6 months ago 6 months
on NP Curations 017 // 3lo
this mix is loud af Posted 6 months ago 6 months
on Rihanna - Sex With Me (Dugong Jr Remix)
not mermaids, they're dugongs@@ Posted 6 months ago 6 months
on !"#$%
nice one homie Posted 6 months ago 6 months on Seji
delicacy Posted 6 months ago 6 months on 1WayTKT feat. Netousha Monroe - Insanity (OUT NOW)
beautiful Posted 6 months ago 6 months on 1WayTKT feat. Netousha Monroe - Insanity (OUT NOW)
this is funky Posted 6 months ago 6 months
on Side By Side
b4by Posted 6 months ago 6 months
on Adhesive
fiah Posted 6 months ago 6 months
on JUST ACCEPT [OUT NOW ON BANDCAMP]
warjuke squuuad Posted 6 months ago 6 months
on Beyonceinstro carman Posted 6 months ago 6 months
on all yours
@spaceslab-go: thank you spaceslab!! Posted 6 months ago 6 months
on Girlfriend
@churchoftheundecided: appreciate the kind words my friend! Posted 6 months ago 6 months
on dead and beat
@churchoftheundecided: hoover Posted 6 months ago 6 months
on worth
@dj_emajor: thanks! Posted 6 months ago 6 months
on Reddington [Free Download]
@seize-the-beat: the only times i go out are for class, groceries, and da green man Posted 6 months ago 6 months on Astral Drift
tight bump bruh Posted 6 months ago 6 months
on Astral Drift
soz 420 kill it Posted 6 months ago 6 months
on Astral Drift
astrallagy as far wannars Posted 6 months ago 6 months
on Yule Noodling
pads Posted 6 months ago 6 months
on Yule Noodling
awesome padas Posted 6 months ago 6 months
on Ism-Ism
these drums are boppin Posted 6 months ago 6 months on Locomotive For Weird Mysteries And Visions* cool Posted 6 months ago 6 months on Locomotive For Weird Mysteries And Visions*
lazahs Posted 6 months ago 6 months
on Qu'est - Ce Que C'est
dusk Posted 6 months ago 6 months
on Qu'est - Ce Que C'est
and the bassline is like warm ice cream Posted 6 months ago 6 months
on Qu'est - Ce Que C'est
tight cover art Posted 6 months ago 6 months
on Wait
power in the plucks Posted 6 months ago 6 months
on Wait cool sound demetri! Posted 6 months ago 6 months
on Escape From Tellus
take us home captain Posted 6 months ago 6 months
on Anaconda
nice one Posted 6 months ago 6 months
on Anaconda
tasty Posted 6 months ago 6 months
on Ludos (Sleeping Minds)
pound Posted 6 months ago 6 months
on Ludos (Sleeping Minds)
super solid Posted 6 months ago 6 months
on Black Rose (Sleeping Minds)
@peter-wheeler: most definitely Posted 6 months ago 6 months
on Black Rose (Sleeping Minds)
damn Posted 6 months ago 6 months
on Black Rose (Sleeping Minds) awesome style guys! sounding good here! Posted 6 months ago 6 months
on Dream
these tiny percs are liviiidid Posted 6 months ago 6 months
on Dream
time will tell all Posted 6 months ago 6 months
on Deep
steady pumping boyo Posted 6 months ago 6 months on Fun With Pap's Open Collab Something Rock2
electric Posted 6 months ago 6 months
on Do It Now! Collab W Paul
put this together really nicely Posted 6 months ago 6 months
on The Chill Pump these keys are like lops of butter being flung off a butter spoon onto some nice big old flapjacks Posted 6 months ago 6 months
on The Chill Pump
awesome bump Posted 6 months ago 6 months
on Girlfriend
this is tight my friend Posted 6 months ago 6 months
on Concentration
tweet your heart out Posted 6 months ago 6 months
on Concentration
tweet little birds Posted 6 months ago 6 months
on Concentration
intergadialect Posted 6 months ago 6 months
on Future Child (Char) - Cover (Instrumental)
good end to a long monday Posted 6 months ago 6 months
on Future Child (Char) - Cover (Instrumental)
most lovely Posted 6 months ago 6 months on Reach Out I'll Be There (Richie Kotzen) - Cover (Instrumental)
that breakdownnnnn Posted 6 months ago 6 months on Reach Out I'll Be There (Richie Kotzen) - Cover (Instrumental)
i'm tossed Posted 6 months ago 6 months on Reach Out I'll Be There (Richie Kotzen) - Cover (Instrumental)
sizzling hot magma Posted 6 months ago 6 months on Reddington [Free Download]
wicked Posted 6 months ago 6 months
on Reddington [Free Download] i'm near auburn. dm me if you're ever in the area man Posted 6 months ago 6 months
on Reddington [Free Download]
you seizin me bro Posted 6 months ago 6 months
on Fifty Shades Of Jane (prod. johnytiger & laflare)
blow pop pop Posted 6 months ago 6 months
on my people
my pope Posted 6 months ago 6 months
on SORCERER'S PRELUDE/SIGHTS + FEELINGS
gotta stay pumpin them synth bellows Posted 6 months ago 6 months on Falling Down
oh buddy. alwayyys Posted 6 months ago 6 months
on VVSV - We Could Be Free
777 Posted 6 months ago 6 months
on triumph
comin out on top Posted 6 months ago 6 months
on What You Mean to Me
mhm Posted 6 months ago 6 months on internet love (no connection)
this that real shit Posted 6 months ago 6 months on internet love (no connection)
hell yeah Posted 6 months ago 6 months on 18. Imagine [Jordan Rakei]
hotter than an air balloon Posted 6 months ago 6 months
on 18. Imagine [Jordan Rakei]
l0ve l0ve l0ve Posted 6 months ago 6 months
on Cavaro ft. Faheem - Lost In You (Heuse remix) drive that synth all the way around the bloc Posted 6 months ago 6 months
on purify
get that cleansing Posted 6 months ago 6 months
on Ness prod. by WTCHCRFT
elegance Posted 6 months ago 6 months
on gloom
void Posted 6 months ago 6 months
on last chance raw Posted 6 months ago 6 months
on last chance who says you can't clip kick your kick out of existence Posted 6 months ago 6 months
on Girls
girl swummin in the ocean Posted 6 months ago 6 months
on Lil Bean Vert - BEANTRUCK (prod. Drip-133)
@ubv: lookin fye Posted 6 months ago 6 months
on Lil Bean Vert - BEANTRUCK (prod. Drip-133)
got get me som burrrrrritoooos Posted 6 months ago 6 months
on ghost ft. brndn (prod. cresce)
chll Posted 6 months ago 6 months
on ghost ft. brndn (prod. cresce) careless caress Posted 6 months ago 6 months
on Top Floor (Feat. Wize)
flyy Posted 6 months ago 6 months
on Top Floor (Feat. Wize)
underground spies Posted 6 months ago 6 months
on *MONOPOLY* (prod. DEXTER DUKARUS)
flush Posted 6 months ago 6 months on *A-1 MARKET JUUGIN' PT. 3* (prod. RXLVND)
non stooop Posted 6 months ago 6 months
on Havok Roth & Tory Lanez - LUV
sum1111 Posted 6 months ago 6 months
on refractor - radiant flux
awesome shxt Posted 6 months ago 6 months
on CALIBR - Birbs
flame Posted 6 months ago 6 months
on chromonicci. - Waves
boy we slappin Posted 6 months ago 6 months
on vrvge - mountain
feelin éasy Posted 6 months ago 6 months
on Drevm- Wtchcrft
gl1tches Posted 6 months ago 6 months
on dead and beat
@cosmos6666: thanks! :D Posted 6 months ago 6 months
on dead and beat
@cosmos6666: no problem! thank you! Posted 6 months ago 6 months
on Tiny Rainbows Held Within
magic fills the air Posted 6 months ago 6 months
on The Big One
mad flames Posted 6 months ago 6 months
on The Big One
gotta get the top fore the top startsta drop Posted 6 months ago 6 months on White Dwarfs And Red Giants by steph sweet and drunkeninstrumentcorporation
trippy Posted 6 months ago 6 months on White Dwarfs And Red Giants by steph sweet and drunkeninstrumentcorporation
this is interesting Posted 6 months ago 6 months
on with JUXTA "Off The Chain" [+lyrics]
flaming fire Posted 6 months ago 6 months
on with JUXTA "Off The Chain" [+lyrics]
interesting profile you've got here Posted 6 months ago 6 months
on with Marko Broström "King Of L.A." [+lyrics] really enjoying the grunge on the vox. sounds sick Posted 6 months ago 6 months
on with Richard Brown "Metal" [+lyrics]
wooooooah that lead hnnng Posted 6 months ago 6 months
on with Richard Brown "Metal" [+lyrics]
slaying it guys Posted 6 months ago 6 months
on Juxta - Lows and Highs (Biggami remix)
tight Posted 6 months ago 6 months
on Juxta - Lows and Highs (Biggami remix)
hyperspeed Posted 6 months ago 6 months
on Under A Blue Moon (instrumental version)
trill Posted 6 months ago 6 months
on Famous last words
props friend Posted 6 months ago 6 months
on Famous last words
get me my satchel Posted 6 months ago 6 months
on Devras Plexi - TWOBOB - Multiplex - PartTwo
wh0A Posted 6 months ago 6 months
on OverTheRain - OrganicMix
gorgeous Posted 6 months ago 6 months
on OverTheRain - OrganicMix broke it open and shattering particles of golden light came exploding into the area Posted 6 months ago 6 months
on where I went wrong
cool comp Posted 6 months ago 6 months
on Flânerie dans le train-train quotidien
good stuff colbru Posted 6 months ago 6 months
on Le blues du vieillard ...
beautiful guitar ^^^ Posted 6 months ago 6 months
on L'avant et l'après ....!
: ) Posted 6 months ago 6 months
on L'avant et l'après ....! interesting free rhythm feel. loving it Posted 6 months ago 6 months
on The Intervoïd Festival -
w0w Posted 6 months ago 6 months on The Intervoïd Festival -
metroido Posted 6 months ago 6 months
on Let Me Spray Your Flower
awesome kick pattern Posted 6 months ago 6 months
on Let Me Spray Your Flower
pierre this is scary af Posted 6 months ago 6 months
on Let Me Spray Your Flower
sick! Posted 6 months ago 6 months on 19-Spiderman Rock. Cover . (with you tube video)
mad western grooves Posted 6 months ago 6 months
on Mafia Surf
great shit Posted 6 months ago 6 months on Mafia Surf
let's go surfing fam Posted 6 months ago 6 months
on Mafia Surf
what a perfect beat Posted 6 months ago 6 months
on melancholic sequence
bruh we flyin Posted 6 months ago 6 months
on melancholic sequence
drum that bass Posted 6 months ago 6 months
on Entrance
the pan is gorgeous Posted 6 months ago 6 months
on Nébuleuse very relaxing atmosphere you've created Posted 6 months ago 6 months on Nébuleuse
supreme rif Posted 6 months ago 6 months
on Amnesia 2
guitar really speaks nicely Posted 6 months ago 6 months
on Horizon
evanescence Posted 6 months ago 6 months on DIFFUSUS - REFEM / Paploviante
these shakers maaas Posted 6 months ago 6 months on DIFFUSUS - REFEM / Paploviante
we are deep in now Posted 6 months ago 6 months on DIFFUSUS - REFEM / Paploviante
i can feel it coming Posted 6 months ago 6 months
جوم . on جوم . on
nice 1 junyiiiiii Posted 6 months ago 6 months
جوم . on
cannot go wrong Posted 6 months ago 6 months
جوم . on
oh my, those them chords thoooo Posted 6 months ago 6 months
جوم . on that snare/clap/perc that sounds like lightly tapping two bricks together is incredible. pls send me? Posted 6 months ago 6 months
جوم . on
glangor Posted 6 months ago 6 months
جوم . on
bass notes forcing certain muscles of my body into a massaged-like-state Posted 6 months ago 6 months جوم . on the clip the pop the bump and the lop Posted 6 months ago 6 months
on UK
keep doing your thing homie Posted 6 months ago 6 months
on FLIPPIN ON YOU
roll me up and swing me down Posted 6 months ago 6 months
on Genesis
oozing with power Posted 6 months ago 6 months
on While You Were Here (Prod. Oylo)
sick flow dude Posted 6 months ago 6 months on ֵ
<3<3 Posted 6 months ago 6 months on ֵ
gorgeous Posted 6 months ago 6 months
on Elona Jeta - Gelato [Prod. @taylorkingmusic]
this is tight as fuck Posted 6 months ago 6 months
on Elona Jeta - Gelato [Prod. @taylorkingmusic]
jelona eato Posted 6 months ago 6 months
on dead and beat
@johnny-hazard: thank you! appreciate that Posted 6 months ago 6 months
on show me w/ kolada
@keylomusic: thanks homie Posted 6 months ago 6 months
on Dance Party ( with a video clip )
str8 digital Posted 6 months ago 6 months on 67 MERRY CHRISTMAS ! & HAPPY NEW YEAR 76
them snowflakes is heavy Posted 6 months ago 6 months
on 67 MERRY CHRISTMAS ! & HAPPY NEW YEAR 76
appreciate the kind words! great beat Posted 6 months ago 6 months
on Dislocated L'amour this makes me want to play my favorite childhood videogame Posted 6 months ago 6 months
on Turncoat
sick sound homie Posted 6 months ago 6 months
on Obsidian Blues [remaster]
nicely filled Posted 6 months ago 6 months
on Last Day On Earth
warping through planets Posted 6 months ago 6 months on Together - 23 musicians. 12 countries. 1 stage
kickin it Posted 6 months ago 6 months on Taking It Up - with Dan van den Berg / guitar
mad bounce too omg Posted 6 months ago 6 months on Taking It Up - with Dan van den Berg / guitar
slaying it Posted 6 months ago 6 months on Taking It Up - with Dan van den Berg / guitar
holy shit!! fusion drive actived Posted 6 months ago 6 months
on Vampire....
this lead is on fire Posted 6 months ago 6 months
on Vampire....
i am digging your unique sound chet Posted 6 months ago 6 months on Don't Let Them Go Away
that note broke my heart Posted 6 months ago 6 months
on Don't Let Them Go Away
ever tried getting a job scoring a film Posted 6 months ago 6 months
on They Only Know My Name
oh man this is a nice breath of fresh air Posted 6 months ago 6 months
on They Only Know My Name and these harmonies are sumotherfuckingpreme!!!!! Posted 6 months ago 6 months
on They Only Know My Name
awesome percussion! has my mind tracing Posted 6 months ago 6 months
on MAGIC (Lyrics)
i like it. interesting and somewhat spooky Posted 6 months ago 6 months
on The Guy That Stalked You Has Become the President!!!! on that beach vibe Posted 6 months ago 6 months on Coming Into San Francisco .... (Cult Before Country Album Release)
nice Posted 6 months ago 6 months on Coming Into San Francisco .... (Cult Before Country Album Release)
got the right grunge Posted 6 months ago 6 months
on hope
<3 Posted 6 months ago 6 months
on hope
extraordinary composition my friend Posted 6 months ago 6 months
on Leaves Fall
top notch effect work Posted 6 months ago 6 months
on The Earth's Wonder Child bloody hell Posted 6 months ago 6 months
on Koufonisia
this is sick bud Posted 6 months ago 6 months
on Koufonisia
intense Posted 6 months ago 6 months
on Faster Than Light that organ don't stop killin does it Posted 6 months ago 6 months
on Faster Than Light
drive it up there!! Posted 6 months ago 6 months
on Alberta Breeze
nice Posted 6 months ago 6 months
on Alberta Breeze
magnificent Posted 6 months ago 6 months
on Sublime
man oh man Posted 6 months ago 6 months
on Sublime
fancy space fance Posted 6 months ago 6 months
on My song 6
: ) : ) Posted 6 months ago 6 months
on a boring new day
love it Posted 6 months ago 6 months
on You're delirious
so gorgeous Posted 6 months ago 6 months
on You're delirious phenomenal chords sequences Posted 6 months ago 6 months on (18+) When You See Me - KarNeVor - Beats by KOOL DJ R.K.M. - pOp pOp Mix
tite Posted 6 months ago 6 months on (18+) When You See Me - KarNeVor - Beats by KOOL DJ R.K.M. - pOp pOp Mix
frunch brang gramo dod Posted 6 months ago 6 months
on On the Turning Away (Acoustic Pink Floyd cover)
nicely done friend Posted 6 months ago 6 months
on Beginning Again
beams of light in those chords Posted 6 months ago 6 months
on Way Below (Instrumental version)
medieval relaxation Posted 6 months ago 6 months
on Way Below (Instrumental version)
gangthug Posted 6 months ago 6 months
on A long time away (ballad)
this is awesome fam Posted 6 months ago 6 months
on Descent (instrumental)
snare game - tight af Posted 6 months ago 6 months
on Descent (instrumental)
taking names Posted 6 months ago 6 months
on Descent (instrumental)
hi hats are kicking ass Posted 6 months ago 6 months
on When I Think Of You (Composing in Counter-Point: See Description) awesome storytelling vibe. makes me want to go on a quest Posted 6 months ago 6 months
on Sometimes I Wonder Why feat. Scott Watson (Vocals) (mixed by 'Jampottt' Donnelly) drummer don't miss do he Posted 6 months ago 6 months on Sometimes I Wonder Why feat. Scott Watson (Vocals) (mixed by 'Jampottt' Donnelly)
nice sound. that guitar gives me nostalgia Posted 6 months ago 6 months
on From the inside out
guitar is slaying rn Posted 6 months ago 6 months
on Memoirs Of A Future Boy
tigght sytnh Posted 6 months ago 6 months
on Memoirs Of A Future Boy
powerful track jim Posted 6 months ago 6 months
on Mellow Me
psychaaa Posted 6 months ago 6 months
on We Remember Sheryl killer page conover Posted 6 months ago 6 months
on When You Love Someone (Patersongs/Conover)
it's like breathing canadian air Posted 6 months ago 6 months
on When You Love Someone (Patersongs/Conover) incredibly fresh sound. perfect blend of so many great styles Posted 6 months ago 6 months
on Pass It On conover/Cedar
and the guitar really evokes a lot of emotion in me Posted 6 months ago 6 months
on Pass It On conover/Cedar
the vocals cuts the mix so nicely Posted 6 months ago 6 months
on TWOBOB !!!! Start It Up 2017 Feat Tracey Cracknell
nice Posted 6 months ago 6 months
on TWOBOB !!!! Start It Up 2017 Feat Tracey Cracknell
sick vocal fx Posted 6 months ago 6 months on We're Interconnected - Bell, Farr and Cracknell
: ) Posted 6 months ago 6 months on We're Interconnected - Bell, Farr and Cracknell
great stuff Posted 6 months ago 6 months on We're Interconnected - Bell, Farr and Cracknell
this is absolutely beautiful Posted 6 months ago 6 months
on STATIC
awesome work! Posted 6 months ago 6 months
on Brainwashed
mad Posted 6 months ago 6 months
on Brainwashed
raw as fuck Posted 6 months ago 6 months on greWVeeland demo (feat. CODENAME : CATATONIC)
sick! Posted 6 months ago 6 months
on You're NOT The Only One Here!
threatz Posted 6 months ago 6 months
on nite
j00p squad Posted 6 months ago 6 months
on icarus.
good little ol yung aido Posted 6 months ago 6 months
on comeagainn
a Posted 6 months ago 6 months
on comeagainn
maaaan damn Posted 6 months ago 6 months on comeagainn
damn man Posted 6 months ago 6 months
on I Miss You
puddles Posted 6 months ago 6 months
on I Miss You
whiffy Posted 6 months ago 6 months
on Flaaack
dude Posted 6 months ago 6 months
on Flaaack this what it sounds like when someone's soul gettin stole Posted 6 months ago 6 months
on Flaaack
yoink Posted 6 months ago 6 months on drifting
oh my <3 Posted 6 months ago 6 months
on drifting
beatmachinearon Posted 6 months ago 6 months
on all 4 u
spectacular Posted 6 months ago 6 months
on all 4 u
mhm Posted 6 months ago 6 months
on all 4 u
janet's made of 65% sass Posted 6 months ago 6 months
on all 4 u bassline like nice big round buttcheeks Posted 6 months ago 6 months on all 4 u
cotton candy surfin Posted 6 months ago 6 months
on Tibe - Discovery
invigorating stuff right here Posted 6 months ago 6 months
on Tibe - Discovery
insane in the membrane lol Posted 6 months ago 6 months
on SALT (w/ wax god)
i just caught a cold Posted 6 months ago 6 months
on Aitai
&o& Posted 6 months ago 6 months on Free Room (feat. Appleby) (3lo Remix)
mighty fine Posted 6 months ago 6 months on Free Room (feat. Appleby) (3lo Remix) damn 3lo Posted 6 months ago 6 months
on Abelation - Mr. Malware
gang Posted 6 months ago 6 months
on Abelation - Mr. Malware
sexy tune buddy Posted 6 months ago 6 months on you kno thats just in my miiiind r2
casting that rod fm Posted 6 months ago 6 months
on I'M THE REAL YOUNG MAN
layzervihzuhn Posted 6 months ago 6 months
on I'M THE REAL YOUNG MAN
this raw Posted 6 months ago 6 months
on Yume Ato Yume (䄬䄬) yesss that's the rhythmmmmm Posted 6 months ago 6 months
on girlfriend
magnifico Posted 6 months ago 6 months
on girlfriend
u carryin them feels Posted 6 months ago 6 months
on 15LUV Ft. Leven Kali
me likey Posted 6 months ago 6 months
on s. lyre - air (slacker remix)
gorgeous production Posted 6 months ago 6 months
on the sculptor this is the next level guys. everyone always says it but we are now experiencing what it actually is Posted 6 months ago 6 months
on Needed U damn this is fung sway Posted 6 months ago 6 months
on aloha juice & simon eng - runitup
thugd out Posted 6 months ago 6 months
on Give It To Me
fantastic Posted 6 months ago 6 months
on LUCiD
fanccccccccy Posted 6 months ago 6 months
on We Did It!
nicely done Posted 6 months ago 6 months
on Glass Arrowhead - Athene
frothy Posted 6 months ago 6 months
on hiccup you can't just fuck with everybody like this homie. we know you've got the talent and understanding to drop shit like this on us like it's nothing, but god damn dude. give someone else a chance lmaoo Posted 6 months ago 6 months
on Callll Me (Feat. Charlie Mburaki)
tells a good story Posted 6 months ago 6 months
on kitten blues
this is ill Posted 6 months ago 6 months
on PHANTAXY
tonic Posted 6 months ago 6 months
on Vibrations Mix [Vol. 2]
righteous Posted 6 months ago 6 months
on Lossio - δample 1
smooth Posted 6 months ago 6 months
on Lossio - Y.A. good shit. really vibing to your page rn Posted 6 months ago 6 months
on Voduz - Caramel
voduz a damn killa Posted 6 months ago 6 months
on LYKOS - L i l w a t e r h a v e n
love this one Posted 6 months ago 6 months on Cashmere Cat - With Me (Ash Flexem Remix)
sick! Posted 6 months ago 6 months
on Drippy Dungeon
tons of energy bursting from the seams Posted 6 months ago 6 months
on missed calls
this is perf Posted 6 months ago 6 months
on Alpha wow that just stol me soul Posted 6 months ago 6 months
on sleepy head
wowza Posted 6 months ago 6 months
on lately
damn boy Posted 6 months ago 6 months
on Abduction w/ Alexander Lewis
whoa this deep Posted 6 months ago 6 months
on LOOKAMA WRIS
brooooo000000øøøø calm down Posted 6 months ago 6 months on Ryan Hemsworth - Holy (ft. RYAN Playground & swim good now)
awesome Posted 6 months ago 6 months
on More Colors (feat. Chelsea Cutler)
sick percussion Posted 6 months ago 6 months
on adderall (OUT NOW ON APPLE MUSIC, SPOTIFY, TIDAL)
slammmmmin Posted 6 months ago 6 months
on Shorty ft. Park. (p.young taylor)
mad smooth. cool feeling Posted 6 months ago 6 months
on breathe
nice 1 tregooo Posted 6 months ago 6 months
on kolada - emblem
koooolaaaadaaaaa Posted 6 months ago 6 months
on lavender w/ hadiya george
this is funky Posted 6 months ago 6 months on Lewis Cancut - Ice Cream & Asphalt (Amy Axegale Remix)
pump Posted 6 months ago 6 months
on Never Again (feat. Grand Khai)
ice cool Posted 6 months ago 6 months
on Tarro x PLVTINUM - Champagne & Sunshine
this is large Posted 6 months ago 6 months
on sh?m - i just (grapes reno)
fine work Posted 6 months ago 6 months on Sofi de la Torre ft. blackbear - Flex Your Way Out (BASECAMP Remix)
awesome Posted 6 months ago 6 months
on sunrise
maaaan these are the right frequencies Posted 6 months ago 6 months
on temper
oh my Posted 6 months ago 6 months
on KÆMP - béton brut
zonked Posted 6 months ago 6 months
on 6,000,000 Woolong
e m e r g e n c y Posted 6 months ago 6 months
on 6,000,000 Woolong
sick! Posted 6 months ago 6 months
on Rascal Drumkit 4 / 50% OFF
legend Posted 6 months ago 6 months
on crame
good shit friend Posted 7 months ago 7 months
on ◽ ◽ ◽ ◽ ◽ ◽ ◽ ◽ ◽ <3<3<3 Posted 7 months ago 7 months
on Over wow this is fresher than chick fil a lemonade Posted 7 months ago 7 months
on Killing Roses
fluid movement Posted 7 months ago 7 months
on San Holo- We Rise (grinless bootleg)
dumb huge Posted 7 months ago 7 months
on Shelter (vocal cover)
my oh my Posted 7 months ago 7 months
on yugi boi ~ Querida (cheguei)
fire Posted 7 months ago 7 months
on yugi boi ~ Querida (cheguei)
tbh i'm all about this baille funk craze Posted 7 months ago 7 months
on SLEEPY EYEZZ
bruh somebody call a damn doctaahh Posted 7 months ago 7 months on Fox Stevenson & Curbi - Hoohah (VIP Edit)[OUT NOW]
very clean Posted 7 months ago 7 months on Fox Stevenson & Curbi - Hoohah (VIP Edit)[OUT NOW]
daaaaang Posted 7 months ago 7 months
on Bitter ( Ft. Strngr & Mike Relm )
super sweet Posted 7 months ago 7 months
on wack
damn herzy Posted 7 months ago 7 months
on Ontheinternet ҝҞҦҨ
great work Posted 7 months ago 7 months
on toto
authentic Posted 7 months ago 7 months
on Lilac
beautiful Posted 7 months ago 7 months on Excited Ft. Omarion
snare tite Posted 7 months ago 7 months
on Ishiki(demo)
got the heat Posted 7 months ago 7 months
on Ishiki(demo)
pizzaz Posted 7 months ago 7 months
on Ishiki(demo)
domo Posted 7 months ago 7 months on Swtrwthr - If You Need people are making some insane shit nowadays wtf Posted 7 months ago 7 months
on chester watson- old pictures (verzache remix)
spookin me with them chords Posted 7 months ago 7 months
on chester watson- old pictures (verzache remix)
verzachemane Posted 7 months ago 7 months
on worth
dude Posted 7 months ago 7 months
on gaws the great - snakeskin
gaws THE great Posted 7 months ago 7 months
on gaws the great - snakeskin
good god purity Posted 7 months ago 7 months on gaws the great - snakeskin
m o l l y w h o p a l l t h e m o t h e r f u c k e r s Posted 7 months ago 7 months
on gaws the great - snakeskin
i like it! Posted 7 months ago 7 months
on Daza - Pieces (ft. Broderick Jones)
can't go wrong Posted 7 months ago 7 months
on AJMW - Baghira
drive Posted 7 months ago 7 months
on AJMW - Baghira you gonna make me piss myself with this asmr shit Posted 7 months ago 7 months
on AJMW - Baghira
wangin spills Posted 7 months ago 7 months on google maps holiday outstanding composition, warming feel, absolutely wonderful Posted 7 months ago 7 months
on google maps holiday
phenomenal Posted 7 months ago 7 months
on google maps holiday
who the fuck are you man Posted 7 months ago 7 months
on RACER
this shit is too evil Posted 7 months ago 7 months
on RACER
knock knock it's satan's plumber Posted 7 months ago 7 months
on Honey
cybumpin Posted 7 months ago 7 months
on Huntly - Please holy shit Posted 7 months ago 7 months
on Huntly - Please
super fresh track! Posted 7 months ago 7 months
on Huntly - Please
niiiiice~ Posted 7 months ago 7 months
on Huntly - Please
oh man this is tight Posted 7 months ago 7 months
on does it have to be
@user-797781815: appreciate that man Posted 7 months ago 7 months
on Indoors
wonderful Posted 7 months ago 7 months
on Losing Myself bro you're something else Posted 7 months ago 7 months
on Silent Need
most chill thing i've heard in a while Posted 7 months ago 7 months
on Trivial Motion
great great great Posted 7 months ago 7 months
on Daydreaming
i'm lost in this Posted 7 months ago 7 months on Nova, MadBliss, Krs. & Dutchboy ~ Wish Pt. II
rolling Posted 7 months ago 7 months on Black Atlass - Tonight (High Klassified Remix)
my oh my this shit is rude Posted 7 months ago 7 months
on Turn Me Down
instant hit Posted 7 months ago 7 months
on No limits
super chill Posted 7 months ago 7 months
on waiting
samsin Posted 7 months ago 7 months on Fais - Hey (Lulleaux & Jengi Beats Remix)
sick stuff Posted 7 months ago 7 months
on indigo
bluuuuu Posted 7 months ago 7 months
on knyvez x yung frankenstein - Zurna
keep it up you guys Posted 7 months ago 7 months
on do you still..
good shit Posted 7 months ago 7 months
on Sumthin Sumthin & Lemay - Buck
tight as fuck Posted 7 months ago 7 months
on Sumthin Sumthin & Lemay - Buck
here we goo Posted 7 months ago 7 months on DBLCRSS - Young Moses ft. LEO. (SLEEPYCATT Remix)
c l u b Posted 7 months ago 7 months
on kys (prod. by medasin)
wow Posted 7 months ago 7 months
on AObeats x Madi - Spicy Mustard
loved this Posted 7 months ago 7 months
on Sqz Me - We (Yokaze remix)
dude Posted 7 months ago 7 months on Sqz Me - We (Yokaze remix)
bruuu Posted 7 months ago 7 months
on Sqz Me - We (Yokaze remix)
danger overload flood Posted 7 months ago 7 months on Steve James - In My Head (ft. RKCB) ~Kwon Flip~
nice tune boyo Posted 7 months ago 7 months
on
nicely put Posted 7 months ago 7 months
on LUUDE - Sooo
wicked Posted 7 months ago 7 months
on LUUDE - Sooo
oh bruh this nasty Posted 7 months ago 7 months on 01 She is from rock "ella es de rock"(METALIZADO)(Free download)
@user-994052754: puts skin on your bones Posted 7 months ago 7 months
on dead and beat
@user-994052754: i appreciate the kind words Posted 7 months ago 7 months
on does it have to be
@user-994052754: thank you so much! Posted 7 months ago 7 months
on worn out
@dominiquefrench: thank you! Posted 7 months ago 7 months
on does it have to be
@user-800592170-309779435: thanks friend Posted 7 months ago 7 months
on does it have to be
@liniror: appreciate that! Posted 7 months ago 7 months on Zambezi River
it's like a magical adventure Posted 7 months ago 7 months
on Zambezi River
tight beat. my whole body is bobbing Posted 7 months ago 7 months
on Zambezi River what an interesting combination of sounds Posted 7 months ago 7 months
on Come On
flames Posted 7 months ago 7 months
on SKYLINE
fire fire fire Posted 7 months ago 7 months
on SKYLINE
ohhh mystical! Posted 7 months ago 7 months
on 17 JUSTICIA (METALIZADO)(Free download) headmadeofmetallllll Posted 7 months ago 7 months on 01 She is from rock "ella es de rock"(METALIZADO)(Free download)
eatin nails for breakfast type tune Posted 7 months ago 7 months on 01 She is from rock "ella es de rock"(METALIZADO)(Free download)
get that grunge boyy Posted 7 months ago 7 months
on Our Time /collab Remix \.../
power Posted 7 months ago 7 months
on Mountain home
dark feel. i like Posted 7 months ago 7 months
on Mountain home
experiential Posted 7 months ago 7 months
on worn out @user-28285061: thanks man! i don't think i'm using any brass instruments in this track Posted 7 months ago 7 months
on Winter Blues (Vocals by Vocalatti & Ver2xif. Musical backing by Jamie Rhind & Tom Adams.
yeah ver2xif $$$ Posted 7 months ago 7 months
on Winter Blues (Vocals by Vocalatti & Ver2xif. Musical backing by Jamie Rhind & Tom Adams.
can't forget tom adams! they're killin Posted 7 months ago 7 months
on Winter Blues (Vocals by Vocalatti & Ver2xif. Musical backing by Jamie Rhind & Tom Adams.
love it! great work jamie rhind too! Posted 7 months ago 7 months
on Das vida a mi ciudad (2nd solo by Paco Ray)
still can't get over how great this is Posted 7 months ago 7 months
on MUSICAL THERAPY 7-3-16 (Instrumental Produced by: Soul Muzick)
this is right on point Posted 7 months ago 7 months on THINKING(falling leaves)9-25-16 {Instrumental Produced by: Derek James}
<3<3 Posted 7 months ago 7 months
on THINKING(falling leaves)9-25-16 {Instrumental Produced by: Derek James}
i like your style dominiquefrench Posted 7 months ago 7 months on Holiday Today (12-4-16)Instrumental Produced by: Diddymousedid (from Tokyo, Japan)
harmonies are sick Posted 7 months ago 7 months on Holiday Today (12-4-16)Instrumental Produced by: Diddymousedid (from Tokyo, Japan)
awesome Posted 7 months ago 7 months on Holiday Today (12-4-16)Instrumental Produced by: Diddymousedid (from Tokyo, Japan)
such a unique feel. from the vocals to the beat Posted 7 months ago 7 months on Holiday Today (12-4-16)Instrumental Produced by: Diddymousedid (from Tokyo, Japan) this is one of the coolest things i've heard in a while Posted 7 months ago 7 months
on Dinosaur - original demo
i like the style Posted 7 months ago 7 months
on We're All Human (click title for lyrics)
i can roll to this Posted 7 months ago 7 months
on We're All Human (click title for lyrics)
nice Posted 7 months ago 7 months
on We're All Human (click title for lyrics)
boy we zoomin aint we Posted 7 months ago 7 months
on CAN'T MEASURE(Prod & Mastered by DJ KOOLBREEZE)
#truth Posted 7 months ago 7 months
on CAN'T MEASURE(Prod & Mastered by DJ KOOLBREEZE) this sounds fantastic \ Posted 7 months ago 7 months
on GROUND ZERO (Freestyle) DJ Nephi MIx
sweet Posted 7 months ago 7 months
on GROUND ZERO (Freestyle) DJ Nephi MIx
i'm laxed Posted 7 months ago 7 months on GET UP AND WIN (Rado Music + A.d.i Trash & The Can)
sick Posted 7 months ago 7 months on GET UP AND WIN (Rado Music + A.d.i Trash & The Can)
awesome tune! Posted 7 months ago 7 months on GET UP AND WIN (Rado Music + A.d.i Trash & The Can)
got that lore passing voice Posted 7 months ago 7 months on GET UP AND WIN (Rado Music + A.d.i Trash & The Can) sweet riff Posted 7 months ago 7 months
on rock castle
flamin strings Posted 7 months ago 7 months
on stranger
percussion has a hold on me already, but then you add this?? holy cow Posted 7 months ago 7 months
on stranger
awesome intro!! Posted 7 months ago 7 months
on My Wife's Dog
i love my dogs Posted 7 months ago 7 months
on Hoopin' this is pretty sick. you inspired me to try something similar Posted 7 months ago 7 months
on We Are Here we are here Posted 7 months ago 7 months
on Revolution
real talk Posted 7 months ago 7 months
on Revolution
sick lead in Posted 7 months ago 7 months
on A Torn Page
telling me a story of triumph Posted 7 months ago 7 months
on A Torn Page
sinister guitarwork Posted 7 months ago 7 months
on A Flavored Life
great relaxed feeel Posted 7 months ago 7 months
on A Flavored Life damn bro vern peterka's house is groovin Posted 7 months ago 7 months on phantom's theme-Phantom of the paradise. Paul Williams (cover)
guitar sounds great!!! Posted 7 months ago 7 months on CIACCO-Exercice vocal sur The Great Gig in the Sky (Pink Floyd)
<3<3<3<3 Posted 7 months ago 7 months
on nessly - never knew (prod nessly & take a daytrip)
this is piping hot Posted 7 months ago 7 months
on Realize (ft. BLANDA)
yall both killas Posted 7 months ago 7 months
on Realize (ft. BLANDA)
thanks for free dl Posted 7 months ago 7 months
on Realize (ft. BLANDA)
i would have never expected this to be so good Posted 7 months ago 7 months
on ◽ ◽ ◽ ◽ ◽ ◽ ◽ ◽ ◽
man i love this song Posted 7 months ago 7 months
on thunder6 drumkit + ableton project https://sellfy.com/p/LAHp/
@oylo: /wicked /wild /wet Posted 7 months ago 7 months
on Andrew Luce - Loyalty
sample game incredulous Posted 7 months ago 7 months
on Andrew Luce - Loyalty
gorgeous Posted 7 months ago 7 months
on CIACCO/Be another - Near Lisboa
great sound. the composition is fantastic Posted 7 months ago 7 months
on Trial cover Bring him home Les Mis keep it up! good stuff Posted 7 months ago 7 months
on 'Singing a little country'My Original.
glissando got me like ºoº Posted 7 months ago 7 months
on 'Singing a little country'My Original.
love the grace notes! Posted 7 months ago 7 months
on cosmo's midnight - phantasm (mirai redo)
ice castle scenery Posted 7 months ago 7 months on ...e veil that has blinded me is being lifted from m...
rad Posted 7 months ago 7 months
on idfc
tight Posted 7 months ago 7 months
on idfc
awesome feel Posted 7 months ago 7 months
on MADBLISS KIT 2 50% OFF!!!!!
buy this kit Posted 7 months ago 7 months
on MADBLISS KIT 2 50% OFF!!!!!
dumb Posted 7 months ago 7 months
on MADBLISS KIT 2 50% OFF!!!!!
always slam my face on the ground Posted 7 months ago 7 months
on MADBLISS KIT 2 50% OFF!!!!!
goodness mother fucking gracious Posted 7 months ago 7 months on "Another Melody For James Bond "(classical style)composed by LINIR OR
nice and smooth Posted 7 months ago 7 months
on "Grandfather Of Pink Panther" composed by LINIR OR
interesting Posted 7 months ago 7 months on "Grandfather Of Pink Panther" composed by LINIR OR
killer drums Posted 7 months ago 7 months on "Grandfather Of Pink Panther" composed by LINIR OR
i feel like i'm about to fight a boss Posted 7 months ago 7 months on "Grandfather Of Pink Panther" composed by LINIR OR
these rolls are dope af Posted 7 months ago 7 months
on Nekolye x west1ne - Ayy
monsta Posted 7 months ago 7 months
on Nekolye x west1ne - Ayy
sweet dreams bitch Posted 7 months ago 7 months
on Nekolye x west1ne - Ayy
yooooooooooo this is wild Posted 7 months ago 7 months
on Fauna
breh Posted 7 months ago 7 months
on Overthinking
inventive Posted 7 months ago 7 months
on Rituals
this is hard as fuck Posted 7 months ago 7 months
on dead and beat
@hatemysurname: <3 Posted 7 months ago 7 months
on Lift You Up
serene Posted 7 months ago 7 months
on Rose
ancient artifact Posted 7 months ago 7 months on DILLON FRANCIS - ANYWHERE (LUCA LUSH REMIX) just when you think the synths couldn't get bigger Posted 7 months ago 7 months
on lost you
on lost you
damn son where'd you find this Posted 7 months ago 7 months
on 2ToneDisco - U & Me (Ft. BB Teeth)
nice Posted 7 months ago 7 months
on 2ToneDisco - U & Me (Ft. BB Teeth)
this tune got me fallin deep 2breal Posted 7 months ago 7 months
on Last Night On Earth
intensity Posted 7 months ago 7 months on throw your chains off
damn carmocko Posted 7 months ago 7 months
on throw your chains off
shackles begone Posted 7 months ago 7 months
on Bones (Insturmental)
bruh Posted 7 months ago 7 months
on The Inevitable Void
countdown to showdown town Posted 7 months ago 7 months
on jam 2411
industrial ad Posted 7 months ago 7 months on Schizo - PostBlocked (prod. $UICIDEBOY$)
raw Posted 7 months ago 7 months on if i fall, will you catch me?
gettin saucy Posted 7 months ago 7 months
on when beauty is broken.
sick Posted 7 months ago 7 months
on Grey Killer - Breath
gang Posted 7 months ago 7 months
on i know how it ends
@whylucid: butter Posted 7 months ago 7 months
on We See We (prod. EphRem)
incredible Posted 7 months ago 7 months
on We See We (prod. EphRem) this track has me questioning myself Posted 7 months ago 7 months
on We See We (prod. EphRem) count me in Posted 7 months ago 7 months on WIZE - the code (prod. by ghosttown)
this beat is disgusssssting Posted 7 months ago 7 months on WIZE - the code (prod. by ghosttown)
my ears need to catch a breath Posted 7 months ago 7 months on WIZE - the code (prod. by ghosttown)
wow Posted 7 months ago 7 months
on Come Up
tight Posted 7 months ago 7 months
on 3:33
whoppin Posted 7 months ago 7 months
on brtrnd - no doubt no doubt Posted 7 months ago 7 months
on brtrnd - no doubt
unique tunes hard to come by Posted 7 months ago 7 months on MEMBA - Heat of the Moment (feat. GIIA & Hoosh)
good stuff Posted 7 months ago 7 months on MEMBA - Heat of the Moment (feat. GIIA & Hoosh)
awesome feel! Posted 7 months ago 7 months
on Ways (prod. Dez Wright)
sick ride Posted 7 months ago 7 months
on No Mercy (Thanks For 10k~)
got me in a trance Posted 7 months ago 7 months
on No Mercy (Thanks For 10k~)
trippy Posted 7 months ago 7 months
on Long Live Zill.
waterfalldistortion Posted 7 months ago 7 months on Right Now (Ft. Kasey Jones) (Prod. by Rashad Stark)
bruh Posted 7 months ago 7 months
on Hex Cougar - How Does It Feel
flaming Posted 7 months ago 7 months
on Son-J - Merge (JADŪ024)
saw it up Posted 7 months ago 7 months on VOKT - The Last Rites [OUT NOW ON CROWSNEST]
my brain is melting Posted 7 months ago 7 months
on DANYAL - Changes
fantastic Posted 7 months ago 7 months
on estelle
thanks again sorry Posted 7 months ago 7 months
on estelle
aight Posted 7 months ago 7 months
on estelle
not this song, but american boy Posted 7 months ago 7 months
on estelle i wanted to cover this song but it never happened Posted 7 months ago 7 months
on estelle
thank you Posted 7 months ago 7 months
on estelle
thx Posted 7 months ago 7 months on estelle
omg i can't breathe bring it back pls Posted 7 months ago 7 months
on estelle i feel like my heart started beating to these kicks Posted 7 months ago 7 months
on estelle
wow soundcloud is lit as fuck today Posted 7 months ago 7 months
on zack villere - 500 days
in it Posted 7 months ago 7 months
on conflicted (w/ gryfon)
@whyuma: is good bruh don't front Posted 7 months ago 7 months
on zack villere - 500 days
the transition Posted 7 months ago 7 months on conflicted (w/ gryfon) xXx tr4pm4st3r9001 xXx slingin that angel dust Posted 7 months ago 7 months
on conflicted (w/ gryfon)
omfg dog Posted 7 months ago 7 months
on conflicted (w/ gryfon)
watch your profanity Posted 7 months ago 7 months
on conflicted (w/ gryfon)
good lord Posted 7 months ago 7 months
on conflicted (w/ gryfon)
haunted ass shit Posted 7 months ago 7 months
on legend (w/ kāren)
spankin Posted 7 months ago 7 months on NRK Shonen, "Not Today" (Prod. @instupendo & @itsgoodintent)
@whyuma: y y y y y y y y y yuma Posted 7 months ago 7 months
on Head In The Clouds
super chill Posted 7 months ago 7 months
on Days/Marvin's Room (feat. Good Intent & Chindamo)
hell yeah Posted 7 months ago 7 months
on Glass half empty? Get your fill with Insecuritea.
i didn't know there were podcasts on soundcloud Posted 7 months ago 7 months
on morla hills
wow Posted 7 months ago 7 months
on morla hills
yooooo Posted 7 months ago 7 months
on morla hills man i am enjoying Posted 7 months ago 7 months
on Samplified - Haze Sample Pack (Free Download)
these percs are messing with my head Posted 7 months ago 7 months
on ghosts
insta dl Posted 7 months ago 7 months
on worn out
@xxsebastionxjennaxx: i get kissed by the love of my life every day nigga Posted 7 months ago 7 months
on Esta - 1738 (Evil Needle Remix)
awesome feel Posted 7 months ago 7 months
on Himmel - Disconnect
tight!! Posted 7 months ago 7 months
on Giorgio Oehlers - New Times (Week 1) fantastic piece of work Posted 7 months ago 7 months
on simon eng - oh
soothed Posted 7 months ago 7 months
on Tibe - Tantivity
wowzah Posted 7 months ago 7 months
on The Meaning Doesn't Matter
absolutely beautiful Posted 7 months ago 7 months
on The Meaning Doesn't Matter
bro this is magical Posted 7 months ago 7 months
on Stay Calm (Prod. DillMatic)
sick Posted 7 months ago 7 months on RNDYSVGE - Inthemorning (feat. Naji) <3<3<3 Posted 7 months ago 7 months
on RNDYSVGE - Inthemorning (feat. Naji)
@user-116879811: i anm also 21 yaros ld and very hand some sad boi Posted 7 months ago 7 months
on RNDYSVGE - Inthemorning (feat. Naji)
@user-116879811: whoa! awesome! can't wait to get to know you clairegriffen19 Posted 7 months ago 7 months
on RNDYSVGE - Inthemorning (feat. Naji)
@oylo: 4ever Posted 7 months ago 7 months
on RNDYSVGE - Inthemorning (feat. Naji)
this shit always bangs Posted 7 months ago 7 months
on RNDYSVGE - Inthemorning (feat. Naji)
w h a t i n t h e w o r l d Posted 7 months ago 7 months
on Pathologic (Thanks for 4K) yooo Posted 7 months ago 7 months
on Pathologic (Thanks for 4K)
make us turn up the volume then murder us Posted 7 months ago 7 months
on Ravyn Lenae - Free Room (More//Night Remix)
syncopation porn Posted 7 months ago 7 months
on Ravyn Lenae - Free Room (More//Night Remix)
love hearing fresh waves Posted 7 months ago 7 months
on Fukurō (Feat. Jåmvvis)
dope shit Posted 7 months ago 7 months on Boombox Cartel & QUIX - Supernatural (Keenan Mathias Remix)
boyyyyyyyyyy Posted 7 months ago 7 months
on Woods love this tune Posted 7 months ago 7 months
on 䌏䜐ፘಋ
saitooooo Posted 7 months ago 7 months
on Calvin and Ellie are sitting outside
mmm Posted 7 months ago 7 months
on Nature
great work man Posted 7 months ago 7 months
on տ͚͵͚ҁαЀφϕ҂
damn bruh you got that emotion Posted 7 months ago 7 months
on Cristal al Sol
nice one fam Posted 7 months ago 7 months on Supernatural (Dominik Dale Remix) *FREE DOWNLOAD* great vibe Posted 7 months ago 7 months on Supernatural (Dominik Dale Remix) *FREE DOWNLOAD*
the cuts are prime Posted 7 months ago 7 months
on Fly
jazzy Posted 7 months ago 7 months
on Late Night Company
lovely Posted 7 months ago 7 months
on HYPR045 Koloah - Back On Track Teaser (OUT NOW)
whoa Posted 7 months ago 7 months
on Trap Ballad (Prod. by Da-P)
good stuff Posted 7 months ago 7 months
on HYPR045 Koloah - Back On Track Teaser (OUT NOW)
pretty tight Posted 7 months ago 7 months
on beacon
mud Posted 7 months ago 7 months on Wize - Quarters (More//Night Remix)
bruhh Posted 7 months ago 7 months
on name that shit
mad Posted 7 months ago 7 months
on Mighty Atlas - D-503 (OUT NOW!)
wicked Posted 7 months ago 7 months
on Mighty Atlas - D-503 (OUT NOW!)
hubba hubba Posted 7 months ago 7 months
on Memory Drought
very fluid. moving nicely Posted 7 months ago 7 months
on acid dream
sick, snares Posted 7 months ago 7 months
on acid dream
spectacular storytelling feel Posted 7 months ago 7 months on ♅ GRISFX ♅ x ~SAGE HITOMI~ - i c e d s o u l s
money bounce Posted 7 months ago 7 months on ♅ GRISFX ♅ x ~SAGE HITOMI~ - i c e d s o u l s
wave Posted 7 months ago 7 months
on What You Need (feat. NÏKA)
love those vox! Posted 7 months ago 7 months
on What You Need (feat. NÏKA)
(o.o) Posted 7 months ago 7 months on Kehlani - Gangsta (Shisto Flip)
fucking sling that dirt Posted 7 months ago 7 months
on Kehlani - Gangsta (Shisto Flip) omg that lo-fi radio/sonar beep really tickles my fancy Posted 7 months ago 7 months
on Kehlani - Gangsta (Shisto Flip)
sprung Posted 7 months ago 7 months
on m-cubed - wednesday
wow! Posted 7 months ago 7 months
on SURF - ON GO (PROD. EERA)
this track always hard Posted 7 months ago 7 months
on SURF - ON GO (PROD. EERA)
you spookin me Posted 7 months ago 7 months on The Things I Felt
sick Posted 7 months ago 7 months
on The Things I Felt
fling them 808s boy Posted 7 months ago 7 months
on Transit good fuckin god that bass is mollywhoppin Posted 7 months ago 7 months
on syllabus day
i love you Posted 7 months ago 7 months
on page me w/ gaws
is that a jinjo????!??!!?!?!!?!?!????!¿¿⁄¿⁄ Posted 7 months ago 7 months
on page me w/ gaws
...... is this even real Posted 7 months ago 7 months on page me w/ gaws
this is super tight! awesome intro Posted 7 months ago 7 months
on Breakfast
killing it man. keep it up! Posted 7 months ago 7 months
on ride.
tweet tweet tweet tweet Posted 7 months ago 7 months
on hatural nigh
wonderful tune Posted 7 months ago 7 months
on jump
heavy Posted 7 months ago 7 months
on Miss You
this is what i like to hear Posted 7 months ago 7 months on This Mornin' - AUFL+CHE$$+CRESCE pan lyfe Posted 7 months ago 7 months on All In The Same (Produced by Cresce)
$$$ Posted 7 months ago 7 months
on Mo Vibez - All Day
spankin Posted 7 months ago 7 months
on CHROME - Dodecahedron
@chromenoise: dw i'm great Posted 7 months ago 7 months
on Myro - Talk To Me [Out Now]
str8 dub Posted 7 months ago 7 months
on Get it - Falcxne(Slomdug Edit)
fire Posted 7 months ago 7 months
on Get it - Falcxne(Slomdug Edit) wowza Posted 7 months ago 7 months
on New Ferrari (Prod by. meltycanon)
bouncy Posted 7 months ago 7 months
on How to ruin a great song in just 10 seconds
loooooooooool Posted 7 months ago 7 months
on Deep Instrumental Loop [Produced by Yorel]
bassline is deep sex Posted 7 months ago 7 months
on Deep Instrumental Loop [Produced by Yorel]
wow~ Posted 7 months ago 7 months
on first of all
spookt Posted 7 months ago 7 months on Adventure Club Ft ELEA - Dreams (TWO OWLS X Fransis Derelle Remix) powerchargebrehhh Posted 7 months ago 7 months
on CHROME - Dodecahedron
just lost feeling in my spine Posted 7 months ago 7 months
on CHROME - Dodecahedron
i think i just went blind Posted 7 months ago 7 months
on MKSB x Soulstruck - Messy Bed
fresh Posted 7 months ago 7 months on Promise (w/ adustio) - STU DRUMKIT VOL 2 - https://sellfy.com/p/ DUej/
dunkin Posted 7 months ago 7 months
on Eastside ft. SistaStrings
what a beauty Posted 7 months ago 7 months
on U Name It Challenge (REMIX) slammmm Posted 7 months ago 7 months
on she's in my dreams
&o& Posted 7 months ago 7 months on Clockvice, Traxell, Flukeluke, Outlit & Covex - Sanctum
this is evil Posted 7 months ago 7 months
on Joey Rumble & Our Psych - Assassin [ft. Stevyn]
movinggg Posted 7 months ago 7 months
on morrissey
tight Posted 7 months ago 7 months
on worn out
@paullutz: i'm crusty Posted 7 months ago 7 months
on worn out
@steeziakbeats: <3<3 st33333z Posted 7 months ago 7 months
on worn out
@liniror: thank you! Posted 7 months ago 7 months
on worn out
@iamrellim: appreciate that homie Posted 7 months ago 7 months
on Right Time Feat. Ari
phenomenal Posted 7 months ago 7 months
on Are My Memes Too Dank?
@noahand-angellive: hahah nahh Posted 7 months ago 7 months
on Maybe Sun - Lait Fraise
yussss Posted 8 months ago 8 months
on Maybe Sun - Lait Fraise
got yourself a follow maybe sun Posted 8 months ago 8 months
on PARTYNEXTDOOR - Wus Good - Curious [Saturn Remix]
nice job saturn Posted 8 months ago 8 months
on Maybe Sun - Pure
god daaamn @ @ this is great Posted 8 months ago 8 months
on gorilla/hoops
sickhop Posted 8 months ago 8 months
on My Thoughts (Prod. [ocean jams])
damn Posted 8 months ago 8 months on Boombox Cartel & QUIX feat. Anjulie - Supernatural (Cloudsz Remix)
damn bro this is naaaaasty Posted 8 months ago 8 months
on Bae
son this pure energy Posted 8 months ago 8 months
on Bae
woo! Posted 8 months ago 8 months
on What So Not - Divide & Conquer (LOLO BX Booty)
that was intense as fuck Posted 8 months ago 8 months on Here For ft. Tre Richmond & Gene Fisher (out on spotify now)
nice nice nice Posted 8 months ago 8 months
on day out
gulp Posted 8 months ago 8 months
on NI/NO - You Don't Understand
gorgeous! Posted 8 months ago 8 months
on SURF - ON GO (PROD. EERA)
soarin Posted 8 months ago 8 months on THE SAP IS IT
filthy Posted 8 months ago 8 months on Wantigga - Stonecold Ft. Sacha Vee (Pat Lok Remix)
<3 Posted 8 months ago 8 months on Wantigga - Stonecold Ft. Sacha Vee (Pat Lok Remix)
yo Posted 8 months ago 8 months on Wantigga - Stonecold Ft. Sacha Vee (Pat Lok Remix)
luv luv Posted 8 months ago 8 months
on Leander
bruh this is wicked Posted 8 months ago 8 months
on Leander
definition of Posted 8 months ago 8 months on Leander
that spread is funk Posted 8 months ago 8 months
on Foggy Shades
damn koolade. enjoying your stuff Posted 8 months ago 8 months
on Koolade - Avenue Feel
i am f e e l i n this Posted 8 months ago 8 months
on Koolade x Ben Bada Boom - Pay Me What You Owe Me
sick Posted 8 months ago 8 months on Anderson .Paak - Am I Wrong (Koolade Remix) Free DL
now this is sick Posted 8 months ago 8 months
on Jay Z - Dirt Off Your Shoulder (Smle & Jupe Remix)
: ) : ) Posted 8 months ago 8 months on J'Von x LAKIM - The Shade 2
tight Posted 8 months ago 8 months
on DROELOE - Bon Voyage
whoa Posted 8 months ago 8 months
on DROELOE - Bon Voyage
you've got a unique piece of work here Posted 8 months ago 8 months
on Glass Arrowhead - Anomaly i like the space you've put the different sounds in Posted 8 months ago 8 months
on RNDYSVGE - Inthemorning (feat. Naji)
groove grove guv Posted 8 months ago 8 months
on TXTRZ
wreckd Posted 8 months ago 8 months
on quitting great work man Posted 8 months ago 8 months
on quitting
heavy shit! Posted 8 months ago 8 months
on EBY - Shady Things
interesting Posted 8 months ago 8 months on zach farache - naive unprepared child [laxcity flip]
drum that ish bizzyoy Posted 8 months ago 8 months
on stillwaters
download pl0x! Posted 8 months ago 8 months
on seemslikeyesterday [8k]
such a fine little tight clap Posted 8 months ago 8 months
on seemslikeyesterday [8k] bruh Posted 8 months ago 8 months
on seemslikeyesterday [8k]
the vox melody is killllllling Posted 8 months ago 8 months on boombox cartel & quix - supernatural (feat. anjulie) >-sfam remix- <
my ears filthy Posted 8 months ago 8 months on boombox cartel & quix - supernatural (feat. anjulie) >-sfam remix- <
i need some q-tips Posted 8 months ago 8 months
on Hustlin
get da hussle Posted 8 months ago 8 months
on Vérité ~ Gesture (Vincent Flip)
xviiiiiiiiiiiiiii Posted 8 months ago 8 months
on Sensi Sye - don't be shy been a good minute since i heard this Posted 8 months ago 8 months
on For Us
real talk Posted 8 months ago 8 months
on For Us
damn... Posted 8 months ago 8 months
on jay z
go quicc Posted 8 months ago 8 months
on jay z the panning hats and the attack on that synth make for one trippy effect Posted 8 months ago 8 months
on jay z
real raunch Posted 8 months ago 8 months
on jay z charge up that chord bruh gluing gluing gluing Posted 8 months ago 8 months
on garden
plant Posted 8 months ago 8 months
on A Tribute To Autumn | Mix
s o a r i n g Posted 8 months ago 8 months
on Hazey very different sound. hard to come by nowadays Posted 8 months ago 8 months
on Worst Mood ft. Abbi Press
damn this is money tho Posted 8 months ago 8 months
on Worst Mood ft. Abbi Press
i'm a mother fucking star boyyyyy Posted 8 months ago 8 months
on Worst Mood ft. Abbi Press dooooooooooooooope Posted 8 months ago 8 months
on Shindig - New Friends
@purfakt: hello Posted 8 months ago 8 months
on Shindig - New Friends
wondrous Posted 8 months ago 8 months
on New Grime Test.3
hats fleekin dude Posted 8 months ago 8 months
on New Grime Test.3
testin da grime Posted 8 months ago 8 months
on energy
modded jerzz Posted 8 months ago 8 months
on energy bro the tallest 808 is just absolutely phenomenal Posted 8 months ago 8 months
on energy
you literally cannot go wrong with these chords Posted 8 months ago 8 months
on energy
the energy Posted 8 months ago 8 months
on Fukurō (Feat. Jåmvvis)
whoa yall Posted 8 months ago 8 months
on Fukurō (Feat. Jåmvvis)
got that dumpster monster bass Posted 8 months ago 8 months
on Fukurō (Feat. Jåmvvis)
classic feel Posted 8 months ago 8 months on Paper Route ft. Black Dave & Goldwood (prod. Max Gertler)
this is tight Posted 8 months ago 8 months
on Awae - Aube
@fred-paper: plastering links is a no-no homie. not listening to that Posted 8 months ago 8 months
on all yours
@ecvilla-1: i appreciate the kind words! Posted 8 months ago 8 months
on always on time
@groovy-coolies: thank you!! Posted 8 months ago 8 months
on dead and beat
@highfield-73234720: <3 Posted 8 months ago 8 months
on dead and beat
@mayadog: appreciate that! Posted 8 months ago 8 months
on woke
@tante-meli: thank you Posted 8 months ago 8 months
on Crazy (with Keith Griffin)
nice one Posted 8 months ago 8 months
on Crazy (with Keith Griffin)
tearing it up! Posted 8 months ago 8 months on Long Distance Love (Athen's Ohio band Hotcakes cover Lowell George/Little Feat)
mad swing Posted 8 months ago 8 months on Long Distance Love (Athen's Ohio band Hotcakes cover Lowell George/Little Feat)
lo-fidelity Posted 8 months ago 8 months
on Three Day Blow (Lyrics: John Eagle)
cool vibe my friend. i like it Posted 8 months ago 8 months
on Going Through A Phase
super tight Posted 8 months ago 8 months
on Going Through A Phase
fucking flaaaaame Posted 8 months ago 8 months
on Hookah Party Remix
this shit is fresh Posted 8 months ago 8 months
on Hookah Party Remix
whoooooooa Posted 8 months ago 8 months
on Rebirth 5:5
awesome drums. keep it up Posted 8 months ago 8 months on The End Of Time- (collaboration with Miranda Shvangiradze)
deep Posted 8 months ago 8 months on The End Of Time- (collaboration with Miranda Shvangiradze)
cool!! Posted 8 months ago 8 months on Tree House With A Swing (live home performance with youtube link)
very sweet. thank you Posted 8 months ago 8 months
on Space Freezes In My Soul
great melody Posted 8 months ago 8 months
on Space Freezes In My Soul
loving it Posted 8 months ago 8 months
on Paling
those bg vox are prime Posted 8 months ago 8 months
on Paling
sweet serenity Posted 8 months ago 8 months
on Paling
nice feel here Posted 8 months ago 8 months on Just A Little Man from" Rainy day lullaby" by Davor's Music
cool scatting Posted 8 months ago 8 months on Just A Little Man from" Rainy day lullaby" by Davor's Music
<3 the strings are amazing Posted 8 months ago 8 months
on "Sognando Lei" Matthias & Paolo
wonderful Posted 8 months ago 8 months
on "Sognando Lei" Matthias & Paolo
gorgeous composition homie Posted 8 months ago 8 months
on Exile
good shit guys Posted 8 months ago 8 months
on Down
you know it's good when your head bobbin deep Posted 8 months ago 8 months on Down
sick Posted 8 months ago 8 months
on CLIMB MOUNTAINS
incredible. 'm zoned Posted 8 months ago 8 months
on "My Last Country Song"
nice and slow Posted 8 months ago 8 months
on Dragonborn skyrim is such a fantastic game Posted 8 months ago 8 months
on Dragonborn
this is fantastic <3<3<3 Posted 8 months ago 8 months
on Dancer (lyrics L. Sherry)
<3 Posted 8 months ago 8 months on Dancer (lyrics L. Sherry) awesome vibe. perfect start to my morning Posted 8 months ago 8 months
on planet world
boy u got da funk i'm tellin' Posted 8 months ago 8 months
on planet world
extra terrestrial Posted 8 months ago 8 months
on Wet fart
breh this shit slammin Posted 8 months ago 8 months
on woke
@esemanolain-ruizzo: thank you! Posted 8 months ago 8 months
on Frank Ocean - Nights (Z W Edit)
are those backwards kicks? Posted 8 months ago 8 months on Frank Ocean - Nights (Z W Edit)
slick shit my man. this is real tight Posted 8 months ago 8 months
on woke
@fred-naa: appreciate it homie Posted 8 months ago 8 months
on dead and beat
@antonio-giuntella: thank you!! Posted 8 months ago 8 months
on Ecris-moi (French cover song)
lovely melody Posted 8 months ago 8 months
on Foreign affairs
where am i Posted 8 months ago 8 months on Under A Blue Moon (instrumental version)
strings are always a great addition Posted 8 months ago 8 months
on Famous last words the falling melody <3 oh man Posted 8 months ago 8 months
on Famous last words
these drums are legend Posted 8 months ago 8 months
on Famous last words
spooky intro. i like it Posted 8 months ago 8 months on Mirada Perdida Feat. Leo Andina
beautiful Posted 8 months ago 8 months
on Alquimia
real power behind that lead Posted 8 months ago 8 months
on Alquimia
sick Posted 8 months ago 8 months
on Alquimia this makes me smile Posted 8 months ago 8 months
on Berrak
this* Posted 8 months ago 8 months
on Berrak
i love htis Posted 8 months ago 8 months
on Berrak
mad groove my friend Posted 8 months ago 8 months
on Rain
happy days Posted 8 months ago 8 months
on Rain
killa killin it Posted 8 months ago 8 months on Ella huyó - She fled (with ProgRockDan1)
deep Posted 8 months ago 8 months
on Ella huyó - She fled (with ProgRockDan1)
such a fine assortment of instruments Posted 8 months ago 8 months on Das vida a mi ciudad (2nd solo by Paco Ray)
those background vocals are slaying Posted 8 months ago 8 months on Das vida a mi ciudad (2nd solo by Paco Ray)
fiery emotion Posted 8 months ago 8 months on Das vida a mi ciudad (2nd solo by Paco Ray)
goodness this is fantastic Posted 8 months ago 8 months on Das vida a mi ciudad (2nd solo by Paco Ray)
this atmosphere is gorgeous Posted 8 months ago 8 months on Das vida a mi ciudad (2nd solo by Paco Ray)
oh buddy here we goooo Posted 8 months ago 8 months
on I Don't Know You Anymore
<3<3<3 Posted 8 months ago 8 months
on Soften Out The Bones Of Time
trudgin on Posted 8 months ago 8 months
on Soften Out The Bones Of Time
nice chill vibe. good stuff Posted 8 months ago 8 months
on Revolt
so relaxing<3 Posted 8 months ago 8 months
on Revolt
this is incredible. great work hayter Posted 8 months ago 8 months
on residential representation
@liniror: thank you! i appreciate you listening!! Posted 8 months ago 8 months on De - Di - De - Do - Da - Dey (with saturday Jazzzz)
@mikebeachy: no problem! great stuff Posted 8 months ago 8 months
on always on time
@mikebeachy: thank you so much zdcom! Posted 8 months ago 8 months
on circus of freaks-demo 2
crazy sound <3 Posted 8 months ago 8 months
on circus of freaks-demo 2
neat Posted 8 months ago 8 months
on General Illusion Store T.M.
those plucks are sick Posted 8 months ago 8 months
on General Illusion Store T.M. you have some interesting ideas. i really like this Posted 8 months ago 8 months on TAKE-OFF & Théo.M
whoa Posted 8 months ago 8 months
on TAKE-OFF & Théo.M tight vox. really intense landscape Posted 8 months ago 8 months
on SOLAR SYSTEM & Théo.M
space guitar Posted 8 months ago 8 months
on SOLAR SYSTEM & Théo.M
there it isss Posted 8 months ago 8 months
on The Rain
chilling Posted 8 months ago 8 months
on Blue
solo is flaming!! Posted 8 months ago 8 months on Blue
the mix surrounds me Posted 8 months ago 8 months
on Blue
excellent Posted 8 months ago 8 months
on Waiting Cab ft Lewisland
loving this atmosphere Posted 8 months ago 8 months
on Vodka & Lemon
great vibe man Posted 8 months ago 8 months
on Lover For One Year (feat. Moni on Voc.)
great sound Posted 8 months ago 8 months
on Lover For One Year (feat. Moni on Voc.)
great work moni Posted 8 months ago 8 months on Days Of Pain (Instrumental, free download) thanks for the free download Posted 8 months ago 8 months
on Days Of Pain (Instrumental, free download)
slaying Posted 8 months ago 8 months
on Days Of Pain (Instrumental, free download)
incredible transition Posted 8 months ago 8 months
on Days Of Pain (Instrumental, free download)
bass is killin' too ain't even messin' Posted 8 months ago 8 months
on Days Of Pain (Instrumental, free download)
sick guitar Posted 8 months ago 8 months on "Beauty"(clarinet , E.guitar) composed by LINIR OR
four on the floorrrrrr Posted 8 months ago 8 months
on "Gangsters In A Vacation" composed by LINIR OR sinister Posted 8 months ago 8 months on "Gangsters In A Vacation" composed by LINIR OR
interesting track my friend Posted 8 months ago 8 months on De - Di - De - Do - Da - Dey (with saturday Jazzzz)
bass is mad funky Posted 8 months ago 8 months on De - Di - De - Do - Da - Dey (with saturday Jazzzz)
cool sound Posted 8 months ago 8 months on De - Di - De - Do - Da - Dey (with saturday Jazzzz)
sparkling composition homie Posted 8 months ago 8 months
on Sparring Guitars
great scott Posted 8 months ago 8 months
on Sparring Guitars
going innnn Posted 8 months ago 8 months
on Sparring Guitars
my oh my Posted 8 months ago 8 months
on Rainbow Love
relaxing Posted 8 months ago 8 months
on Rainbow Love
super mellow vibe Posted 8 months ago 8 months
on Spring Of 1980 bassline keeps carrying me along with the show Posted 8 months ago 8 months
on Spring Of 1980
my ears are melting Posted 8 months ago 8 months
on Spring Of 1980
that melody is literally fire Posted 8 months ago 8 months
on Leaving the Earth
awesome composition Posted 8 months ago 8 months
on Leaving the Earth
temple of light Posted 8 months ago 8 months
on Leaving the Earth
spot on title Posted 8 months ago 8 months
on ARTP In search of lost time
<3<3 Posted 8 months ago 8 months
on ARTP In search of lost time hi hats are mad slick my friend Posted 8 months ago 8 months
on ARTP In search of lost time
mysterious Posted 8 months ago 8 months on ARTP In search of lost time
take me on this journey Posted 8 months ago 8 months
on not real
what in the hell Posted 8 months ago 8 months on DEATHWISH 950 - BOOF BITCH (PROD. NBOME)
this is fucking sick Posted 8 months ago 8 months on DEATHWISH 950 - BOOF BITCH (PROD. NBOME)
hot hot hot!!! Posted 8 months ago 8 months
on Minus (Mini Tape)
take me home i'm scared Posted 8 months ago 8 months
on Minus (Mini Tape)
fucking sick shit bruv Posted 8 months ago 8 months on Thank You Blorp
@samzircon: L0L Posted 8 months ago 8 months
on Thank You Blorp
this just inspired me. thanks fam Posted 8 months ago 8 months
on gucci damn son way too chill for me. massaged all the earwax into a puddle in my ear. need some q-tips Posted 8 months ago 8 months
on dylan rieder
he's elevated Posted 8 months ago 8 months
on Blinded Hearts - Favorite ( On Chill Nation )
wowzaa Posted 8 months ago 8 months
on HYPE
pant shitting Posted 8 months ago 8 months on Kingpin
dope Posted 8 months ago 8 months
on Kingpin
bruh Posted 8 months ago 8 months on pls leave a message after the tone (feat. meltycanon)
softspoken drumkit Posted 8 months ago 8 months
on two cops on a milk box
syncopate me Posted 8 months ago 8 months
on SOUDIERE - DOUBTS
fresh Posted 8 months ago 8 months
on c'est la vie. (prod. Rice N' Peas)
swingin Posted 8 months ago 8 months on Lain - Control (Nowadays #6)
slaya Posted 8 months ago 8 months
on die for me. 9
maaaad tune Posted 8 months ago 8 months
on Red Kit
actually tempted Posted 8 months ago 8 months
on Waiting
thanks for dl Posted 8 months ago 8 months
on Waiting
u got that wave boi Posted 8 months ago 8 months on Connor Pearson - Free Fall feat. D.R.A.M. (prod. by Doc McKinney)
this is tight guys Posted 8 months ago 8 months on elete - Too Much
tight Posted 9 months ago 9 months
on Falling (Prod. Drainpuppet)
daaaaamn Posted 9 months ago 9 months on Beamon - Nightmare Before Christmas (produced by alfon zaaberg & MIRAMARE)
yoooo Posted 9 months ago 9 months
on i kno what u want
h e a t Posted 9 months ago 9 months
on city.
snake shake Posted 9 months ago 9 months
on Sadnest
this goes deep Posted 9 months ago 9 months on Dreaming
<3 Posted 9 months ago 9 months
on Dreaming
sick Posted 9 months ago 9 months
on dead and beat
@evo-auxilium: thanks man! Posted 9 months ago 9 months on The Bio Hannya Comment (Bpm 159 Ver.)
rip Posted 9 months ago 9 months
on Diveo and Summer Payton - Rendezvous
n_n Posted 9 months ago 9 months
on Diveo and Summer Payton - Rendezvous
love love love love love Posted 9 months ago 9 months
on Diveo and Summer Payton - Rendezvous stop it Posted 9 months ago 9 months
on Diveo and Summer Payton - Rendezvous
the harmoniiiicsssss <3<3<3 Posted 9 months ago 9 months
on Diveo and Summer Payton - Rendezvous descending into an underwater cavern type melody Posted 9 months ago 9 months
on Diveo and Summer Payton - Rendezvous
why haven't i heard this Posted 9 months ago 9 months
on treez lowkey - faded:; (prod @16yroid & dj patt)
mad tight Posted 9 months ago 9 months
on treez lowkey - faded:; (prod @16yroid & dj patt)
that kick is pentrating Posted 9 months ago 9 months
on Overdue ...... Posted 9 months ago 9 months
on Overdue
gracious Posted 9 months ago 9 months
on Bloodcomfort
w h o 0 are y o 0 o u u Posted 9 months ago 9 months on FREEDOLO X WUTRAN- Free Your Heartbeat (Ft. JJ Rhymer)
g0d Posted 9 months ago 9 months on FREEDOLO X WUTRAN- Free Your Heartbeat (Ft. JJ Rhymer)
this is something special Posted 9 months ago 9 months on FREEDOLO X WUTRAN- Free Your Heartbeat (Ft. JJ Rhymer)
so many hot new tunes in my feed rn!!! Posted 9 months ago 9 months
on ®® Rhoda - 5am, You're So Cute ®® good one Posted 9 months ago 9 months
on rocket good god that sass counter melody Posted 9 months ago 9 months
on rocket
this is filthy Posted 9 months ago 9 months
on Kioto
whoa Posted 9 months ago 9 months
on Kioto
knees weakening Posted 9 months ago 9 months
on the chase
@youknowlimbo: ^ Posted 9 months ago 9 months on Gypsy Woman x Loca (Nixus Bootleg)
this was tight nixus Posted 9 months ago 9 months
on 1ne 2 step
soundcloud blazin 2day Posted 9 months ago 9 months
on Gallivanture
love this shit Posted 9 months ago 9 months
on Kid Froopy // BB (Four Missed Texts) (WRLD Remix)
lvely Posted 9 months ago 9 months
on Kid Froopy // BB (Four Missed Texts) (WRLD Remix)
my stream is on fire right now Posted 9 months ago 9 months
on idle hour ft. dawson & kolada
@yungsulu: hello there sulu Posted 9 months ago 9 months on Wolfkin & Pacific Patterns - Upside Down (STRTMF037)
hnngah Posted 9 months ago 9 months
on GEOTHEORY - Desiree (Aye)
spectaculara Posted 9 months ago 9 months
on NEW HOME (Prod. by Cresce & AUFL)
whip Posted 9 months ago 9 months
on NEW HOME (Prod. by Cresce & AUFL)
nice slides Posted 9 months ago 9 months
on that thing.
sweltering sauna humidity liq mhm Posted 9 months ago 9 months on Christian Lady Goes Hard On Vince Staples Beat
start bustin Posted 9 months ago 9 months
on the things i do for u
this is cute man Posted 9 months ago 9 months on toasted
@youknowlimbo: hey Posted 9 months ago 9 months
on toasted
@youknowlimbo: i haven't seen you for months Posted 9 months ago 9 months
on APO σ·ᇦ ̶ - bed book
sick Posted 9 months ago 9 months
on breathe
let me ^ pls Posted 9 months ago 9 months
on Dr. Derg x Gangus x Tsuruda - Always One
bangin from beyond the grave. this shit is 100 Posted 9 months ago 9 months
on Aztek - Xians' Cat Palace
these samples are out of this world Posted 9 months ago 9 months on Hapa - Sandman
kick penetrates deep Posted 9 months ago 9 months
on I prod. attic beats
stinging me with them flames Posted 9 months ago 9 months
on home phone (w/ nick hakim)
whoa Posted 9 months ago 9 months
on moontalk.
sultry Posted 9 months ago 9 months on Smile (Ft. Sophie Meiers) (Prod. nohidea)
wowza Posted 9 months ago 9 months
on Wild Love (Moonbeat Remix) *BUY4DL*
:D Posted 9 months ago 9 months on ANGELS (w/ SwuM)
gentle Posted 9 months ago 9 months
on Woods
fresh Posted 9 months ago 9 months
on never can say goodbye
^^^ Posted 9 months ago 9 months
on TREGS - Crystal Sky
shit got me flyin Posted 9 months ago 9 months on crush (madebyswavy bootleg)
high energy Posted 9 months ago 9 months
on charlie brown spectacle of human ingenuity Posted 9 months ago 9 months
on Higher Ground $$$$$$ Posted 9 months ago 9 months
on Higher Ground
sick Posted 9 months ago 9 months
on Higher Ground
got me groovin Posted 9 months ago 9 months
on The Sneeze
guitar slaying Posted 9 months ago 9 months
on The Sneeze
the spread on those vocals is crazy Posted 9 months ago 9 months
on The Sneeze
holy shit Posted 9 months ago 9 months on Beast of Burden (argonaut&wasp cover) <3 Posted 9 months ago 9 months
on Beast of Burden (argonaut&wasp cover)
lovely sounds Posted 9 months ago 9 months
on Beast of Burden (argonaut&wasp cover)
this is tight! Posted 9 months ago 9 months
on Loser Like You
@argonaut-and-wasp: no problem! plan on listening to the rest of your profile when i get home Posted 9 months ago 9 months
on harris cole - girls (out now; "pause" lp) harris understand what components are necessary to make a beautiful composition Posted 9 months ago 9 months
on Loser Like You
really feeling this vibe! love it Posted 9 months ago 9 months
on Stevie - Leave You Must Not captivating Posted 9 months ago 9 months
on junyii. x [ocean jams] EP
damn... Posted 9 months ago 9 months
on Birthday (ft. Lil Aaron) Prod. JOY.
real trill Posted 9 months ago 9 months
on Call Bby (feat. Bloodz Boi & Young Peach) - Oh Boy
tight Posted 9 months ago 9 months
on Groove On: Session 054
<3<3 Posted 9 months ago 9 months
on Groove On: Session 054 breh suuuuper tight! sound like something from an ssx game! Posted 9 months ago 9 months
on Groove On: Session 054 bailleeee Posted 9 months ago 9 months on BEEZ project + DRUM KIT [sellfy.com/p/XhRk]
RAUNCH Posted 9 months ago 9 months
on Crapface x HOP BOX - D.Va
destruction Posted 9 months ago 9 months
on 813 – Sorry God ( buy = FREE DL :)
yowza Posted 9 months ago 9 months
on 813 – Sorry God ( buy = FREE DL :)
W O W Posted 9 months ago 9 months
on weird inside - just ask (oshi redo)
always love hearing this Posted 9 months ago 9 months
on rai ϶απγ thumbs way up Posted 9 months ago 9 months
on pekepon go
this is wonderful Posted 9 months ago 9 months on 3lo & Hadiya ~ Acid Venom (Ft. Atlas Greene)
. . . Posted 9 months ago 9 months
on fractals
sick atmosphere. it's warm Posted 9 months ago 9 months
on you don't know
dang Posted 9 months ago 9 months
on you don't know
this is fucking awesome Posted 9 months ago 9 months
on hidden track waltz
supreme hats 2 Posted 9 months ago 9 months
on hidden track waltz
this one is my favorite Posted 9 months ago 9 months
on hidden track waltz
them whisperrrrssss Posted 9 months ago 9 months
on hidden track waltz
dumb dope Posted 9 months ago 9 months
on don't wake me those backwards kicks are fucking with me Posted 9 months ago 9 months
on don't wake me
super relaxing Posted 9 months ago 9 months
on knock on wood
fantastic clap Posted 9 months ago 9 months
on knock on wood damn this track is coated in sass Posted 9 months ago 9 months
on nothing is missing
let's go time traveling Posted 9 months ago 9 months
on nothing is missing
h o t Posted 9 months ago 9 months
on nothing is missing
sick synth. retro0Oøºo0Oo Posted 9 months ago 9 months
on just another i'm gonna faint off those bg vox Posted 9 months ago 9 months
on director's cut
these keys are killing Posted 9 months ago 9 months on director's cut
good shit dude Posted 9 months ago 9 months
on phantoms
sounds like a star Posted 9 months ago 9 months
on phantoms
dliiiiiiing Posted 9 months ago 9 months
on phantoms
damn... Posted 9 months ago 9 months
on in time
: ) : ) Posted 9 months ago 9 months on The Kount & Lege ~ Silence (Feat. Olukara)
loving this Posted 9 months ago 9 months on how i live w/ blue november
sweet Posted 9 months ago 9 months
on Grey Killer - Patience
super chill Posted 9 months ago 9 months
on Grey Killer - Patience
tight breh Posted 9 months ago 9 months
on .into the sound
dope Posted 9 months ago 9 months
on bytes.
super fluid Posted 10 months ago 10 months
on vanilla air
right on Posted 10 months ago 10 months on babe - dawn mists
g o r g e o u s Posted 10 months ago 10 months on Love Thy Brother & Jonny Stemp - Holy Days
this is way wavy Posted 10 months ago 10 months
on FRIENDS (prod. eu-IV)
treat Posted 10 months ago 10 months
on FRIENDS (prod. eu-IV)
pure Posted 10 months ago 10 months
on Comme ceci
<3 Posted 10 months ago 10 months
on Comme ceci
already in love Posted 10 months ago 10 months
on Sus Slide darth vader ass shit Posted 10 months ago 10 months
on Empty Pools
icy af Posted 10 months ago 10 months
on Vrry Cold
jesus christ those snares in the background are livid Posted 10 months ago 10 months
on Yugen
lovely atmosphere. you really filled the space well Posted 10 months ago 10 months on Esben, Deph, Khal - International Klokker ringer (ER DU MED?)
this bassline is dank Posted 10 months ago 10 months
on Flyder New Age 99
cool Posted 10 months ago 10 months
on Flyder New Age 99 is that you breathing Posted 10 months ago 10 months
on Flyder New Age 99
you weird man Posted 10 months ago 10 months
on Flyder New Age 99
yo this is really tight Posted 10 months ago 10 months on When comes the end of summer...
sensational Posted 10 months ago 10 months on When comes the end of summer...
whoa... Posted 10 months ago 10 months
on ɴ/ᴀ
hahah supreme Posted 10 months ago 10 months
on safe
he's solid all the way back! Posted 10 months ago 10 months
on cool
i am droning Posted 10 months ago 10 months
on cool
experiential Posted 10 months ago 10 months
on cool
fantastic Posted 10 months ago 10 months
on hymn
butter Posted 10 months ago 10 months
on pantone 448c
@brothermynor: truth Posted 10 months ago 10 months
on pantone 448c i wish i could make things like this Posted 10 months ago 10 months
on pantone 448c
beautiful portfolio you've got here Posted 10 months ago 10 months
on pantone 448c
start str0ng Posted 10 months ago 10 months
on strange/beautiful
visual and auditory pleasantries Posted 10 months ago 10 months
on strange/beautiful
sweeet waveforms Posted 10 months ago 10 months
on hearter
dude you are fucking me Posted 10 months ago 10 months
on hearter
@skug-1: appreciate your commitment to the community Posted 10 months ago 10 months on <
mmmmmmf Posted 10 months ago 10 months
on <
correct Posted 10 months ago 10 months
on that/this
sick Posted 10 months ago 10 months
on that/this
innovating shit man. loving it Posted 10 months ago 10 months
on reno
fun <3 Posted 10 months ago 10 months
on reno good god mix game incredible Posted 10 months ago 10 months on tamale
huh Posted 10 months ago 10 months
on tamale
damn boy where did you take us Posted 10 months ago 10 months
on tamale
turn this up, bitch. this my jam Posted 10 months ago 10 months
on River Haze (ft. J.Roosevelt) this synth is literally what love sounds like Posted 10 months ago 10 months
on River Haze (ft. J.Roosevelt)
magnificent work! Posted 10 months ago 10 months
on Mbe - Charming Victim
p l u c k Posted 10 months ago 10 months on Mbe - Charming Victim
that deconstructed digital arp lawd Posted 10 months ago 10 months
on Mbe - Charming Victim
@muso-ka: meet you @ white castle in 30 Posted 10 months ago 10 months
on praying for you the top of my mouth is touching the back of my throat Posted 10 months ago 10 months
on praying for you
hngnnnngnnngngng Posted 10 months ago 10 months
on praying for you
god Posted 10 months ago 10 months
on praying for you
i like the way you explore Posted 10 months ago 10 months on DB (w/ jamo and xix) *VIDEO NOW LIVE @ DOMINOSMUSIC.COM*
guys this is mad dope Posted 10 months ago 10 months on DB (w/ jamo and xix) *VIDEO NOW LIVE @ DOMINOSMUSIC.COM*
gaaaang Posted 10 months ago 10 months
on Taipei
nice Posted 10 months ago 10 months
on Taipei
scoooop me up Posted 10 months ago 10 months
on wet socks [ sophie meiers x gin$eng ]
yall Posted 10 months ago 10 months
on AJMW - Cadence
good shit ajmw Posted 10 months ago 10 months
on AJMW - Dedicated 2 U oof Posted 10 months ago 10 months
on AJMW - Dedicated 2 U
solid start. loving this Posted 10 months ago 10 months on Leaf (w/ samsin)(DRUMKIT VOL1 : https://sellfy.com/p/MCyK/)
mad cool Posted 10 months ago 10 months
on Dieumerci August ft. Phlipz - Order More (Prod. Stunnah)
tame love Posted 10 months ago 10 months
on Picture This
w o w o w o w Posted 10 months ago 10 months
on triumph
rip me Posted 10 months ago 10 months
on triumph this is heavier than a natural disaster Posted 10 months ago 10 months
on triumph
scratch that Posted 10 months ago 10 months
on triumph remember when i said this was dope Posted 10 months ago 10 months
on triumph
this is dope Posted 10 months ago 10 months
on krs. + don't need u
loving this so much Posted 10 months ago 10 months
on krs. + don't need u
succulent Posted 10 months ago 10 months
on krs. + don't need u
oh my shit Posted 10 months ago 10 months
on krs. + don't need u
delicate Posted 10 months ago 10 months
on Happy Hour - Odunsi ft Okunta (Remix)
that ride Posted 10 months ago 10 months
on Happy Hour - Odunsi ft Okunta (Remix)
this is really tight Posted 10 months ago 10 months
on ✃ JOOK'D ✁
dude Posted 10 months ago 10 months
on ✃ JOOK'D ✁
✁ DOJOK' ✃ Posted 10 months ago 10 months on NRK Shonen, "No Funny" (Prod. Good Intent)
hnnnnnng Posted 10 months ago 10 months
on NRK Shonen, "No Funny" (Prod. Good Intent)
loving them 808s Posted 10 months ago 10 months
on NRK Shonen, "No Funny" (Prod. Good Intent)
dude this is sharp Posted 10 months ago 10 months
on NRK Shonen, "No Funny" (Prod. Good Intent)
claaaaaaw Posted 10 months ago 10 months on NRK Shonen, "Not Today" (Prod. @instupendo & @itsgoodintent)
breh Posted 10 months ago 10 months on NRK Shonen, "Not Today" (Prod. @instupendo & @itsgoodintent)
i i i i i i instupendo Posted 10 months ago 10 months
on Hibiscus (feat. Naji)
props Posted 10 months ago 10 months on Hibiscus (feat. Naji)
sick atmosphere Posted 10 months ago 10 months
on Hibiscus (feat. Naji) caught me with those bulky angel wings Posted 10 months ago 10 months
on Jakob Jespersen - Mountain
cute melody Posted 10 months ago 10 months
on do we
this is wicked Posted 10 months ago 10 months
on Love is all Around
<3 lovely Posted 10 months ago 10 months
on The Nashville Number System Blues
soul Posted 10 months ago 10 months on Money Doesn't Grow on Trees
groove Posted 10 months ago 10 months on Money Doesn't Grow on Trees
we are moving boyo Posted 10 months ago 10 months
on Last Train To Town
better catch that train Posted 10 months ago 10 months
on Last Train To Town
love that sample Posted 10 months ago 10 months
on Barrier Reef music
dope!! Posted 10 months ago 10 months
on Moonlight Orgy
teach me Posted 10 months ago 10 months on Moonlight Orgy
master Posted 10 months ago 10 months
on Moonlight Orgy
fuck yes Posted 10 months ago 10 months
on Things She Said
killin it Posted 10 months ago 10 months
on Things She Said
damn Posted 10 months ago 10 months
on Espionage
lord Posted 10 months ago 10 months
on Espionage
this belongs on guitar hero Posted 10 months ago 10 months on Pokémon Title Theme - Red/Blue Version (cover) <3 <3 <3 <3 Posted 10 months ago 10 months on "The Hills Have Ears" Podcast Theme
sick Posted 10 months ago 10 months on "The Hills Have Ears" Podcast Theme
catchy Posted 10 months ago 10 months
on A New Day
live well Posted 10 months ago 10 months
on The Gathering
<3 Posted 10 months ago 10 months
on The Gathering
love your sound variety Posted 10 months ago 10 months
on The Escape heat! Posted 10 months ago 10 months
on The Escape
good shit man Posted 10 months ago 10 months
on The Escape
telling a badass story Posted 10 months ago 10 months
on The Escape damn, cleaned up nicely Posted 10 months ago 10 months
on The Escape
i like it here Posted 10 months ago 10 months
on Halleluiah (cover) breehhh this is gorgeous Posted 10 months ago 10 months on Sending Me Angels (cover)
love that soft rim Posted 10 months ago 10 months
on Sending Me Angels (cover)
relaxed as hell my man Posted 10 months ago 10 months
on Troglodyte
lawd Posted 10 months ago 10 months
on tibe x brtrnd - deviants that scream makes me arm hair stand up Posted 10 months ago 10 months
on tibe x brtrnd - deviants
you disgusting mother fuckers Posted 10 months ago 10 months
on tibe x brtrnd - deviants
keys are literally perfect Posted 10 months ago 10 months
on tibe x brtrnd - deviants
good g o d that fucking break Posted 10 months ago 10 months
on tibe x brtrnd - deviants
yahhhh Posted 10 months ago 10 months on Washing Machine (Prod. Eestbound & Bijan Amir) [ Video in description ]
sick Posted 10 months ago 10 months
on Lmlu Flip
slappin Posted 10 months ago 10 months
on brother mynor - w h ï p
<3 Posted 10 months ago 10 months
on brother mynor - w h ï p
so right Posted 10 months ago 10 months
on brother mynor - w h ï p
everything is to tight Posted 10 months ago 10 months
on brother mynor - w h ï p
h u h ? ¿ Posted 10 months ago 10 months
on brother mynor - egyptian flush
suave Posted 10 months ago 10 months
on brother mynor - egyptian flush
@p-a-n-o: what's good homie Posted 10 months ago 10 months
on brother mynor - egyptian flush
more like brother major Posted 10 months ago 10 months
on Yaaah
yaaah Posted 10 months ago 10 months
on ᵗʰᵉʳᵉ'ˢ ᶰᵒ ʳᵉᵃˢᵒᶰ ᵗᵒ ᵇᵉ ᵃᶠʳᵃᶦᵈ
i'll take these paddles w/ me Posted 10 months ago 10 months on Ion Care
dope Posted 10 months ago 10 months
on soryo - our heads in clouds
mmm Posted 10 months ago 10 months
on soryo - our heads in clouds
this is art Posted 10 months ago 10 months
on cracks on my vans
whippin Posted 10 months ago 10 months
on Deploy Emoji do do do do do do do do do do do do dope Posted 10 months ago 10 months
on Deploy Emoji
whoaaaa Posted 10 months ago 10 months on Ataraxia
keys are the touch Posted 10 months ago 10 months
on uncomf
kongah Posted 10 months ago 10 months
on uncomf
phaser melted my brain Posted 10 months ago 10 months
on uncomf what the hell is happening Posted 10 months ago 10 months
on edged out.
dig me down Posted 10 months ago 10 months
on edged out.
dig me deep Posted 10 months ago 10 months on slow down, ow!
grand Posted 10 months ago 10 months
on sexy back
this is sick Posted 10 months ago 10 months on Might Just (prod. KINGBNJMN)
i could fucc to this Posted 10 months ago 10 months
on urban angel ̿w/ doujinshì
boys Posted 10 months ago 10 months
on urban angel ̿w/ doujinshì
spectacular Posted 10 months ago 10 months
on like kanye
son Posted 10 months ago 10 months
on like kanye this is the most disgusting thing Posted 10 months ago 10 months
on like kanye hahahaha what the fucking shit it this Posted 10 months ago 10 months
on like kanye
my e a r s Posted 10 months ago 10 months
on cracks on my vans
whimsical Posted 10 months ago 10 months
on Tropics(prod. by Saimyosho)
interesting Posted 10 months ago 10 months
on godbody
this shit str8 growlin Posted 10 months ago 10 months
on Simple yo this is sick Posted 10 months ago 10 months
on purple
i like it Posted 10 months ago 10 months
on O c u l u s
mad Posted 10 months ago 10 months
on Point Point - Wound Up
on point point Posted 10 months ago 10 months
on MELLDU & BUCKY - Feel
these cuts are tight Posted 10 months ago 10 months on Adamantium Ft. Steeziak & Domino
fucking dope Posted 10 months ago 10 months
on hide
lovely Posted 10 months ago 10 months
on aurora [6k]
goodness gracious Posted 10 months ago 10 months
on aurora [6k]
what the hell am i hearing exactly Posted 10 months ago 10 months
on Those.Legends {Tape}
<3<3 Posted 10 months ago 10 months
on Those.Legends {Tape}
yus Posted 10 months ago 10 months
on Those.Legends {Tape}
strong Posted 10 months ago 10 months on Breed - Sketchy Loops(Habits)[Prod. SVT]
mad quicc Posted 10 months ago 10 months
on goliath
yo Posted 10 months ago 10 months
on Dylan Kidd - Resurface
super chill kidd Posted 10 months ago 10 months
on session w/ kolada
@maia-arellano: same af Posted 10 months ago 10 months
on language w/ goldy 47
gang Posted 10 months ago 10 months
on language w/ goldy 47
those kicks penetrate Posted 10 months ago 10 months
on mudi hums
magnifico Posted 10 months ago 10 months on x (starting over)
deep Posted 10 months ago 10 months
on x (starting over)
this is fucking sick Posted 10 months ago 10 months
on x (starting over)
damn... already caught me Posted 10 months ago 10 months
on Indulge (Jarreau Vandal Remix)
swell Posted 10 months ago 10 months
on Atlas Greene x 3lo x Banksly - Smartwater i buy a bottle of smart water and refill it over and over for a week then i get a new one Posted 10 months ago 10 months
on dead and beat
@shinisc: thanks dude. been a minute! how are you? Posted 10 months ago 10 months on Self Control (Cavan Brady Flip)
<3<3<3 Posted 10 months ago 10 months
on Self Control (Cavan Brady Flip)
that sidechain is deeep afff Posted 10 months ago 10 months
on Self Control (Cavan Brady Flip)
lord almighty Posted 10 months ago 10 months
on Self Control (Cavan Brady Flip) brooooooooooooooooooo is this youuu????? Posted 10 months ago 10 months
on KiWi - Sugar Panic (813 remix)
raaaw Posted 10 months ago 10 months
on HATEABLE (Thank you for 2k)
dope Posted 10 months ago 10 months on Peyton - Anxious [prod. Bobby Earth & The Remnants]
: ) Posted 10 months ago 10 months
on jonecks - waiting for you
interesting take Posted 10 months ago 10 months
on "Froze" prod. Dro & Allan Kingdom
hard Posted 10 months ago 10 months
on bored
you made me break lowercase Posted 10 months ago 10 months
on bored
WHAT THE FUCK Posted 10 months ago 10 months
on bored
who mans is this?????? Posted 10 months ago 10 months on bored
you are fucking crazy Posted 10 months ago 10 months
on bored
du du du duuuuuuuu dude Posted 10 months ago 10 months
on Taube
keep it up Posted 10 months ago 10 months
on Taube
i have no words Posted 10 months ago 10 months on Heartthrob [prod.meltycanon]
jeez Posted 10 months ago 10 months
on smpl
mans Posted 10 months ago 10 months
on smpl my throat stoppin up Posted 10 months ago 10 months
on Fix Me
@klrx: 6 letters in your name? wh... who... are you...? Posted 10 months ago 10 months
on Mick Jеnkins - Jazz (thunder6 remix)
the most chill thing i've heard all month Posted 10 months ago 10 months
on Mick Jеnkins - Jazz (thunder6 remix)
damn dude Posted 10 months ago 10 months
on low
jerseyyyy <3<3 Posted 10 months ago 10 months
on low
god the whips smacking my body back and forth Posted 10 months ago 10 months on thunder6 drumkit + ableton project https://sellfy.com/p/LAHp/ @thundersix: i'd help you out fam but i have less than $50 in my checking rn... Posted 10 months ago 10 months
on Coastal Love ( Cover )
that kick is sooooo deep Posted 10 months ago 10 months
on ౯ጱᑮᵐ My Phone ( feat. Zenbo )
good stuff Posted 10 months ago 10 months
on ౯ጱᑮᵐ My Phone ( feat. Zenbo )
yooooo Posted 10 months ago 10 months
on ౯ጱᑮᵐ My Phone ( feat. Zenbo )
pro Posted 10 months ago 10 months
on ౯ጱᑮᵐ My Phone ( feat. Zenbo )
dope riffs Posted 10 months ago 10 months
on ౯ጱᑮᵐ My Phone ( feat. Zenbo ) lovely Posted 10 months ago 10 months
on ౯ጱᑮᵐ My Phone ( feat. Zenbo )
chords are serene af Posted 10 months ago 10 months
on ౯ጱᑮᵐ My Phone ( feat. Zenbo )
amazing Posted 10 months ago 10 months
on Mixing Alcohol & Cocaine Could Be Dangerous.
fucking gaaaaaangster Posted 10 months ago 10 months
on Fix Me
@klrx: yo you may be onto something... 'four lttr gang' Posted 10 months ago 10 months
on 01_WPI
my man, this is a beautiful piece of work Posted 10 months ago 10 months
on GITS such groove Posted 10 months ago 10 months
on GITS
<3<3<3<3<3 Posted 10 months ago 10 months
on GITS
how the Posted 10 months ago 10 months
on 䰤壆 Label
supreme Posted 10 months ago 10 months
on 䰤壆 Label i don't understand it but i like Posted 10 months ago 10 months
on 䰤壆 Label
this is insanely good Posted 10 months ago 10 months
on make a move @biohannya: i played biohannya clicker the other day and stopped after like 23 upgrades... lol Posted 10 months ago 10 months
on make a move
i'm a fucking sucker for jersey Posted 10 months ago 10 months
on make a move
master Posted 10 months ago 10 months
on make a move
yyyyyyaaaaaaaaaaaahhhhh Posted 10 months ago 10 months
on make a move
oh god Posted 10 months ago 10 months
on make a move
1 second in and it's this dope already?? Posted 10 months ago 10 months
on Dabow x Herzeloyde - What's Up oof Posted 10 months ago 10 months
on Dabow x Herzeloyde - What's Up yall gonna murder somebody with this Posted 10 months ago 10 months
on 22 [miniTape]
yo Posted 10 months ago 10 months
on Fix Me
@klrx: #4lttrgang Posted 10 months ago 10 months
on 22 [miniTape]
gorgeous!! Posted 10 months ago 10 months
on Hopes... ft. puhham
that bass is roaring Posted 10 months ago 10 months
on Fix Me
mad Posted 10 months ago 10 months
on Fix Me
s Posted 10 months ago 10 months
on Fix Me
opening door Posted 10 months ago 10 months
on Fix Me
beautiful gate Posted 10 months ago 10 months
on Fix Me
fucking leash those 808s Posted 10 months ago 10 months
on Fix Me bro we are fucking hyperspeed rn Posted 10 months ago 10 months
on inside despair
that riiiide Posted 10 months ago 10 months
on Ghxst x Nafy - Mother
i just spelled surprises wrong Posted 10 months ago 10 months
on Ghxst x Nafy - Mother
constant suprises Posted 10 months ago 10 months
on Ghxst x Nafy - Mother
o.o Posted 10 months ago 10 months
on Ghxst x Nafy - Mother
well i'll be Posted 10 months ago 10 months
on Ghxst x Nafy - Mother
always good to hear a fresh sound Posted 10 months ago 10 months on thunder6 drumkit + ableton project https://sellfy.com/p/LAHp/
this shit is loud Posted 10 months ago 10 months on thunder6 drumkit + ableton project https://sellfy.com/p/LAHp/
buddy Posted 10 months ago 10 months on Yunomi - य़䜜πЀϕϺЄ϶Є (feat. TORIENA) [Cherishh x Sayuw Remix]
suuuhh cuuuuute Posted 10 months ago 10 months
on Theme of Jamie
dang Posted 10 months ago 10 months
on Denzel Curry - THREATZ [Promnite Edition]
i don't think i've heard this????? Posted 11 months ago 11 months
on Neck Of The Woods ft. KVKA
fucc Posted 11 months ago 11 months
on Neck Of The Woods ft. KVKA
dark deep deadly dank done Posted 11 months ago 11 months on Naomi
lawd Posted 11 months ago 11 months
on Naomi i don't have these keys on my keyboard Posted 11 months ago 11 months
on Naomi
it's like magic Posted 11 months ago 11 months
on Tell Your Friends.
wiping the floor with your competition Posted 11 months ago 11 months
on Tell Your Friends.
this dude is wack Posted 11 months ago 11 months
on Crème
so fucking fire Posted 11 months ago 11 months on Crème mans pulled this lead...... smdhhhhhhh Posted 11 months ago 11 months
on Crème
this make my dick wet Posted 11 months ago 11 months
on Crème
@zodivk: you are not alone Posted 11 months ago 11 months
on Crème
good god Posted 11 months ago 11 months
on Crème
instant follow Posted 11 months ago 11 months
on Crème
nuts Posted 11 months ago 11 months on falling asleep at 3:37am (ft. Alex Szotak) (from "Hiraeth" EP)
well done guys Posted 11 months ago 11 months on falling asleep at 3:37am (ft. Alex Szotak) (from "Hiraeth" EP)
the stereoooooooooohh ß( Posted 11 months ago 11 months on falling asleep at 3:37am (ft. Alex Szotak) (from "Hiraeth" EP)
please... i'm going to have a heart attack Posted 11 months ago 11 months
on i remixed low by trace
dope Posted 11 months ago 11 months
on Dabow & Herzeloyde - Drop It
thro baccc Posted 11 months ago 11 months
on F L A G S
ding Posted 11 months ago 11 months
on F L A G S been a h o t minute since i heard this fucking 12 inch dick of a track Posted 11 months ago 11 months
on lost again (DRUMKIT VOL1 : https://sellfy.com/p/MCyK/)
know what i'm saying Posted 11 months ago 11 months
on lost again (DRUMKIT VOL1 : https://sellfy.com/p/MCyK/)
there Posted 11 months ago 11 months
on lost again (DRUMKIT VOL1 : https://sellfy.com/p/MCyK/)
that rim back there took me back Posted 11 months ago 11 months
on lost again (DRUMKIT VOL1 : https://sellfy.com/p/MCyK/)
got the elegance but also the gang shit Posted 11 months ago 11 months
on Jade Tearz
eplah Posted 11 months ago 11 months
on Jade Tearz nasty Posted 11 months ago 11 months
on Jade Tearz
hey bud Posted 11 months ago 11 months on Pixelord - Human.exe LP teaser (OUT NOW)
dank Posted 11 months ago 11 months on Pixelord - Human.exe LP teaser (OUT NOW)
dude this paints an amazing picture Posted 11 months ago 11 months
on BEHIND THE BEAT: WIZE
gotta start somewhere Posted 11 months ago 11 months
on always on time
@peter-wheeler: <3<3<3 Posted 11 months ago 11 months
on dead and beat @peter-wheeler: thanks peter! will do! have a good one! Posted 11 months ago 11 months
on Instupendo - Wisp
everything is ok Posted 11 months ago 11 months
on Instupendo - Wisp
baby baby baby Posted 11 months ago 11 months
on WIZE's the elements // water edition (sound kit)
@vyrzi: dick Posted 11 months ago 11 months
on WIZE's the elements // water edition (sound kit)
@vyrzi: my Posted 11 months ago 11 months
on WIZE's the elements // water edition (sound kit)
@vyrzi: suck Posted 11 months ago 11 months
on WIZE's the elements // water edition (sound kit)
@vyrzi: bro here's 4 more comments Posted 11 months ago 11 months
on Nuisance (Prod. J Dilla)*Snippet
sick flow famo Posted 11 months ago 11 months
on where the bleep am i headed?
yeessss!!!! ^^^ Posted 11 months ago 11 months
on serpents ft. PANTRY [prod. FACTION]
space crimes Posted 11 months ago 11 months
on ORIGAMI
fucking dank bro Posted 11 months ago 11 months
on BISHOPS & ROOKS
whaaaaat Posted 11 months ago 11 months on https://3333.bandcamp.com/album/honor
jvpvn Posted 11 months ago 11 months
on FANTASIES
this shit spanks Posted 11 months ago 11 months
on home.
yoooooo yo yo yo Posted 11 months ago 11 months on Jump( Ft. Adrien LaSalle & Caitlin Avocado)
<3 Posted 11 months ago 11 months on Jump( Ft. Adrien LaSalle & Caitlin Avocado)
rilla got mad skills Posted 11 months ago 11 months
on Lil'Yukichi - Nichts Raum
nice one lil'yukichi Posted 11 months ago 11 months
on RAW
this fuckin leeeeeaaaad Posted 11 months ago 11 months on RAW
whaaaat? i didn't know you made this Posted 11 months ago 11 months
on Voyager
goodness Posted 11 months ago 11 months
on Voyager
just learn me Posted 11 months ago 11 months
on Voyager
dude i will work for free Posted 11 months ago 11 months
on Voyager u got any internships available troyboi Posted 11 months ago 11 months
on Voyager
i want to be your apprentice Posted 11 months ago 11 months on Vertigo Feat. a l l i e
power chords Posted 11 months ago 11 months
on Vertigo Feat. a l l i e
i enjoyed this Posted 11 months ago 11 months
on Sideways feat. Marco Foster
supreme Posted 11 months ago 11 months
on Sideways feat. Marco Foster
masterpiece Posted 11 months ago 11 months on Honest (KRNE & Maximus MMC Remix)
hnnnnnng Posted 11 months ago 11 months on Honest (KRNE & Maximus MMC Remix)
jesus mother fucking christ Posted 11 months ago 11 months on Honest (KRNE & Maximus MMC Remix)
lol this is kinda tight Posted 11 months ago 11 months
on Fall [prod. meltycanon]
fiiiiiiiiiiire Posted 11 months ago 11 months
on Outta' Options [prod. meltycanon]
>>>>>>>>>>> Posted 11 months ago 11 months
on Outta' Options [prod. meltycanon]
d a h m s o n Posted 11 months ago 11 months on WIZE's the elements // water edition (sound kit)
fire hits btw Posted 11 months ago 11 months on WIZE's the elements // water edition (sound kit)
like would i make money or should i wait Posted 11 months ago 11 months on WIZE's the elements // water edition (sound kit) is worth? Posted 11 months ago 11 months on WIZE's the elements // water edition (sound kit)
do i need to start this kit life Posted 11 months ago 11 months
on Nothing Is Missing (Freestyle) [prod. cehryl]
mighty Posted 11 months ago 11 months
on Nothing Is Missing (Freestyle) [prod. cehryl]
my oh my Posted 11 months ago 11 months
on i'm "fun"
tight Posted 11 months ago 11 months
on i'm "fun"
i can tell from ur happy ass synth Posted 11 months ago 11 months
on Haze w/ Late June interessant Posted 11 months ago 11 months
on how they ruin steak & eggs
headless chicken on da loose Posted 11 months ago 11 months
on how they ruin steak & eggs
rang that checen's necc Posted 11 months ago 11 months
on serpents ft. PANTRY [prod. FACTION]
pretty cool fam Posted 11 months ago 11 months
on this time (w/ tomppabeats)
@verzache: a good old snickerin' Posted 11 months ago 11 months
on Crapface x ZEN - Balloon ft. moistbreezy
@amyaxegale: gang gang gang gang gang Posted 11 months ago 11 months
on Pathways - Goodnight
smoothing Posted 11 months ago 11 months
on Alex X Laifu - Goodbye Friend
powerdreaming type tune Posted 11 months ago 11 months
on Winter (ft. Crosby)(Prod. idntrmmbr x Gene Fisher)
this is lower key than the leftmost key Posted 11 months ago 11 months
on Bonita
you got a sex here on ur hands brother Posted 11 months ago 11 months
on rarecandy
dude man Posted 11 months ago 11 months
on movies ocean waves trappin silent evil horror film rain feelin u got me Posted 11 months ago 11 months
on 23:99
ajpvbw496agprb93vwybRW Posted 11 months ago 11 months
on this time (w/ tomppabeats)
high octane listening right here Posted 11 months ago 11 months
on deja vu
very beautiful Posted 11 months ago 11 months
on deja vu
fucking dopppppppe Posted 11 months ago 11 months
on Trip To Mars (feat. Sammi Constantine)
<3<3 Posted 11 months ago 11 months
on Trip To Mars (feat. Sammi Constantine)
great work with sound design fam Posted 11 months ago 11 months
on Trip To Mars (feat. Sammi Constantine) this is unlike anything i've heard before Posted 11 months ago 11 months
on gudEnuf holy smokes u gonna blow my clothes off Posted 11 months ago 11 months
on Crapface x Elevation - Swim Meet
tight Posted 11 months ago 11 months
on Crapface x Elevation - Swim Meet
good god guys Posted 11 months ago 11 months
on Crapface x Elevation - Swim Meet
so fucking clean Posted 11 months ago 11 months
on Crapface x ZEN - Balloon ft. moistbreezy
i need to pop open a fresh qt Posted 11 months ago 11 months
on Crapface x Zack Bruce - U & Me
oh so sweet <3 Posted 11 months ago 11 months on Crapface x HOP BOX - Smile
sparkling Posted 11 months ago 11 months
on Explorer
serenity in percussion Posted 11 months ago 11 months
on ComfyMix.
: ) : ) Posted 11 months ago 11 months
on ComfyMix.
sick Posted 11 months ago 11 months
on wya jesus this got me emotional Posted 11 months ago 11 months
on 10. Nostalgia
beautiful piece guys Posted 11 months ago 11 months on Shadow Man (ft. Saba, Smino & Phoelix)
10/10/10/10/10 Posted 11 months ago 11 months
on questioning boundaries
@indigobeck: > 2 months ... > 7 hours Posted 11 months ago 11 months
on hormone
@emotegi: watch out bruh Posted 11 months ago 11 months
on b.sideu (free download!)
@kalkofent: (✿╹◡╹) Posted 11 months ago 11 months
on pain
☼ squad ☼ Posted 11 months ago 11 months
on pain
this is fucking sick Posted 11 months ago 11 months on pain
duuuuuuuude Posted 11 months ago 11 months
on pain
those foil chimes are sex Posted 11 months ago 11 months on p a p y r u s (feat. Nandyna&Indius)
smuth Posted 11 months ago 11 months on p a p y r u s (feat. Nandyna&Indius)
expert Posted 11 months ago 11 months on p a p y r u s (feat. Nandyna&Indius)
wow Posted 11 months ago 11 months
on hormone
jesus fucking christ Posted 11 months ago 11 months
on hormone this makes me want to kill someone Posted 11 months ago 11 months
on b.sideu (free download!)
2 darn cute Posted 11 months ago 11 months
on b.sideu (free download!)
<3<3<3 Posted 11 months ago 11 months
on b.sideu (free download!)
i'm a sucker for these drums Posted 11 months ago 11 months
on b.sideu (free download!) why this sound like what grass looks like at 6:30 in the morning Posted 11 months ago 11 months
on MONEYiGET.mp3
golly Posted 11 months ago 11 months
on MONEYiGET.mp3 guuuuulp Posted 11 months ago 11 months on j.robb - Still Got It (feat. Naji, Olukara, Solis & Vada)
this is dope guys Posted 11 months ago 11 months
on Chairs (Divine Remix)
i'm talkin' underwater Posted 11 months ago 11 months
on Chairs (Divine Remix)
d e e p Posted 11 months ago 11 months
on Thank you for 1K <3
dude these kicks are |||||||||||||| Posted 11 months ago 11 months
on Forever (Pearls)
kamau u r slaying Posted 11 months ago 11 months
on su na - Separate spectacular Posted 11 months ago 11 months
on Saucin - Ekany
man Posted 11 months ago 11 months
on Twice
dumb smooth Posted 11 months ago 11 months
on Twice
love it Posted 11 months ago 11 months
on Top Cats Vol. 46
<3<3<3<3<3 Posted 11 months ago 11 months
on swirl looking forward to hearing more from you Posted 11 months ago 11 months
on swirl
keep killing my dude Posted 11 months ago 11 months
on joan bro you have some real control over your composition Posted 11 months ago 11 months
on all yours
@seshcurry: i like you man Posted 11 months ago 11 months
on always on time
@seshcurry: <3<3 Posted 11 months ago 11 months
on Howls
loved this tune man!! thank you! Posted 11 months ago 11 months
on Night 24
fiya Posted 11 months ago 11 months
on Vague001 - So Cold (feat. Indica & Venture)
laxed and chill Posted 11 months ago 11 months
on wntr drum/sample kit (ADI - Pink Pillz remix)
like seriously mad Posted 11 months ago 11 months
on wntr drum/sample kit (ADI - Pink Pillz remix)
super groove Posted 11 months ago 11 months
on chillin
always on vibe time Posted 11 months ago 11 months
on (dreamchild) - SECSI BACK
slamming tune fam Posted 11 months ago 11 months
on in love w/ u
this is super dope Posted 11 months ago 11 months on Je t'Aime À Mourir - Bob Dylan Bilingual Cover (I Want You)
smooth goings Posted 11 months ago 11 months on Houston We Have A Problem (free download)
straight jammin' Posted 11 months ago 11 months
on Houston We Have A Problem (free download) peter you really understand all these classic styles of rock pretty well Posted 11 months ago 11 months
on Cocaine
coco coco cococoooo Posted 11 months ago 11 months
on Cocaine
tell em Posted 11 months ago 11 months
on Cocaine
those background vox are dope Posted 11 months ago 11 months
on wishes w / mydigo
huuhhhh?????? Posted 11 months ago 11 months on Dominique Is Stoned
have mercy on me Posted 11 months ago 11 months
on Dominique Is Stoned
seriously digging this vibe Posted 11 months ago 11 months
on Dominique Is Stoned
and the story is told Posted 11 months ago 11 months on What Goes Around Comes Around
good lord Posted 11 months ago 11 months on What Goes Around Comes Around
rock n roll baby Posted 11 months ago 11 months on What Goes Around Comes Around
yeeees that power cry! Posted 11 months ago 11 months on What Goes Around Comes Around
this guitar is slaaaaaying!!! Posted 11 months ago 11 months
on Den Endeløse Vegen
<3 Posted 11 months ago 11 months
on Den Endeløse Vegen
very unique Posted 11 months ago 11 months
on In The Shadow Of The Cross
love these chords Posted 11 months ago 11 months
on Take Me Down
beautiful piece of work you've got here Posted 11 months ago 11 months on The old kitchen is closed, ... Back sometime in November, weather permitting. ")
spectacular!! Posted 11 months ago 11 months on The old kitchen is closed, ... Back sometime in November, weather permitting. ")
oh man i am so into this Posted 11 months ago 11 months on The old kitchen is closed, ... Back sometime in November, weather permitting. ")
amazing work all!! Posted 11 months ago 11 months
on Fire (Leif Ka)
i can feel the heat Posted 11 months ago 11 months
on mewtwo
whoa Posted 11 months ago 11 months
on mewtwo
sccr Posted 11 months ago 11 months
on Mond II
aquarium life Posted 11 months ago 11 months on Wind good god man, drum fill game 'what's silence?' Posted 11 months ago 11 months
on Don't Do It w/ ||DIIIP||
done snapped Posted 11 months ago 11 months
on Coffee
damn dude you have some real talent Posted 11 months ago 11 months
on Usher - Still Got It Ft. Migos (Roshima edit)
dead Posted 11 months ago 11 months
on Usher - Still Got It Ft. Migos (Roshima edit)
gulp those skips Posted 11 months ago 11 months
on Usher - Still Got It Ft. Migos (Roshima edit)
mad groove Posted 11 months ago 11 months on Goodbye w/ ||DIIIP||
d i s g u s t i n g Posted 11 months ago 11 months
on Goodbye w/ ||DIIIP||
so glad this came on Posted 11 months ago 11 months
on Goodbye w/ ||DIIIP||
goooooooooood nesssssss Posted 11 months ago 11 months on mc pantcuff & lil estonian — IKEA ft. Hook Mang (prod. umru) ™
oh my god Posted 11 months ago 11 months
on Michael Mason (W/ Ehiorobo) - Chatting By The River (Echos & Anrae Remix)
what a treat Posted 11 months ago 11 months
on Michael Mason (W/ Ehiorobo) - Chatting By The River (Echos & Anrae Remix)
this shit is rare Posted 11 months ago 11 months on Holly & sumthin sumthin - Isolation
lighted Posted 11 months ago 11 months
on verzache ~ Blueberry
perfection Posted 11 months ago 11 months
on verzache ~ Blueberry
monstrous composition Posted 11 months ago 11 months on GoldLink - Sober Thoughts (Lido's Forgotten Sunday Service)
catchy Posted 11 months ago 11 months
on Floyd- Test Me ft. Lil West (prod. Eera +Ryan Jacob)
tight Posted 11 months ago 11 months
on u
damn that lemonade glass melody is fresh as fuck Posted 11 months ago 11 months on u
man quit playin Posted 11 months ago 11 months
on u
fucking circling the room Posted 11 months ago 11 months
on u lol dude... i don't even have speakers behind me... how did you Posted 11 months ago 11 months
on Shane Coulter ~ Lilacs ft Ryan Clephane
that riffff tho Posted 11 months ago 11 months
on Shane Coulter ~ Lilacs ft Ryan Clephane
whoa Posted 11 months ago 11 months
on Shane Coulter ~ Lilacs ft Ryan Clephane
dope shit Posted 11 months ago 11 months on Invention - Bluffs
incredible Posted 11 months ago 11 months
on Invention - Bluffs
w h y h a v e n ' t i h e a r d t h i s b e f o r e ? Posted 11 months ago 11 months on Tom Misch - Artist (Taken off "Spring In Jakarta". Free DLL soon)
got mad groove Posted 11 months ago 11 months
on I'm srry
shiloh and swum both have such an unmistakable sound Posted 11 months ago 11 months
on legacies
ugh Posted 11 months ago 11 months
on legacies
yung heartthrob p p padillon Posted 11 months ago 11 months on NEW HOME (Prod. by Cresce & AUFL)
flames Posted 11 months ago 11 months
on that thing.
where the hell did this come from Posted 11 months ago 11 months
on all yours
@tiberbeats: homiii Posted 11 months ago 11 months on OG CHE$$ - O 'Lordy Prod. ChrisxRose
that was sick Posted 11 months ago 11 months
on E e v e e - Viola
not so dark Posted 11 months ago 11 months
on Skit & Kareful - Lotus
spooky vox Posted 11 months ago 11 months
on making my way dt :-) l000000l Posted 11 months ago 11 months
on A-Team (remix) good god i love this fucking song Posted 11 months ago 11 months
on hi
trippin Posted 11 months ago 11 months
on hi
hello Posted 11 months ago 11 months
on BLANDA - Für Audri
interesting Posted 11 months ago 11 months
on Missing You
: ) Posted 11 months ago 11 months
on Jade mo vibez Posted 11 months ago 11 months
on Birmingham
smiths station Posted 11 months ago 11 months
on Hard To Tell
cool Posted 11 months ago 11 months
on Missing You
quality Posted 11 months ago 11 months
on Autograf - Heartbeat (Dirty Chocolate Remix)
@dirtychocolate: i walk around the lake a lot to hatch my eggs. tons of water pokemon Posted 11 months ago 11 months
on Popeska - I Believe
thicc Posted 11 months ago 11 months
on Popeska - I Believe really well put together Posted 11 months ago 11 months
on Autograf - Heartbeat (Dirty Chocolate Remix)
@dirtychocolate: bruh i've got another 470 magikarp candies. gyrados #2 soon lol Posted 11 months ago 11 months
on crazy
vibe Posted 11 months ago 11 months
on Mark The Beast & Snakefoot - Swamp Thing
whoa now Posted 11 months ago 11 months
on Hudson Mohawke - Chimes (Alexander Lewis X Y2K Flip) this is what they be listening to up at mount olympus Posted 11 months ago 11 months
on guillotine
best take on that i have heard Posted 11 months ago 11 months
on Sure tuuuuune Posted 11 months ago 11 months
on Sure
switch em Posted 11 months ago 11 months
on Sure
no e Posted 11 months ago 11 months
on Sure
over the bate Posted 11 months ago 11 months
on Sure
right off the bar Posted 11 months ago 11 months
on SVYSLF
good ride Posted 11 months ago 11 months
on SVYSLF
already in Posted 11 months ago 11 months
on Autograf - Heartbeat (Dirty Chocolate Remix)
this is warming me up Posted 11 months ago 11 months
on Autograf - Heartbeat (Dirty Chocolate Remix)
kilt Posted 11 months ago 11 months
on bird of paradise
yuuuus Posted 11 months ago 11 months
on Akira Akira - Return (JADŪ009)
this goes pretty hard Posted 11 months ago 11 months
on don't want no one else
only u Posted 11 months ago 11 months on Come Here [Prod. J.Eliaye , Cashmere Brown & Mike Green]
too g Posted 11 months ago 11 months
on evilpiece
uuuhhh whhaat Posted 11 months ago 11 months
on halpe~crystal tower (steelix remix) my sub is pushing very pleasant streams of air over my toes right now Posted 11 months ago 11 months
on Must Have w/ Karuna
sun chords Posted 11 months ago 11 months
on Xtra
hucci Posted 11 months ago 11 months
on josh pan & dumbfoundead - banned in the motherland (ft. simon dominic, jay park, g2)
yo Posted 11 months ago 11 months
on A room of one's own
delicious Posted 11 months ago 11 months
on A room of one's own
a cave of one's own Posted 11 months ago 11 months
on Cerulean
so intricate Posted 11 months ago 11 months
on Bee Orchid
<3 Posted 11 months ago 11 months
on Bee Orchid
duuuuude Posted 11 months ago 11 months
on DUBS+TRIPS - Angel Dubstep
love it Posted 11 months ago 11 months
on DUBS+TRIPS - Angel Dubstep oh damn this shit is getting real Posted 11 months ago 11 months
on todd siesel - groove
huuhh??? Posted 11 months ago 11 months
on Boom Bap
sick stuff Posted 11 months ago 11 months
on Let Go
very cool Posted 11 months ago 11 months
on Let Go those drums are so wet jdc Posted 11 months ago 11 months
on Footsteps On Beaches
pretty serene Posted 11 months ago 11 months
on gas
lol just noticed bonglord Posted 11 months ago 11 months on gas
lax Posted 11 months ago 11 months
on onitram & elate - scent
smashing piece of work Posted 11 months ago 11 months on When I Rule The World (SORTAGOTH Remix)
fast Posted 11 months ago 11 months on When I Rule The World (SORTAGOTH Remix)
whoooooooa Posted 11 months ago 11 months
on SINIQ - China Glass
moly o holy Posted 11 months ago 11 months
on Mr. Kaylo
wonk Posted 11 months ago 11 months on Take It Back ///// Bryson Tiller - Self Righteous Slamagotchi remix
lovely Posted 11 months ago 11 months
on Jia Lih & K.B. Starr - Resist [Chill Trap Release]
i like it Posted 11 months ago 11 months
on Coffee Shop
hell yea this bumps Posted 11 months ago 11 months
on Sweet
nicely done Posted 11 months ago 11 months
on Vérité - Gesture (BKAYE Remix)
smackin Posted 11 months ago 11 months
on Strap da Fool - Aint Worried Bout a Thing
this is tight Posted 11 months ago 11 months on smoove.
amazing work Posted 11 months ago 11 months
on Find.u
intricate Posted 11 months ago 11 months on Weary Eyes (Short Story For Ta-ku & Wafia) [w/ Tiber]
whoa Posted 11 months ago 11 months
on Mula (Oy X Lege)
yep Posted 11 months ago 11 months
on Mula (Oy X Lege)
u know my body is bobbing Posted 11 months ago 11 months on Cocoa Butter Kisses [Vocal Rework] w/ Jael The Voice
really enjoyed this Posted 11 months ago 11 months
on The Juice seriously vibing. good shit Posted 11 months ago 11 months
on In The Pocket #01
damn this right here is tight Posted 11 months ago 11 months
on CAN'T WAIT
<3 Posted 11 months ago 11 months
on CAN'T WAIT this how you know it's sunday Posted 11 months ago 11 months
on Lapis Lazuli
asmr af Posted 11 months ago 11 months
on Lapis Lazuli
man i'm interested Posted 11 months ago 11 months on so fluent (whereisalex interlude) ooooooo boy! Posted 11 months ago 11 months
on so fluent (whereisalex interlude)
this is wild Posted 11 months ago 11 months
on so fluent (whereisalex interlude) signature cunt move "i'll get my brother on you" Posted 11 months ago 11 months
on Master Niggel - Cabriolen
funky for sure Posted 11 months ago 11 months
on 2X6 & MMM - YTBK (PROD BY SENOJNAYR)
@thisiscreepa: truth Posted 11 months ago 11 months
on 2X6 & MMM - YTBK (PROD BY SENOJNAYR)
seno Posted 11 months ago 11 months on Dabow X Creepa X Tapecut - Touch (Flormaga Edit)
you messin huh Posted 11 months ago 11 months on Dabow X Creepa X Tapecut - Touch (Flormaga Edit)
gulp Posted 11 months ago 11 months on Dabow X Creepa X Tapecut - Touch (Flormaga Edit)
livid snare Posted 11 months ago 11 months
on feel like
yo Posted 11 months ago 11 months
on FGM - Lotus Paper Bomb (Instrumental)
downloading Posted 11 months ago 11 months
on FGM - Lotus Paper Bomb (Instrumental)
i've gone so under Posted 11 months ago 11 months
on FGM - Lotus Paper Bomb (Instrumental)
this is absolutely influential Posted 11 months ago 11 months
on Crash And Burn (MorrisCode X Azide Remix)
wow Posted 11 months ago 11 months
on Crash And Burn (MorrisCode X Azide Remix)
dem snares tho Posted 11 months ago 11 months
on Mystic
that's what i'm talking about man Posted 11 months ago 11 months
on Cesqeaux & San Holo - Who Am I [OUT NOW]
hnnnnnnnnnnnng Posted 11 months ago 11 months on Brandon Skeie - So Bad (MKJ X Dropwizz Remix)
exotic Posted 11 months ago 11 months
on Rihanna - Work (Vandalized Cover)
ugh holy moly Posted 11 months ago 11 months on FLOYD - ATTENTION (PROD. HELICA)
i like it Posted 11 months ago 11 months
on God Sight
evil Posted 11 months ago 11 months
on Sophie w/ l y o. - He Says I Think Too Much
wow you got that secret formula Posted 11 months ago 11 months on bottle caps (feel the spice) [prod. tomppabeats]
nice!! Posted 11 months ago 11 months
on On My Mind (feat. Emily Lomeli)
sick claps Posted 11 months ago 11 months
on On My Mind (feat. Emily Lomeli)
guuuuhh Posted 11 months ago 11 months on On My Mind (feat. Emily Lomeli)
melody already got me hooked Posted 11 months ago 11 months
on rib
this is some evolved ass shit Posted 11 months ago 11 months
on Samples & Keys 2 (Link in Description)
damn these are smooth Posted 11 months ago 11 months
on Marshmello - Alone (Xan Griffin Remix)
well done Posted 11 months ago 11 months
on Marshmello - Alone (Xan Griffin Remix) how is your release so tight on that synth. like impossibly tight Posted 11 months ago 11 months
on Marshmello - Alone (Xan Griffin Remix)
help i need a fire extinguisher Posted 11 months ago 11 months on aren't you lonely
no one can match this trademark olli aura Posted 11 months ago 11 months on $onoma ft. Killstation ~ Rollin Off (prod. Packman)
oh shit dudes Posted 11 months ago 11 months
on CVIRO x GXNXVS - Benjamins (LA-NO Remix)
baby Posted 11 months ago 11 months
on Summer Nights [ep]
aaalllll gooooood Posted 11 months ago 11 months
on Summer Nights [ep]
rip me Posted 11 months ago 11 months
on Summer Nights [ep]
srs Posted 11 months ago 11 months on Summer Nights [ep]
heart-melting Posted 11 months ago 11 months
on Summer Nights [ep]
goodness gracious Posted 11 months ago 11 months
on Summer Nights [ep]
monday bumpin; Posted 11 months ago 11 months
on Summer Nights [ep]
sunday lovin; Posted 11 months ago 11 months
on Summer Nights [ep]
caleb... Posted 11 months ago 11 months
on Summer Nights [ep]
slayer Posted 11 months ago 11 months on Dugong Jr - Aliens (feat. +2dB) <3 Posted 11 months ago 11 months on Dugong Jr - Aliens (feat. +2dB)
tasty stuff here Posted 11 months ago 11 months
on LIT
lit Posted 11 months ago 11 months
on LIT
fuck af Posted 11 months ago 11 months
on LIT
serious Posted 11 months ago 11 months
on LIT
doooohh Posted 11 months ago 11 months
on LIT l i t ! Posted 11 months ago 11 months
on LIT
how do you have that much control over your lips Posted 11 months ago 11 months
on MATCH FREESTYLE
dank Posted 11 months ago 11 months
on MATCH FREESTYLE
rawwww Posted 11 months ago 11 months
on MATCH FREESTYLE
golly Posted 11 months ago 11 months
on MATCH FREESTYLE
yes i am Posted 11 months ago 11 months on A Soundcloud Beat You Can Take Home And Introduce To Your Parents god damn it this is beautiful Posted 11 months ago 11 months
on aurora
so alive Posted 11 months ago 11 months
on aurora
lawd Posted 11 months ago 11 months
on aurora
steelixx as fuck Posted 11 months ago 11 months on Those Were The Days (featuring Natey & Ru AREYOU)
beautiful Posted 11 months ago 11 months
on chorus howl
help Posted 11 months ago 11 months
on chorus howl
where am i Posted 11 months ago 11 months
on Leaf - Money (TroyBoi Remix)
this is legit af troyboi Posted 11 months ago 11 months
on Existentiality (Demo)
digging it fam Posted 11 months ago 11 months
on fly
@cavalierbeats: picc up tha pace Posted 11 months ago 11 months
on fly
dude Posted 11 months ago 11 months
on dahlia
what Posted 11 months ago 11 months
on dahlia
mad ill Posted 11 months ago 11 months
on dahlia was weary at first but daaaaamn Posted 11 months ago 11 months
on AKA Yung shrimp
savage Posted 11 months ago 11 months
on Blurry
this is dope Posted 11 months ago 11 months
on We Will Rise
sicccc Posted 11 months ago 11 months
on We Will Rise
awaveofchillhearings Posted 11 months ago 11 months
on f l u i d w/ swvde.
jandro you're a killa Posted 11 months ago 11 months on f l u i d w/ swvde. bassline got my emotions rolling Posted 11 months ago 11 months
on LateSpring
really enjoyed this! Posted 11 months ago 11 months
on kiwi, with halpe
huge as fuck Posted 1 year ago 1 year
on Cream Supreme
like your style family Posted 1 year ago 1 year
on Edge
i dig v much Posted 1 year ago 1 year
on Edge
delicate & elegant Posted 1 year ago 1 year on Edge ypooooo this is out of this world!!! sick chords toooo Posted 1 year ago 1 year
on Serenity
lovely <3 Posted 1 year ago 1 year
on Serenity
asmr af Posted 1 year ago 1 year
on Serenity
this goes Posted 1 year ago 1 year
on Serenity
breeeeehhhhhh Posted 1 year ago 1 year
on HAlR (crapface x taco emoji)
this bannnnngs Posted 1 year ago 1 year on beauty unit.
insty Posted 1 year ago 1 year
on illest
super dope Posted 1 year ago 1 year
on strike a match
good god Posted 1 year ago 1 year
on Prisma (whip)
tight Posted 1 year ago 1 year
on Prisma (whip) bro u got ideas flowing out your ass Posted 1 year ago 1 year
on Euphoria - Free beat by Thovo
smuth Posted 1 year ago 1 year
on stop time mastaaaaa Posted 1 year ago 1 year
on stop time
we should all stop trying Posted 1 year ago 1 year on Euphoria - Free beat by Thovo
love this direction Posted 1 year ago 1 year
on Coven (W/ trn 99)
guh Posted 1 year ago 1 year
on Coven (W/ trn 99)
i am deep rn Posted 1 year ago 1 year
on Just Let It
v cool!! Posted 1 year ago 1 year
on Just Let It wicked bass stories Posted 1 year ago 1 year
on Tony Ozier - Back To The Mitten
mmmm Posted 1 year ago 1 year
on Tony Ozier - Back To The Mitten
aye Posted 1 year ago 1 year
on Tony Ozier - Back To The Mitten
bro man your majesty Posted 1 year ago 1 year
on #SummaStank
snazzy Posted 1 year ago 1 year
on satan got dropped at prom
@tyleraparker: hahah throwbacc Posted 1 year ago 1 year
on Gatorade Ft. Kayge Calypso
@y4nn: <3<3 Posted 1 year ago 1 year
on I fall in love, too easily
f u x xx Posted 1 year ago 1 year
on I fall in love, too easily
jbaby byabyabyaby baby!! Posted 1 year ago 1 year
on balamari
@rndysvge: we gon hook boy Posted 1 year ago 1 year
on theres still us
holy smokes boy boy Posted 1 year ago 1 year
on balamari
damn randy you savage Posted 1 year ago 1 year
on Anax
<3<3<3 Posted 1 year ago 1 year
on Anax
behold Posted 1 year ago 1 year
on Gatorade Ft. Kayge Calypso
mad Posted 1 year ago 1 year
on Gatorade Ft. Kayge Calypso
stick a fork in me Posted 1 year ago 1 year
on anewplace
this is tight bro Posted 1 year ago 1 year on drifting [sophie meiers x samsin]
holy moly Posted 1 year ago 1 year
on vibrant ft. falcxne
ya done good boys Posted 1 year ago 1 year on Araatan ft. Sohight & Cheevy - Curiosity
this is definitely the best track i've ever heard Posted 1 year ago 1 year
on i'm trying
yeeeeeeeeeeeees :DDDDDDD Posted 1 year ago 1 year
on i'm trying
dang neville Posted 1 year ago 1 year on The Boondocks Soundtrack - Huey And Riley Vs The Hateocracy
damn this is actually sick Posted 1 year ago 1 year
on Bitches in my phone [prod ~ @lilskys]
dang Posted 1 year ago 1 year
on omniboi - Officer Jay
<3 Posted 1 year ago 1 year on omniboi - Officer Jay boy oh boy this lead got that warm embrace Posted 1 year ago 1 year
on omniboi - Officer Jay
ie tunes Posted 1 year ago 1 year
on omniboi - Officer Jay
smoooooth Posted 1 year ago 1 year
on omniboi - Officer Jay
checking into hotel omni indefinitely Posted 1 year ago 1 year
on Mo Vibez & Ohsun - Talk To Me
spectacular Posted 1 year ago 1 year
on olli - good morning, me
hnggg Posted 1 year ago 1 year on olli - you'll forget me, i'll forget you
o l l l l l l l l l i Posted 1 year ago 1 year on Creepa & Blake Skowron - Lucky Strike
mighty Posted 1 year ago 1 year
on whereisalex - ghost pt.2
chargin Posted 1 year ago 1 year
on Lege Kale & Ordnry Yngstr - Values
fucking sick Posted 1 year ago 1 year
on Lege Kale & Ordnry Yngstr - Values
collab game nuclear fam Posted 1 year ago 1 year
on Jedi Jordan - Satellite
love Posted 1 year ago 1 year
on Jedi Jordan - Satellite i feel like i'm being sacrificed Posted 1 year ago 1 year
on swell - i want to take you everywhere
supreme Posted 1 year ago 1 year
on swell - i want to take you everywhere
@oylo: clap Posted 1 year ago 1 year
on swell - i want to take you everywhere
smiled hard when that clip appeared Posted 1 year ago 1 year
on swell - i want to take you everywhere
thank you Posted 1 year ago 1 year
on swell - i want to take you everywhere you're stripping all the anger i built up this week Posted 1 year ago 1 year
on Creepa & No Tv No Radio - Enemy solidified pan Posted 1 year ago 1 year
on Creepa & No Tv No Radio - Enemy
keep riding that new wave you two Posted 1 year ago 1 year
on Creepa & No Tv No Radio - Enemy
ha!! this is so fucking good Posted 1 year ago 1 year
on Creepa & No Tv No Radio - Enemy
good god we gone oriental Posted 1 year ago 1 year
on Creepa & No Tv No Radio - Enemy
these keys tho Posted 1 year ago 1 year
on Creepa & No Tv No Radio - Enemy
guys guys guys Posted 1 year ago 1 year on Jumpman Takedown (El Dembow Prohibido) - DL for original
<3 Posted 1 year ago 1 year on Jumpman Takedown (El Dembow Prohibido) - DL for original
:D:D:D:D Posted 1 year ago 1 year
on Dark Skin Women (Cosmo's Midnight & Swindail Remix)
stunning Posted 1 year ago 1 year
on Dark Skin Women (Cosmo's Midnight & Swindail Remix)
@p-a-n-o: i'm wilin' rn Posted 1 year ago 1 year
on TRU LEE ~ NAH (FREESTYLE) FT. YUGI BOI PROD. JOSH MENCHACA
smoke up Posted 1 year ago 1 year
on too good remix instrumental
#getitrightsoundcloudknowwhoyourrealartistsare Posted 1 year ago 1 year
on too good remix instrumental
this is still flaming hot idgaf Posted 1 year ago 1 year
on too good remix instrumental
u messin wit these drums boy Posted 1 year ago 1 year
on too good remix instrumental
cover art a+ Posted 1 year ago 1 year
on lost
swooopin ass snare Posted 1 year ago 1 year on Say It (feat Kirsten Leigh) [OLSO Remix] - Maru
touch Posted 1 year ago 1 year on Say It (feat Kirsten Leigh) [OLSO Remix] - Maru
have not blinked in 80 seconds Posted 1 year ago 1 year
on Ice Climbers
@dam-of-newera: dawg hahhahahah Posted 1 year ago 1 year
on double a's ft. Ayorta
dang son Posted 1 year ago 1 year
on double a's ft. Ayorta
this is some fresh ass shit Posted 1 year ago 1 year
on all yours
@its-just-alex: <3<3 Posted 1 year ago 1 year
on questioning boundaries
@indigobeck: facetime me ; ) Posted 1 year ago 1 year on O x y g e n // [Visual_R &_Kickflip]
<3 that sample Posted 1 year ago 1 year on O x y g e n // [Visual_R &_Kickflip]
sick! Posted 1 year ago 1 year on atølla - send it
@phuturecollective: very much' Posted 1 year ago 1 year
on bones ft. domino
@phuturecollective: you have thrown me back Posted 1 year ago 1 year
on ELLIO - Coffee
@aos-spartan-001: it's not the hardware that makes good music brother it's the time you put into practicing your craft Posted 1 year ago 1 year
on ELLIO - Coffee
smooooke Posted 1 year ago 1 year
on atølla - send it
just twitched from a spine chill Posted 1 year ago 1 year
on atølla - send it
jack! Posted 1 year ago 1 year on atølla - send it
can't help my body ummmmhj Posted 1 year ago 1 year
on atølla - send it
oh my god these vocals are pure lust Posted 1 year ago 1 year
on atølla - send it
boy i did not know this existed Posted 1 year ago 1 year
on Ykwo - Miss U
ur like milking me saliva glands Posted 1 year ago 1 year
on Ykwo - Miss U
loving it. well thought out Posted 1 year ago 1 year
on Ykwo - Miss U my goodness this's gotta be at least stratosphere... u call that low earth?? breh i Posted 1 year ago 1 year on Ykwo - Miss U
soft like lever2000 Posted 1 year ago 1 year
on datwheat. - fatigue
!!!!! Posted 1 year ago 1 year
on datwheat. - fatigue
good god u elegant mf Posted 1 year ago 1 year
on datwheat. - fatigue
the sizzle! Posted 1 year ago 1 year
on datwheat. - fatigue
ofuckingkay Posted 1 year ago 1 year
on questioning boundaries
@indigobeck: stop using skype u nerd. sucky ass service Posted 1 year ago 1 year on Where We Gonna Go? (Feat. Gavin Turek)
beautiful Posted 1 year ago 1 year
on chur w/ nekolye
hop Posted 1 year ago 1 year
on Thank_You_Kace[tengu]_wip_notmixed
those rims jfc Posted 1 year ago 1 year
on Always
holy shit Posted 1 year ago 1 year
on 8k
adventure Posted 1 year ago 1 year
on 8k
you really do make ocean jams Posted 1 year ago 1 year on kattie - von
<3<3<3<3<# Posted 1 year ago 1 year
on kattie - von
oh my flipping goodnes c: Posted 1 year ago 1 year
on mvpvche - U Cant
i think one of my lungs just collapsed Posted 1 year ago 1 year
on mvpvche - Bazofia yo i forgot to comment on this track when i listened, but this track on crwn is liiiiiiit Posted 1 year ago 1 year
on mvpvche - U Cant
dope shit Posted 1 year ago 1 year
on mvpvche - U Cant
damn this build got some fucking power Posted 1 year ago 1 year on Jodeci - What About Us (The Kount Edit) (Deeperkay Exclusive Track)
this is t i g h t! Posted 1 year ago 1 year
on what it do (w/ kan-g)
mmm good one <3 Posted 1 year ago 1 year
on Bedrooms
serenade me with that peacefulness Posted 1 year ago 1 year
on Atolla - Bloom
that guitar instr is liviiidddd Posted 1 year ago 1 year
on Glass Arrowhead - Anthem (FREE DOWNLOAD) don't you just love it when a tracks brightens your mood unexpectedly Posted 1 year ago 1 year
on dont fall (plz read description)(prod. ta-ku)
fam Posted 1 year ago 1 year on for derg
is your side acc mura masa Posted 1 year ago 1 year
on for derg
potent Posted 1 year ago 1 year on Y2K & lil aaron―DAMN―umru remix
i'm rubbin my dick 2 this Posted 1 year ago 1 year
on umru―dry spell
r Posted 1 year ago 1 year
on umru―dry spell
e Posted 1 year ago 1 year
on umru―dry spell
t Posted 1 year ago 1 year on umru―dry spell
s Posted 1 year ago 1 year
on umru―dry spell
g Posted 1 year ago 1 year
on umru―dry spell
n Posted 1 year ago 1 year
on umru―dry spell
a Posted 1 year ago 1 year
on umru―dry spell
g Posted 1 year ago 1 year on Heartthrob [prod.meltycanon]
bruhhh Posted 1 year ago 1 year
on questioning boundaries @midiboyz: i'd fuck him if i liked men Posted 1 year ago 1 year
on questioning boundaries
@nomiadubs: *indigo beck Posted 1 year ago 1 year
on questioning boundaries
@girmusic: synth e same Posted 1 year ago 1 year
on questioning boundaries
@itsmvpvche: praying for a quick recovery. get better mvpvche Posted 1 year ago 1 year
on questioning boundaries
@nightowlcollective: he too next level i'm tellin ya Posted 1 year ago 1 year
on questioning boundaries
@umru: if umru loves you you've made it Posted 1 year ago 1 year
on questioning boundaries @indigobeck: been a long time since i've been called by anything but oylo Posted 1 year ago 1 year
on Flight
sick Posted 1 year ago 1 year
on Flight good mixture of recognizable elements from several genres Posted 1 year ago 1 year
on questioning boundaries
zane Posted 1 year ago 1 year
on questioning boundaries
audio version of dmt Posted 1 year ago 1 year
on SHILOH DYNASTY - TIFM (Rain Skit Remix)
loveeee Posted 1 year ago 1 year
on I'm sorry (feat. shiloh) @dj-mcchicken: bruh we true swell hipsters Posted 1 year ago 1 year
on I'll Pretend (Feat. Kolada)
<3<3 Posted 1 year ago 1 year
on I'll Pretend (Feat. Kolada)
perfection Posted 1 year ago 1 year
on all yours
@nxp7: hey man! been a minute Posted 1 year ago 1 year
on falcxne - NYC (Interlude)
i really appreciate the download falcxne Posted 1 year ago 1 year
on falcxne - Caly wait holy fucking shit what.... this is an album????? Posted 1 year ago 1 year
on falcxne - Piu Piu whoa now. where'd this come from Posted 1 year ago 1 year
on hey i made a mix 4 u
oh my fucking god Posted 1 year ago 1 year
on can't (w/ guppi)
u r evil Posted 1 year ago 1 year on rilla force - youth (baby) (wntr remix)
killer remix Posted 1 year ago 1 year
on First birthday without a girl
damn son this raw Posted 1 year ago 1 year
on Decisions
deep conga Posted 1 year ago 1 year
on Lucian - Drift (feat. Sleeper)
cute!! Posted 1 year ago 1 year
on all yours
@officialloki: thanks bruh, love you Posted 1 year ago 1 year
on all yours
@hashtagraps: thanks bruh! you still at CSU? i haven't seen you in a minute Posted 1 year ago 1 year
on introduction to waterboi
bruhhhhhh don't tell me.... Posted 1 year ago 1 year
on Cosmology (Live 5/29/16)
lemme check out the other live sessions from u gyuys Posted 1 year ago 1 year
on Cosmology (Live 5/29/16)
this is my third listen. still golden. Posted 1 year ago 1 year
on sophie meiers - cigarette kisses
whewwww Posted 1 year ago 1 year
on sophie meiers - cigarette kisses
oh my Posted 1 year ago 1 year
on Intro
funk fresh feelins Posted 1 year ago 1 year
on Intro
oh god that brass <3<3<3 Posted 1 year ago 1 year
on Cosmology (Live 5/29/16)
hoppin Posted 1 year ago 1 year
on Cosmology (Live 5/29/16)
loving this Posted 1 year ago 1 year
on Cosmology (Live 5/29/16) if only i could actually play live music Posted 1 year ago 1 year
on Elona - Skies
ain't even finish this track yet* Posted 1 year ago 1 year
on Elona - Skies bruh why giving me notifications. ain Posted 1 year ago 1 year
on Elona - Skies
oh snap Posted 1 year ago 1 year
on in time
jungle Posted 1 year ago 1 year
on in time
sweet Posted 1 year ago 1 year
on french w/ sophie meiers
... Posted 1 year ago 1 year on NAJI & RNDY - Brushes
mad percussion Posted 1 year ago 1 year
on NAJI & RNDY - Brushes
this dark Posted 1 year ago 1 year
on NEST!
bb Posted 1 year ago 1 year
on NEST! the pan is deconstructing my brain Posted 1 year ago 1 year
on NEST!
bruh is that a cat Posted 1 year ago 1 year
on Zotti - Moon
monstrous Posted 1 year ago 1 year on Zotti - Moon
mans u evil Posted 1 year ago 1 year
on Zotti - Moon
daaaaaaamn daniel Posted 1 year ago 1 year
on Zotti - Moon
@ngomusic: l0000l Posted 1 year ago 1 year
on Zotti - Moon
what the fucjk' Posted 1 year ago 1 year
on Zotti - Moon
goodness... Posted 1 year ago 1 year
on Montell2099 - Apply
@i-001: ur not foolin' me Posted 1 year ago 1 year on Far Away
slams Posted 1 year ago 1 year
on Far Away
kept it real collected and classy. lovin it Posted 1 year ago 1 year
on Far Away closest neighbor is 200 ft away and i'm pretty sure they can hear this kick Posted 1 year ago 1 year
on Far Away
i wish i could move my body as sharply as my mind imagines myself moving it Posted 1 year ago 1 year
on Far Away
plenty o vibez Posted 1 year ago 1 year
on throwaway lounge beat so much sass & swing in this cashmere pluck melody omfg Posted 1 year ago 1 year on throwaway lounge beat
<3<3<3<3<3<3 Posted 1 year ago 1 year
on David Sabastian - Ride The Wave (feat. ANTI PoP)
sick Posted 1 year ago 1 year
on David Sabastian - Ride The Wave (feat. ANTI PoP)
oh shit then Posted 1 year ago 1 year
on LUCY (Just Another Night) i always move my head/neck a specific way when i hear this part Posted 1 year ago 1 year
on HILTON (3AM) [Prod. Taylor $upreme]
electric silk Posted 1 year ago 1 year
on HILTON (3AM) [Prod. Taylor $upreme]
<3 Posted 1 year ago 1 year on HILTON (3AM) [Prod. Taylor $upreme] damn dawg did you write this that day you were in atlanta? Posted 1 year ago 1 year
on HILTON (3AM) [Prod. Taylor $upreme]
oh man this that night time ridin track Posted 1 year ago 1 year
on HILTON (3AM) [Prod. Taylor $upreme]
get that shit yall Posted 1 year ago 1 year
on MAGIC [Prod. Taylor $upreme]
fuck yes Posted 1 year ago 1 year
on MAGIC [Prod. Taylor $upreme]
smooth as fuck Posted 1 year ago 1 year
on MAGIC [Prod. Taylor $upreme]
you're generating power Posted 1 year ago 1 year on PULL UP [Prod. K Swisha]
dang son. haha Posted 1 year ago 1 year
on PULL UP [Prod. K Swisha]
why i oughta skrr Posted 1 year ago 1 year
on PULL UP [Prod. K Swisha]
clapboooooooooo Posted 1 year ago 1 year
on PULL UP [Prod. K Swisha] are you hearing the same shit i'm hearing Posted 1 year ago 1 year
on PULL UP [Prod. K Swisha]
you have my friend Posted 1 year ago 1 year
on PULL UP [Prod. K Swisha]
wooah Posted 1 year ago 1 year
on NUMBERS [Prod. Buck Nasty] $ $ $ Posted 1 year ago 1 year on NUMBERS [Prod. Buck Nasty]
meta rap is best rap Posted 1 year ago 1 year on NUMBERS [Prod. Buck Nasty]
rollin up Posted 1 year ago 1 year on NUMBERS [Prod. Buck Nasty]
got dat grime nasT boi Posted 1 year ago 1 year on NUMBERS [Prod. Buck Nasty]
red ticket Posted 1 year ago 1 year on NUMBERS [Prod. Buck Nasty]
lol damn Posted 1 year ago 1 year
on WANNA [Prod. K Swisha] pure Posted 1 year ago 1 year
on WANNA [Prod. K Swisha]
oh my god bro how is your voice capable of this Posted 1 year ago 1 year
on WANNA [Prod. K Swisha]
hooooooooooooooooooweeeee Posted 1 year ago 1 year
on WANNA [Prod. K Swisha]
damn 2 catchy Posted 1 year ago 1 year
on WANNA [Prod. K Swisha]
that paaaaaaaaan Posted 1 year ago 1 year
on WANNA [Prod. K Swisha]
gugaahgaaaah Posted 1 year ago 1 year
on INTRODUCTION [Prod. Let That Boy Cook] i'm going to shit my fucking pants dawson what the hell Posted 1 year ago 1 year on INTRODUCTION [Prod. Let That Boy Cook]
good god Posted 1 year ago 1 year on INTRODUCTION [Prod. Let That Boy Cook]
daaaaamn ride that shit Posted 1 year ago 1 year on INTRODUCTION [Prod. Let That Boy Cook]
yes you are fam Posted 1 year ago 1 year on INTRODUCTION [Prod. Let That Boy Cook]
#20yroldsreppin Posted 1 year ago 1 year on INTRODUCTION [Prod. Let That Boy Cook]
2016 Posted 1 year ago 1 year on INTRODUCTION [Prod. Let That Boy Cook]
h o t d a m n Posted 1 year ago 1 year
on Thomas White - Drunk Mind, Sober <3 (with RYAN Playground)
this is definitely the best thing i've heard today Posted 1 year ago 1 year
on Thomas White - Drunk Mind, Sober <3 (with RYAN Playground)
good god!! that snare Posted 1 year ago 1 year
on Thomas White - Drunk Mind, Sober <3 (with RYAN Playground)
unique shit!!! Posted 1 year ago 1 year
on Onnanoko - Stay (Hercelot Remix)
baby manitee squeals Posted 1 year ago 1 year
on Onnanoko - Stay (Hercelot Remix) i love how diverse each section of the song is. everything still fits together but there's such a huge variety! <3 Posted 1 year ago 1 year
on Onnanoko - Stay (Hercelot Remix)
dude this got me unwinding af Posted 1 year ago 1 year on Onnanoko - Stay (Hercelot Remix)
incredible Posted 1 year ago 1 year on Onnanoko - Stay (Hercelot Remix)
hercelot...... Posted 1 year ago 1 year on Onnanoko - Stay (Hercelot Remix)
w h o a Posted 1 year ago 1 year
on nulabee - Suspended Islands
super pumped Posted 1 year ago 1 year
on nulabee - Suspended Islands
very nice piece of work Posted 1 year ago 1 year
on Goodbye w/ So Sus
well golly Posted 1 year ago 1 year on pensar azul pensando celeste
u dazzlin me Posted 1 year ago 1 year
on cnt trust
sex Posted 1 year ago 1 year
on Happy Go Lady
swoonin Posted 1 year ago 1 year
on Anita's Song (Early Edit)
god damn Posted 1 year ago 1 year
on Nightfall w/ James Gent
i a m g o i n g t o c r y s t o p i t Posted 1 year ago 1 year
on Nightfall w/ James Gent this makes me wanna make something like this Posted 1 year ago 1 year on Nightfall w/ James Gent oh my <3<3<3 so sweet and happy Posted 1 year ago 1 year
on MADBLISS KIT 2 50% OFF!!!!!
@thatyoungboyv: hahahahah Posted 1 year ago 1 year
on MADBLISS KIT 2 50% OFF!!!!!
crushing my soul\ Posted 1 year ago 1 year
on take/give
hit em wit that stun grenade fam Posted 1 year ago 1 year
on take/give
stunned me Posted 1 year ago 1 year
on take/give
insaneeeee Posted 1 year ago 1 year on take/give
u got finesse tho Posted 1 year ago 1 year
on take/give
is this real Posted 1 year ago 1 year
on i wanna be a superhero ft. icy dave (p. vague001) came to this tab to see why this stopped playing lol it's over Posted 1 year ago 1 year
on Anapola
so fluid c: Posted 1 year ago 1 year
on eugene cam x meltycanon - BASTION
uryb ¨ˆov qt8pthr84 nrø√†hdgfA N h elp Posted 1 year ago 1 year
on eugene cam x meltycanon - BASTION
this fucking kick flexing the walls of my house Posted 1 year ago 1 year
on eugene cam x meltycanon - BASTION my dudes Posted 1 year ago 1 year on gnash - i hate u, i love u feat. olivia o'brien (james yammouni remix)
cute Posted 1 year ago 1 year
on Yosi Horikawa "Bump"
appreciate it when i hear i nice & different tune Posted 1 year ago 1 year
on WDYW
live Posted 1 year ago 1 year
on 3lo & James Bryce - Entropy
@oylo: who has @nua-1 @nua-2 @nua-3 @nua-4 and @nua-5 ? Posted 1 year ago 1 year
on 3lo & James Bryce - Entropy
@nua-6: (n˘v˘•)¬ don't flatter me fam Posted 1 year ago 1 year on 3lo & James Bryce - Entropy
@phuturecollective: x10000000000 Posted 1 year ago 1 year
on 3lo & James Bryce - Entropy was holding my breath so i could hear everything with no interference Posted 1 year ago 1 year
on nighttime stroll
$$ Posted 1 year ago 1 year
on nighttime stroll
lord have mercy Posted 1 year ago 1 year
on hawaiian cocaine ft zeina
man i adore those plucks Posted 1 year ago 1 year
on :-/
<3<3 Posted 1 year ago 1 year on Ո
sick Posted 1 year ago 1 year
on Ո
love me some anime titty Posted 1 year ago 1 year
on don't leave me alone
my heart is crying Posted 1 year ago 1 year
on Indica - Back On Drugs (prod. VAGUE001)
spooky Posted 1 year ago 1 year
on Always Yours
98/100 A+ Posted 1 year ago 1 year
on Fanshore X AJMW - Linear
<3 this is wonderful. soothing to the ear Posted 1 year ago 1 year
on Hailstorm snazzy Posted 1 year ago 1 year
on subsistence (w/ methone)
<3<3 Posted 1 year ago 1 year
on Euphoria (Instrumental)
royal Posted 1 year ago 1 year
on We Need Love w/vbnd
huh Posted 1 year ago 1 year on XELΛRΛIN - Views From The Basement(Original)[Free DL]
damn dude dayuumm Posted 1 year ago 1 year
on introduction to waterboi
that was tight Posted 1 year ago 1 year
on introduction to waterboi haha holy fuck Posted 1 year ago 1 year
on not a single question?
@soonshineme: hahah been there Posted 1 year ago 1 year
on zero
what the fuck Posted 1 year ago 1 year
on zero
good lord Posted 1 year ago 1 year
on zero
dude Posted 1 year ago 1 year
on zero
am i really hearing this Posted 1 year ago 1 year
on what was it worth? this reminds me of some song i downloaded years ago named samurai. i don't have anything tagged but the title... but i still love that song, and this is like an evolved version with much better mastering and cleaner vocals Posted 1 year ago 1 year
on jinu. - epoch (trash)
illicit Posted 1 year ago 1 year
on jinu. - epoch (trash)
these 808s are dope Posted 1 year ago 1 year
on blackliquor
: ) : ) Posted 1 year ago 1 year
on quiet nights.
that track is wonderful Posted 1 year ago 1 year
on idc..?
hot Posted 1 year ago 1 year
on matter evil Posted 1 year ago 1 year
on Zero Tep & Arfus - Diamond Solar Cell
industrial venture Posted 1 year ago 1 year
on Superb Lyres - Sober
su...perb...... Posted 1 year ago 1 year on Kaiydo - refleKtions (prod by dKthepunisher)
!~ <3 love <3 ~! Posted 1 year ago 1 year
on Dion Timmer - Wanna B In Luv
bitch we hoppin now Posted 1 year ago 1 year
on Tropicana
so g Posted 1 year ago 1 year
on Tropicana navajo Posted 1 year ago 1 year
on Tropicana
hard as fuck Posted 1 year ago 1 year
on Sonne III (w/Szunaka) your percs carryin a lot of flavor right here Posted 1 year ago 1 year
on Tiber - Misunderstood w/ Falcxne
omfd Posted 1 year ago 1 year
on Tiber - Misunderstood w/ Falcxne
g Posted 1 year ago 1 year
on Tiber - Misunderstood w/ Falcxne
b Posted 1 year ago 1 year
on Tiber - Misunderstood w/ Falcxne
bubly Posted 1 year ago 1 year
on Mauro Valdemi & Symbiose - Be Unchained (Ft. Kokoflo)
: ) homely Posted 1 year ago 1 year
on STAY
on some serious shit right now Posted 1 year ago 1 year
on Sunset (feat. EZRA)
tighter than virgin poontang Posted 1 year ago 1 year
on Mr.Carmack - Reassurance - Insecurity (Adustio remix)
cute melody : ) Posted 1 year ago 1 year
on Safe and sound this is the most relaxing thing i've heard in a long time Posted 1 year ago 1 year
on Safe and sound
<3<3<3<3 Posted 1 year ago 1 year
on The Internet - Get Away (ADUSTIO remix)
mad clean Posted 1 year ago 1 year
on TREES
420 Posted 1 year ago 1 year
on Save Me hmu if you wanna collab. this shit is amazing Posted 1 year ago 1 year
on Save Me
gorgeous Posted 1 year ago 1 year
on Save Me
oh fuck <3 Posted 1 year ago 1 year
on Oshi ft Branigel - Hurricane
i feel it Posted 1 year ago 1 year on Nu Disco
oh my Posted 1 year ago 1 year
on Sustain the Illusion (RMX) tons of emotion on those bg fx Posted 1 year ago 1 year
on Sustain the Illusion (RMX)
damn dude trill hi hats Posted 1 year ago 1 year
on The High Life
evil drop Posted 1 year ago 1 year on vbnd - i wanna know (feat. tola)
i feel this in my bones Posted 1 year ago 1 year
on A Walk to Remember
i like how inventive you are Posted 1 year ago 1 year on sadboy anthem
right on Posted 1 year ago 1 year
on Back it up
mysterious Posted 1 year ago 1 year on "crush" with amy axegale.
$$$ Posted 1 year ago 1 year
on juju
intense Posted 1 year ago 1 year
on juju
it's cooking in here Posted 1 year ago 1 year
on juju
holy shit Posted 1 year ago 1 year on technicolour
soft & elegant. good shit Posted 1 year ago 1 year
on Charons Cacophony
eastghost woke Posted 1 year ago 1 year
on shamana & SwuM - Tsunami just copped. didn't know this existed. thanks guys <3 Posted 1 year ago 1 year
on joy
this Posted 1 year ago 1 year
on the triumph of neptune (ft. hellion)
<3 Posted 1 year ago 1 year
on the triumph of neptune (ft. hellion)
i like where this is heading Posted 1 year ago 1 year
on Private Island (ft. a l l i e) jungle Posted 1 year ago 1 year
on Only Human
those rides are sweet Posted 1 year ago 1 year
on Only Human
@dominosmusic: we sure can Posted 1 year ago 1 year
on 3lo & James Bryce - Serenity fucking hell. this lead got me erect Posted 1 year ago 1 year
on 3lo & James Bryce - Serenity
grrrahtahtahtah Posted 1 year ago 1 year
on 3lo & James Bryce - Serenity
hahahahah still not over that Posted 1 year ago 1 year
on 3lo & James Bryce - Serenity noooooooooo!!!!!! hahhahahhahahah Posted 1 year ago 1 year
on 3lo & James Bryce - Serenity
sexual Posted 1 year ago 1 year
on 3lo & James Bryce - Entropy
what a wonderful wonderful world Posted 1 year ago 1 year
on 3lo & James Bryce - Entropy
can't breathe Posted 1 year ago 1 year
on 3lo & James Bryce - Entropy
do i even have to say anything Posted 1 year ago 1 year
on 3lo & James Bryce - Entropy
beyond well done Posted 1 year ago 1 year
on 3lo & James Bryce - Entropy
you all have reached the summit Posted 1 year ago 1 year
on cereal
where does it come from Posted 1 year ago 1 year
on cereal how are you guys making stuff like this Posted 1 year ago 1 year
on game over!
:):):):) dang Posted 1 year ago 1 year
on First birthday without a girl
new sound Posted 1 year ago 1 year
on Mood
good feels all around Posted 1 year ago 1 year
on field [jinsang x jasperino]
coffeeshopsmooth Posted 1 year ago 1 year
on asmote ain't no one too meta for the oylster Posted 1 year ago 1 year
on Joymance Feat Zeroni prod by JWT
way different. good looks Posted 1 year ago 1 year
on Migrate
b o y Posted 1 year ago 1 year
on Paradise
swag Posted 1 year ago 1 year
on Paradise
this man knows the formula Posted 1 year ago 1 year
on TWO STOMP
o.o Posted 1 year ago 1 year on soda city funk thanks for the free dl Posted 1 year ago 1 year
on soda city funk
god damnit Posted 1 year ago 1 year
on methone - Surreal
experiential Posted 1 year ago 1 year
on methone - Surreal
solid!! Posted 1 year ago 1 year
on EXPLICIT (prod. R7)
stay lit Posted 1 year ago 1 year
on unhappy
dude Posted 1 year ago 1 year on zen
every time <3 Posted 1 year ago 1 year
on Padillion - Skin Tone
great shit man Posted 1 year ago 1 year
on Padillion - Skin Tone
yeeeesss Posted 1 year ago 1 year
on Padillion - Skin Tone
u got a smile out of me Posted 1 year ago 1 year on BULMA (MUSIC VIDEO IN DESCRIPTION) [Prod. Ricky Hernandez]
ill Posted 1 year ago 1 year on BULMA (MUSIC VIDEO IN DESCRIPTION) [Prod. Ricky Hernandez]
hair standing up on the back of my neck Posted 1 year ago 1 year on Hurry 3.0
spectacular Posted 1 year ago 1 year
on Hurry 3.0
mix game halpetron4000 Posted 1 year ago 1 year
on Hurry 3.0
hahah eplah Posted 1 year ago 1 year
Ͷ͚͚ͧ͢Ӯኴת / / on The-World-Without-Me
lovely Posted 1 year ago 1 year
Ͷ͚͚ͧ͢Ӯኴת / / on The-World-Without-Me
it's other wordly Posted 1 year ago 1 year
on Do You... ft. puhham
this sub bass holy Posted 1 year ago 1 year
on Cheech & Chong yeah i'm pumpin' my arms so what Posted 1 year ago 1 year
on Cheech & Chong look into the myrror, what do you see? Posted 1 year ago 1 year
on ଛᐰ΄᭄
cute! Posted 1 year ago 1 year
on trust me (w/ DIlIP)
smackkkk Posted 1 year ago 1 year
on trust me (w/ DIlIP)
rippin' Posted 1 year ago 1 year
on trust me (w/ DIlIP)
guh Posted 1 year ago 1 year on AUFL - Tonight Ft. Floyd (Prod. By Cresce) 10/10 Posted 1 year ago 1 year
on AUFL - Tonight Ft. Floyd (Prod. By Cresce)
cresce dude chill on these hats man sheesh Posted 1 year ago 1 year
on AUFL - Tonight Ft. Floyd (Prod. By Cresce)
super catchy Posted 1 year ago 1 year
on AUFL - Tonight Ft. Floyd (Prod. By Cresce)
this is dope Posted 1 year ago 1 year
on AUFL - Tonight Ft. Floyd (Prod. By Cresce) whoaaaa that bass sass hahah come @ again boi Posted 1 year ago 1 year
on AUFL - Tonight Ft. Floyd (Prod. By Cresce)
autotune coming back hard Posted 1 year ago 1 year
on AUFL - Tonight Ft. Floyd (Prod. By Cresce)
loooove the chords you've got going Posted 1 year ago 1 year
on brazilian girls [remixed w/ Wun Two]
@skug-1: about right Posted 1 year ago 1 year
on brazilian girls [remixed w/ Wun Two] super smooth. like nicaraguan thighs Posted 1 year ago 1 year
on No Connection w/ Traxell
: ) Posted 1 year ago 1 year
on No Connection w/ Traxell
real tight dude Posted 1 year ago 1 year
on lifeline
damn those swords are eerie Posted 1 year ago 1 year
on lifeline
fuck Posted 1 year ago 1 year
on lifeline
omg Posted 1 year ago 1 year
on lifeline
filth Posted 1 year ago 1 year
on lifeline
dirt Posted 1 year ago 1 year
on Lose It
raw Posted 1 year ago 1 year
on Gold
mad dope Posted 1 year ago 1 year
on arenas. those hats got my head spinnin Posted 1 year ago 1 year on arenas.
fire! Posted 1 year ago 1 year
on J.Robb - Battle 2
sliiick Posted 1 year ago 1 year
on Vei - Mind
i like it fam Posted 1 year ago 1 year
on WORKING
my man. hype mag!! Posted 1 year ago 1 year on Dreams (Produced by: Mezzo)
breh Posted 1 year ago 1 year on Dreams (Produced by: Mezzo)
got a fresh retro feel Posted 1 year ago 1 year on ESCPE - Light
magical percussion cove Posted 1 year ago 1 year
on Tibe - Mist
aw hell Posted 1 year ago 1 year
on A-Team (remix)
holy shit Posted 1 year ago 1 year
on Ark Patrol - Soirée ark patrol you are so diverse. but everything is always solid. great quality to have. keep it up Posted 1 year ago 1 year
on Fragile (feat. Hailee Steinfeld)
ooh ooh oohh Posted 1 year ago 1 year
on Genshin - Night Out.
fresh Posted 1 year ago 1 year on Genshin - Night Out.
i am liking your style Posted 1 year ago 1 year
on PREY PROD. TRBLD BOY
slaughter Posted 1 year ago 1 year
on weekend fling
ok damn Posted 1 year ago 1 year
on weekend fling
<3 Posted 1 year ago 1 year
on weekend fling
oh u think u cute huh Posted 1 year ago 1 year
on dojo. - COURTS good 2 see ya on trap brother! Posted 1 year ago 1 year on Justin Trax - Fade Away
this track is tall af Posted 1 year ago 1 year
on Lawrence
trippy Posted 1 year ago 1 year
on sam gellaitry ~ nah (prime redo)
@prime: onomatopoeia Posted 1 year ago 1 year
on missed calls dang i don't think i've heard this?? Posted 1 year ago 1 year
on buy u a drank
buy it' Posted 1 year ago 1 year on J.K. The Reaper - Exodia (jam edit)
this hard tho Posted 1 year ago 1 year on J.K. The Reaper - Exodia (jam edit) my dad bought me a japanese set off ebay and thought i wouldn't notice... Posted 1 year ago 1 year
on J.K. The Reaper - Exodia (jam edit)
that sass pitch bend Posted 1 year ago 1 year
on Sound Patrol & VDG - Paper Wings (Feat. Voia)
@sound-patrol: yall Posted 1 year ago 1 year
on Sound Patrol & VDG - Paper Wings (Feat. Voia)
voia Posted 1 year ago 1 year
on Sound Patrol & VDG - Paper Wings (Feat. Voia)
:):):):) Posted 1 year ago 1 year
on Sound Patrol & VDG - Paper Wings (Feat. Voia)
hello. hey Posted 1 year ago 1 year
on Will & Peezy - Who Would've Thought? (prod. [ocean jams]) fuc Posted 1 year ago 1 year
on Will & Peezy - Who Would've Thought? (prod. [ocean jams])
unwind Posted 1 year ago 1 year
on Robokid, AObeats & Manila Killa - Helix 2.0 (feat. Blaise Railey)
fuck this clean Posted 1 year ago 1 year
on Robokid, AObeats & Manila Killa - Helix 2.0 (feat. Blaise Railey)
#truth Posted 1 year ago 1 year
on No Love ft. TLC
crazy sampling Posted 1 year ago 1 year
on No Love ft. TLC holy shit!! haven't seen dr. fresch in a good minute! glad to see he's still banging af Posted 1 year ago 1 year
on Jai Wolf - Drive (feat. Chain Gang of 1974) @oylo: compilation Posted 1 year ago 1 year
on Jai Wolf - Drive (feat. Chain Gang of 1974) soundtrack to an uplifting 3rd person dream Posted 1 year ago 1 year
on Awoltalk & Jupe - Young Blood
nice job guys this is dope Posted 1 year ago 1 year
on Awoltalk & Jupe - Young Blood
that b o u n c e e e e e e e Posted 1 year ago 1 year
on Awoltalk & Jupe - Young Blood
can feel happiness seeping through Posted 1 year ago 1 year
on Dabow - Roses
hebinomichi always killin Posted 1 year ago 1 year
on Dabow - Roses bwoodoodoodwooboo Posted 1 year ago 1 year
on Dabow - Roses this makes me feel like a gangsta Posted 1 year ago 1 year
on Dabow - Roses
bruh that roll Posted 1 year ago 1 year
on Dabow - Roses
got spunk Posted 1 year ago 1 year
on StéLouse & Sober Rob - Science
wonderful composition Posted 1 year ago 1 year
on StéLouse & Sober Rob - Science
adventurous Posted 1 year ago 1 year
on basement
loving it! encasing Posted 1 year ago 1 year
on Ricky Remedy - Get It
fiery Posted 1 year ago 1 year
on Tibe - Mist
@tiberbeats: yes he do Posted 1 year ago 1 year
on Kučka - Honey (medasin redo)
@ledparade: nice sluethin Posted 1 year ago 1 year
on Alibi
this is excellent my friend Posted 1 year ago 1 year on sam gellaitry ~ nah (prime redo)
clip clop Posted 1 year ago 1 year
on 5AM - Wire Forks
i like it Posted 1 year ago 1 year
on 5AM - Wire Forks
son! Posted 1 year ago 1 year
on MALAA - Fade(Masayoshi Iimori Remix)
snare roll afff Posted 1 year ago 1 year
on MALAA - Fade(Masayoshi Iimori Remix)
this is dangerous Posted 1 year ago 1 year
on MALAA - Fade(Masayoshi Iimori Remix) these deep metallic synths sound like a more raw version of some what so not instruments Posted 1 year ago 1 year
on MALAA - Fade(Masayoshi Iimori Remix)
omg Posted 1 year ago 1 year
on Being
boun Posted 1 year ago 1 year
on Being
that sole snare <3 whooo Posted 1 year ago 1 year
on Being
sparkling goodness Posted 1 year ago 1 year
on Glass Arrowhead - Couch Surfing
good stuff man Posted 1 year ago 1 year
on Glass Arrowhead - Couch Surfing
this was the track i stopped on to heat my nail to Posted 1 year ago 1 year
on Saito - ก෭ (tomorrow)
mad cultural bruh Posted 1 year ago 1 year
on Saito - ก෭ (tomorrow) i think i could live a thousand years in the adventure of this loop Posted 1 year ago 1 year
on Bazinga
^^^ Posted 1 year ago 1 year
on Bazinga
cygn.... fucking hell bud Posted 1 year ago 1 year
on Bazinga
how many octaves was that??? 6???? Posted 1 year ago 1 year
on Angels w/ Lit Lords
llloooooooord Posted 1 year ago 1 year on Anderson .Paak - Draft Day Freestyle [Free DL]
unique as shit Posted 1 year ago 1 year on Anderson .Paak - Draft Day Freestyle [Free DL]
daaaaaamn this is sooo good Posted 1 year ago 1 year
on Juan RIOS • verde
thanks friend Posted 1 year ago 1 year
on Juan RIOS • verde
c: Posted 1 year ago 1 year
on Juan RIOS • verde
breath out Posted 1 year ago 1 year
on Juan RIOS • verde
takes dab Posted 1 year ago 1 year
on AUFL - With It (Prod. Cresce & AUFL)
kill Posted 1 year ago 1 year
on AUFL - With It (Prod. Cresce & AUFL) yall feel that evil creepin up your neck? Posted 1 year ago 1 year on Side Note feat. LissA
cool Posted 1 year ago 1 year
on Side Note feat. LissA
:) :) Posted 1 year ago 1 year
on VAGUE001 - fatigue
holy fuck Posted 1 year ago 1 year
on Airwav & Jbell - 100M
<3 Posted 1 year ago 1 year
on EAZYBAKED - Um.. let's go hunt some werewolves Posted 1 year ago 1 year
on desiigner panda acapella
pan Posted 1 year ago 1 year on CHIEFS x Holly - Ether
that went hard Posted 1 year ago 1 year on A Song For You (Prod. by Nique)
@oylo: s Posted 1 year ago 1 year on A Song For You (Prod. by Nique)
@jayduprae: thank dude haha Posted 1 year ago 1 year
on DoubleDaZZle - CLOUD
mix game fire Posted 1 year ago 1 year
on Swordplay ft. Kolada
: ) Posted 1 year ago 1 year
on samsin - origins
loving this Posted 1 year ago 1 year on insidious (w/ alasen)
straight evil Posted 1 year ago 1 year
on insidious (w/ alasen)
mollywhoppin Posted 1 year ago 1 year
on Freedom Fry - Smells Like Teen Spirit (Cover)
those claps got me giddy Posted 1 year ago 1 year
on Freedom Fry - Smells Like Teen Spirit (Cover)
damn this is too good Posted 1 year ago 1 year
on Freedom Fry - Smells Like Teen Spirit (Cover) i don't speak this language but <3<3<3<3<3 Posted 1 year ago 1 year
on graves & Coolights - Say Things
hhnnnnng Posted 1 year ago 1 year
on graves & Coolights - Say Things always love these high background vocal stabs Posted 1 year ago 1 year on snares - Grapes (from EXPEDITion Vol. 9: Ghetto Fills LP)
$$$ Posted 1 year ago 1 year on snares - Grapes (from EXPEDITion Vol. 9: Ghetto Fills LP)
sweet mercy Posted 1 year ago 1 year
on No Tv No Radio - Space (FREE DOWNLOAD)
<3 Posted 1 year ago 1 year
on No Tv No Radio - Space (FREE DOWNLOAD)
very no tv no radio Posted 1 year ago 1 year
on No Tv No Radio - Space (FREE DOWNLOAD)
well u got me already. these chords sexy Posted 1 year ago 1 year
on outstanding tight~ Posted 1 year ago 1 year on FOS 001 Antonio Mendez and Jonah Baseball - Slide In (Yah)
yyyahhhhhhhh Posted 1 year ago 1 year
on FOS 001 Jonah Baseball - Abandoned Ballparks
soundtrack to a dream Posted 1 year ago 1 year
on Cash Carti.
dang dude. really liked that Posted 1 year ago 1 year
on Not A Little Bit
very pretty voice Posted 1 year ago 1 year
on After Midnight/Game Over/Spicehoes
yuss Posted 1 year ago 1 year
on After Midnight/Game Over/Spicehoes
this groove is straight up unstoppable tho Posted 1 year ago 1 year
on After Midnight/Game Over/Spicehoes
you get me Posted 1 year ago 1 year
on After Midnight/Game Over/Spicehoes after after midnight after midnight i'm feeling well prepared to take on game over Posted 1 year ago 1 year
on DROELOE X Busta Rhymes - Dusty Ears
oh my Posted 1 year ago 1 year
on DROELOE X Busta Rhymes - Dusty Ears
explain this!!! howww Posted 1 year ago 1 year
on no intention (prod. najaesbeats)
<3 Posted 1 year ago 1 year
on no intention (prod. najaesbeats)
god damn this is dumb chill Posted 1 year ago 1 year
on Mo & Creepa - Lightspeed
love you two together Posted 1 year ago 1 year
on Mo & Creepa - Lightspeed
screeeeeamin Posted 1 year ago 1 year
on Mo & Creepa - Lightspeed
i wanna fuck the funky Posted 1 year ago 1 year on Shawn Bastard - Motions (Prod. QLOCSOUND)
nicely done. good harmonies Posted 1 year ago 1 year on Shawn Bastard - Motions (Prod. QLOCSOUND)
you got this shit on qlock Posted 1 year ago 1 year
on LULLABY (co. STRNGR.)
i need to get massaged to this track Posted 1 year ago 1 year
on what have I done kanye?
fucking nasty Posted 1 year ago 1 year
on what have I done kanye?
those chops are like a satanic chant Posted 1 year ago 1 year
on So Relatable
pop me open a fresh qt Posted 1 year ago 1 year
on 5. Surpass (Prod. By MadBliss)
own that shit Posted 1 year ago 1 year
on You Could Do Better (w/Ezra Maeve) snares are tears dripping from my chin Posted 1 year ago 1 year
on Don't Stop
mystical Posted 1 year ago 1 year on Don't Stop
is that how you spell that Posted 1 year ago 1 year
on Don't Stop
whimsical Posted 1 year ago 1 year
on truth/idk (Prod. Raava)
rolll Posted 1 year ago 1 year on what u waiting for rmx ft. alex coco
nice composition Posted 1 year ago 1 year
on Wassup (Prod. DANYAL)
ay this buumps Posted 1 year ago 1 year
on Forest Thing
the light Posted 1 year ago 1 year on Vibin'
smooth sailing Posted 1 year ago 1 year
on Purple
sick as fuck Posted 1 year ago 1 year on rndysvge - getbackbby (verzache rework)
@oylo: still on fire Posted 1 year ago 1 year on rndysvge - getbackbby (verzache rework)
b o y Posted 1 year ago 1 year
on somnium
dude this slams Posted 1 year ago 1 year
on what do u mean
damn this right here is hooot Posted 1 year ago 1 year on what do u mean
@oylo: **sampling of this song Posted 1 year ago 1 year
on what do u mean
@oylo: *edit?? Posted 1 year ago 1 year
on what do u mean
best remix so far?? Posted 1 year ago 1 year
on See You Space Cowboy...
@glass-arrowhead-music: i hear you dawg Posted 1 year ago 1 year
on worth
@enzhexbeats: yyyyy Posted 1 year ago 1 year
on worth
@vranamusic: thanks homie Posted 1 year ago 1 year
on ocarina / lost woods (w/ MISOGI) good lorddd Posted 1 year ago 1 year
on ocarina / lost woods (w/ MISOGI)
dudes Posted 1 year ago 1 year
on ocarina / lost woods (w/ MISOGI)
whoa bro u got raw real quick Posted 1 year ago 1 year
on XYZ
wow guys Posted 1 year ago 1 year
on Kučka - Honey (medasin redo)
genuine Posted 1 year ago 1 year on Feel Me (off 'Home Alone Dance Party' EP)
@falcxne: papa bless <3 Posted 1 year ago 1 year
on Codex nice and relaxing Posted 1 year ago 1 year
on Comodo & Eli Way - Rain
this shit is fast man Posted 1 year ago 1 year
on baby, u and i
lovely work Posted 1 year ago 1 year
on Rgry - Pins
drive them rims dudeeee Posted 1 year ago 1 year on Versace Chobani - Sreams (feat James Lanning)
wickedd Posted 1 year ago 1 year
on unchained
unreal Posted 1 year ago 1 year
on unchained
so much sass Posted 1 year ago 1 year
on unchained
thanks for the the download Posted 1 year ago 1 year
on unchained i don't know what to say. this is breathtaking Posted 1 year ago 1 year
on Peace
that melody always kills me Posted 1 year ago 1 year
on Peace
exquisite Posted 1 year ago 1 year
on flood
tregs Posted 1 year ago 1 year
on Feel Me (off 'Home Alone Dance Party' EP)
i'm feelin Posted 1 year ago 1 year
on 360 No Scope Ft. Lil Traffic
tiiiight snares Posted 1 year ago 1 year
on 360 No Scope Ft. Lil Traffic
1080 never scoped Posted 1 year ago 1 year
on Coast To Coast (deDunamis x Mo Vibez)
c: Posted 1 year ago 1 year
on Coast To Coast (deDunamis x Mo Vibez)
got a smile posted ty Posted 1 year ago 1 year
on Green Thrill Zone Ft. Sensei greeeeeeeeeeen paarrrrrrrrroooooooooott Posted 1 year ago 1 year
on Green Thrill Zone Ft. Sensei
like can't do the breathing motions Posted 1 year ago 1 year on Green Thrill Zone Ft. Sensei
choking on this lyricism Posted 1 year ago 1 year
on Green Thrill Zone Ft. Sensei
fluid Posted 1 year ago 1 year
on Toonorth - Daydreams
nice one man Posted 1 year ago 1 year
on Toonorth - Daydreams
sparkling spectacle Posted 1 year ago 1 year
on drive you crazy
why am i not following you Posted 1 year ago 1 year on Anna Lunoe & Chris Lake - Stomper (The Red Baron Remix)
yyayyyyeeeeeee Posted 1 year ago 1 year on MILK
frickety fresh Posted 1 year ago 1 year
on LOUPO - Warmth
you're square in my book loupo Posted 1 year ago 1 year
on LOUPO - Warmth
attitude Posted 1 year ago 1 year
on Flux Pavilion - I Can't Stop (Ekali Tribute)
great shit ekali Posted 1 year ago 1 year on RÜFÜS DU SOL - You Were Right (Louis Futon Remix)
tickyticky Posted 1 year ago 1 year
on Playing with Fire
this is gorgeous Posted 1 year ago 1 year on Love & Blessings (ft. Deverano)
fancy footwork Posted 1 year ago 1 year on Manila Killa feat. Joni Fatora - All That's Left (Yung Wall Street Remix)
sweet serenity. stress relief synths Posted 1 year ago 1 year
on 3lo x James Gent - Lovr
magnificent Posted 1 year ago 1 year
on Pwr
r.i.p. every artist Posted 1 year ago 1 year
on Pwr
:) Posted 1 year ago 1 year
on Pwr
my ears can't track it fast enoug Posted 1 year ago 1 year on Pwr
hahah guys Posted 1 year ago 1 year
on Pwr
already blown away Posted 1 year ago 1 year
on nessly - still finessin ft night lovell (prod cardogotwings)
bang Posted 1 year ago 1 year
on Elevate (w/ Hoody) i am in love with the sweeping bells/mirrors edge fx stuff. sounds amazing Posted 1 year ago 1 year
on Elevate (w/ Hoody)
paints a beautiful picture Posted 1 year ago 1 year
on COURTS
dij doj boy this is sick Posted 1 year ago 1 year on COURTS
good god that volleyyyyy Posted 1 year ago 1 year
on when i... (prod. j. robb)
okay this pretty dope mang Posted 1 year ago 1 year
on 2 WORK
this is different. i like the pulse Posted 1 year ago 1 year
on killshot w/ explore & mo vibez
level 99 Posted 1 year ago 1 year
on Maybe
it's grooveday Posted 1 year ago 1 year
on INDICA - AHEAD / LEVEL UP (PROD. RYANJACOB)
dang this is too smooth Posted 1 year ago 1 year on In My Room (feat. Ty Dolla $ign & Tyga) (San Holo Remix) spiffy Posted 1 year ago 1 year
on Love Again
mix game prime time televsion Posted 1 year ago 1 year
on ΉΞΠ (biyori) ft emotegi
oh my this guitar Posted 1 year ago 1 year
on Ӏӈӈҽ ҽҺӒӌ
loving it. spring as hell Posted 1 year ago 1 year
on IRL Guest Mix 007: umru
frickin flames Posted 1 year ago 1 year
on IRL Guest Mix 007: umru this mix is more raw than arby's roast beef Posted 1 year ago 1 year
on IRL Guest Mix 007: umru @umru: clint is basically god Posted 1 year ago 1 year
on Travel Bug
damn this most certainly is chill/oriental Posted 1 year ago 1 year
on She breaks my heart again and again
hi hi hi hi hi :)))) Posted 1 year ago 1 year
on She breaks my heart again and again
get it man Posted 1 year ago 1 year
on takeafter
otherworldly Posted 1 year ago 1 year on Sinjin Hawke X Dj Funk - Three Fine Hoes (Mr Fuzz Remix)
hella build Posted 1 year ago 1 year
on under (worst mix but w/e)
huge synths dude Posted 1 year ago 1 year
on under (worst mix but w/e)
sparkling smiles Posted 1 year ago 1 year
on Those Other Things?
so natural Posted 1 year ago 1 year
on Her - Troubled Waters really enjoying your stuff man Posted 1 year ago 1 year
on Nonchalant
you a killa Posted 1 year ago 1 year
on HVOB - Oxid | Full Length
this goes deep Posted 1 year ago 1 year
on chestpain[s]
damnnnn <3<3<3<3<3<3 Posted 1 year ago 1 year
on slowfall
goodness how incredible Posted 1 year ago 1 year
on the rock upon which you once stood
: ) Posted 1 year ago 1 year
on the rock upon which you once stood
damn boy. do that shit Posted 1 year ago 1 year
on GEOTHEORY - Hyper
bold bangin. these my favorite chords forreal Posted 1 year ago 1 year
on Clear (ft. Mothica)
@oylo: call ffrick Posted 1 year ago 1 year
on Clear (ft. Mothica)
@oylo: i guess that's why they called you pusher ayy heyhey Posted 1 year ago 1 year
on Clear (ft. Mothica)
daaamn, pushed this shit to limit Posted 1 year ago 1 year
on Lucid.
mmmm Posted 1 year ago 1 year
on Lucid.
i want to inhale this song Posted 1 year ago 1 year on NESSLY & A$AP ANT (YG ADDIE) ~ SPEED RACING PROD OUTTATOWN
shit i fucked up Posted 1 year ago 1 year on NESSLY & A$AP ANT (YG ADDIE) ~ SPEED RACING PROD OUTTATOWN
gimme a k Posted 1 year ago 1 year on NESSLY & A$AP ANT (YG ADDIE) ~ SPEED RACING PROD OUTTATOWN gimme an n Posted 1 year ago 1 year on NESSLY & A$AP ANT (YG ADDIE) ~ SPEED RACING PROD OUTTATOWN
gimme an a Posted 1 year ago 1 year on NESSLY & A$AP ANT (YG ADDIE) ~ SPEED RACING PROD OUTTATOWN
gimme a d Posted 1 year ago 1 year
on blue tone
beyond cute Posted 1 year ago 1 year
on blue tone
seriously enjoying the fucking shit out of this Posted 1 year ago 1 year
on Spirit Bomb (Instrumental)
boom Posted 1 year ago 1 year
on Ben Maxwell - Feel U you've really come a long way ben Posted 1 year ago 1 year
on Ben Maxwell - Feel U
my heart is beating to these kicks Posted 1 year ago 1 year on Alina Baraz & Galimatias - Show Me (LOKI X Wildfire FLIP)
dawwwwg Posted 1 year ago 1 year
on we can take it slow.
damn alex Posted 1 year ago 1 year
on we can take it slow.
i like you i like this Posted 1 year ago 1 year
on we can take it slow.
daring Posted 1 year ago 1 year
on Ruxell Ft. Robbie Rule - Hands Up mad burnin up in this bitch Posted 1 year ago 1 year on Mark The Beast - Breathe ft Niks (LUZCID Remix)
shit is haaard Posted 1 year ago 1 year
on BLOODSHED ft. VIGGO
run the trap Posted 1 year ago 1 year
on vbnd - always
you're on fire Posted 1 year ago 1 year
on CHIEFS x Holly - Ether
@iam_abz: for certain Posted 1 year ago 1 year
on CHIEFS x Holly - Ether
mind bending Posted 1 year ago 1 year
on CHIEFS x Holly - Ether
god damn Posted 1 year ago 1 year
on Steal This x Xoras - Farsi
@takedatmusic: 2 evil Posted 1 year ago 1 year
on Work you right i'm crying and nutting at the same time Posted 1 year ago 1 year
on swell - you & i
..... Posted 1 year ago 1 year
on Steal This x Xoras - Farsi
u need jesus Posted 1 year ago 1 year
on The Kount - Hey
<3 Posted 1 year ago 1 year
on The Kount - Hey
got this on lock dawg Posted 1 year ago 1 year
on THEY. - Motley Crue (Alizzz Remix)
niiiice Posted 1 year ago 1 year
on Krs. // Georgina ft. Vybz Kartel
spectacular Posted 1 year ago 1 year
on Harrau
sick Posted 1 year ago 1 year
on umru + frstmait―flat earth type beat ft. cassiopée
nailed it Posted 1 year ago 1 year
on Roll With Her
i can roll with this Posted 1 year ago 1 year on Lindsay Lowend & Jonah Baseball - Jeremy's Pet Peeve
nicely done you two Posted 1 year ago 1 year on I Want You (ft Wade)
slayaaa Posted 1 year ago 1 year
on Pure ft. Zeina [Majestic Color]
what a special tune Posted 1 year ago 1 year on What So Not & Ganz - Lone Ft JOY.
you dem boys Posted 1 year ago 1 year
on A room of one's own
smooth n in there for sure Posted 1 year ago 1 year
on XHVIL & Dylan Kidd - Apollo
sick percs Posted 1 year ago 1 year
on XHVIL & Dylan Kidd - Apollo
@thisiscreepa: agreed Posted 1 year ago 1 year on Rilla Force - Hyper Beam
weep weep wepp wepp woeop Posted 1 year ago 1 year
on Rilla Force - Hyper Beam
snick snackin Posted 1 year ago 1 year
on Cresce & Sensi Sye - Unknown
: ") Posted 1 year ago 1 year
on Cresce & Sensi Sye - Unknown
mad chillin on this Posted 1 year ago 1 year
on Otxhello - I am
bruh Posted 1 year ago 1 year
on Otxhello - I am hahaha holy fucking shit you're crazy Posted 1 year ago 1 year on Otxhello - I am
satan Posted 1 year ago 1 year
on Comodo & Eli Way - Rain
<3<3<3 lovely Posted 1 year ago 1 year
on J.Robb - Wasted
j Posted 1 year ago 1 year
on J.Robb - Wasted
fuck Posted 1 year ago 1 year
on J.Robb - Wasted
good god how g Posted 1 year ago 1 year
on J.Robb - Wasted
snare is spankin' Posted 1 year ago 1 year on West1ne & Rilla Force - Platkush good lord Posted 1 year ago 1 year on West1ne & Rilla Force - Platkush
my sub on fire Posted 1 year ago 1 year on West1ne & Rilla Force - Platkush
my boys Posted 1 year ago 1 year
on Akalay & Mo Vibez - Chamas
this is savage Posted 1 year ago 1 year
on Instupendo - Nightviper
certainly Posted 1 year ago 1 year
on Do You Love Me [EP]
ooooh <3 Posted 1 year ago 1 year
on Do You Love Me [EP] loving it so far Posted 1 year ago 1 year on J Dilla - Gangsta Boogie feat. Snoop Dogg & Kokane
straight up Posted 1 year ago 1 year
on Heart, Mind and Soul (Zora Jones Bootleg)
whoa Posted 1 year ago 1 year
on heaven
heavenly Posted 1 year ago 1 year
on Escape To Everest: Kev
:):):) glad to see this Posted 1 year ago 1 year
on Whispa - The Poet
them subtle percs!!! slick Posted 1 year ago 1 year
on Whispa - The Poet
fuck me that is wet Posted 1 year ago 1 year on so now I get it/10 toes (prod. neid)
<3 Posted 1 year ago 1 year on so now I get it/10 toes (prod. neid)
solid Posted 1 year ago 1 year
on Atalho
damn these chords are heavy Posted 1 year ago 1 year
on Gate
son you going verrrry deep Posted 1 year ago 1 year
on Black // FREE DL
slammin Posted 1 year ago 1 year
on Black // FREE DL
bruh that lead tho Posted 1 year ago 1 year
on twelve
r Posted 1 year ago 1 year
on twelve
evil mother fucke Posted 1 year ago 1 year
on oylo - graded
@synchronistic: thanks family Posted 1 year ago 1 year
on oylo - graded
@sam-mccurry-1: boy you think you clever?? hahah Posted 1 year ago 1 year
on 10: UMRU
b o y Posted 1 year ago 1 year
on SCHEMIN'
goodness Posted 1 year ago 1 year on SCHEMIN'
this is some seriously unique shit Posted 1 year ago 1 year
on Alpen
good holy god moly Posted 1 year ago 1 year
on Alpen you're dicing me up into tiny pieces Posted 1 year ago 1 year
on W.I.F.I. (Prod. ICYTWAT)
woooooo Posted 1 year ago 1 year
on good news
man you're evil Posted 1 year ago 1 year
on Losk - Solo
fire Posted 1 year ago 1 year on Losk - Solo
fine dining Posted 1 year ago 1 year
on Ponme un café para dos
cool shit man Posted 1 year ago 1 year on i'm fine i'm fine i'm fine i'm not
oh kalko Posted 1 year ago 1 year on i'm fine i'm fine i'm fine i'm not
:¯( Posted 1 year ago 1 year
on ops, with JonEcks
killed it guys Posted 1 year ago 1 year
on ops, with JonEcks
inventive!! Posted 1 year ago 1 year on Airwav - Grandma's Cookies
mann Posted 1 year ago 1 year
on Airwav - Grandma's Cookies
savage Posted 1 year ago 1 year
on worth ahead of the trend fam hahah holla @ me Posted 1 year ago 1 year
on Parkinson White - Lament of Sif (Remix)
spectacular Posted 1 year ago 1 year
on Mo Vibez - Get It On
that was wild ride Posted 1 year ago 1 year
on dropout
fucking fantastic Posted 1 year ago 1 year
on dropout aka what i'm about to be Posted 1 year ago 1 year
on Mozaic
love it Posted 1 year ago 1 year
on Mozaic damn son this is soaring Posted 1 year ago 1 year
on Healing Waters
shiiiiiiiit Posted 1 year ago 1 year
on Healing Waters
these synths are on fire Posted 1 year ago 1 year
on Healing Waters
deep water Posted 1 year ago 1 year
on silly ho : ) Posted 1 year ago 1 year
on silly ho
serenity Posted 1 year ago 1 year
on deathwish // part II
sick Posted 1 year ago 1 year
on deathwish // part II
im choking Posted 1 year ago 1 year
on play. (prod. maurice moore)
royal Posted 1 year ago 1 year
on play. (prod. maurice moore) this is the cleanest, most high-class fucking thing i have heard all week. quality as hell Posted 1 year ago 1 year
on finesse @fourlore: ^^^ Posted 1 year ago 1 year
on TATSUMAKI SENPAI ! ! !
glad u back it bb Posted 1 year ago 1 year
on Just A Gent • Heavy As A Heartbreak Ft. LANKS (Syntact Remix)
dang good Posted 1 year ago 1 year on Yung Xela - Back On The Move (Prod. Manitee)[Electrostep Network EXCLUSIVE]
hot Posted 1 year ago 1 year
on The Kount - Jupiter
fantastic work Posted 1 year ago 1 year
on RNDYSVGE - Igotwtuneed
always welcome this tune into my ears Posted 1 year ago 1 year
on Resonant Love w/ Enzalla can i cry here Posted 1 year ago 1 year
on flpmde
mode Posted 1 year ago 1 year on rndysvge - getbackbby (verzache rework)
flaming hot Posted 1 year ago 1 year
on Diana | Prod. Killroy
super dope Posted 1 year ago 1 year
on yhats all w/ GRiMM Doza
whaaaaaaaa Posted 1 year ago 1 year
on hüttenparty
i like it a lot Posted 1 year ago 1 year
on Guatemala w/ Ian Ewing
: ) : ) : ) Posted 1 year ago 1 year
on hüttenparty
great work man Posted 1 year ago 1 year
on Gangsta Gangsta ft. Baby Eazy-E (Original Mix)
don't give a fucccc Posted 1 year ago 1 year on golden features - no one feat. thelma plum (coyote kisses remix)
beautiful work Posted 1 year ago 1 year
on SHOWCASE (Original Mix)
you killin this presentation bruh Posted 1 year ago 1 year
on Tostones And Ginger Beer
: ) : ) Posted 1 year ago 1 year
on rocketship
<3<3 Posted 1 year ago 1 year
on 2000
sick tape Posted 1 year ago 1 year
on Right Now
frick Posted 1 year ago 1 year
on six
niaghb489byv˚ Posted 1 year ago 1 year
on six
my oh mighty Posted 1 year ago 1 year
on six you done gone off son Posted 1 year ago 1 year
on westside.
xtreme Posted 1 year ago 1 year on westside. love the crying watery vocal fx, super dope Posted 1 year ago 1 year
on westside.
whoaaaaa that bass backtalkin like fuck Posted 1 year ago 1 year
on westside.
n a s fuckin' t y Posted 1 year ago 1 year
on honest
oh my Posted 1 year ago 1 year
on honest
≤3_ Posted 1 year ago 1 year
on honest
i like it a whole heck of a lot Posted 1 year ago 1 year on honest
i like what you've got here Posted 1 year ago 1 year
on Remember This If Anything
in a fantastic way ofc Posted 1 year ago 1 year
on Remember This If Anything
very thick Posted 1 year ago 1 year
on Mitchell Cohen - Una Nota
fam this is fucking me up like what??? Posted 1 year ago 1 year
on Mitchell Cohen - Una Nota i think i've been holding my breath this whole time Posted 1 year ago 1 year
on Mitchell Cohen - Una Nota
god Posted 1 year ago 1 year on Mitchell Cohen - Una Nota yo i really don't think i can handle this Posted 1 year ago 1 year
on Mitchell Cohen - Una Nota
too dank Posted 1 year ago 1 year
on I N F I N I T Y (love)
bap bap bap Posted 1 year ago 1 year
on I N F I N I T Y (love)
keep on killin friend Posted 1 year ago 1 year
on M Y S T E R I O U S(beta)
fucking sick Posted 1 year ago 1 year
on M Y S T E R I O U S(beta)
bruh this goesss Posted 1 year ago 1 year
on metsä x olmos - Tolerance good god what a nasty synth Posted 1 year ago 1 year
on metsä x olmos - Tolerance
wanna fuck you both Posted 1 year ago 1 year
on metsä x olmos - Tolerance i'm choking from how much this makes my mouth water Posted 1 year ago 1 year
on metsä x olmos - Tolerance these mother fucking snares are tighter than is possible Posted 1 year ago 1 year
on Blazin'
son u are mad ill Posted 1 year ago 1 year
on ill vibe
screeech Posted 1 year ago 1 year
on ill vibe so evil Posted 1 year ago 1 year
on ill vibe
death Posted 1 year ago 1 year
on fizzle (unfinished 2015)
<3<3<3<3<3 Posted 1 year ago 1 year on untitled (unfinished 2014)
man u got some class Posted 1 year ago 1 year on firetruck (unfinished 2014)
& spicy Posted 1 year ago 1 year on firetruck (unfinished 2014)
raw Posted 1 year ago 1 year
on sugar coated (2014)
tight grip Posted 1 year ago 1 year
on Premiere: David Marston & Dan Izco - Giving Up On You feat. Brigitte Zozula (Original Mix)
lock n load Posted 1 year ago 1 year
on acid
nice Posted 1 year ago 1 year
on worth
@bamm-bamm-12348: no problem, add my links please Posted 1 year ago 1 year
on Cashmere Cat - Wedding Bells (kyra flip)
fire Posted 1 year ago 1 year on [Future | Chill Trap] nourish. mix series #1 (200 subs special) by k- pizza
^^^^!!!!! Posted 1 year ago 1 year on [Future | Chill Trap] nourish. mix series #1 (200 subs special) by k- pizza yeaaa Posted 1 year ago 1 year
on Lakes
<3<3 i feel you vox, i feeel you Posted 1 year ago 1 year
on Lakes
what an adventure Posted 1 year ago 1 year
on Lakes you're telling the tallest tale rn oh my Posted 1 year ago 1 year
on Lakes
oh fuck yes. this is my kind of shit Posted 1 year ago 1 year
on sonder [misc. remix] - sober rob
sick Posted 1 year ago 1 year
on sonder [misc. remix] - sober rob me oh my Posted 1 year ago 1 year
on sonder [misc. remix] - sober rob
th hick Posted 1 year ago 1 year
on Spacewalk - Mystery Luv
mystical <3 Posted 1 year ago 1 year
on all matters
loving it Posted 1 year ago 1 year
on all matters
very unique Posted 1 year ago 1 year
on Interlude 2
@dojodojo: <3<3<3<3 sorry for all the notifications Posted 1 year ago 1 year
on Interlude 2
@winstonsound: yeah, that's a go-to strategy. hahah i sound like a ten year old girl Posted 1 year ago 1 year
on Interlude 2
@winstonsound: trust me i've tried so many effects/ combinations of Posted 1 year ago 1 year
on Shine
@8tracklife: don't make these comments fam. it will ruin you Posted 1 year ago 1 year
on Interlude 2
@winstonsound: i literally try on every song i make Posted 1 year ago 1 year
on Interlude 2
@winstonsound: *i wish i could rap and not hate my voice on the final product Posted 1 year ago 1 year
on Time Goes Slow
ooooh me likey Posted 1 year ago 1 year on DIVERSA - underscore - awkward silence ft. oneira
sicked (wicked + sick) Posted 1 year ago 1 year
on The Kount x Memorecks - ADHD
my whole body is feelin this shit Posted 1 year ago 1 year
on Popsiclist
@oylo: damn.... so truu Posted 1 year ago 1 year
on goldlink's flow
smash Posted 1 year ago 1 year
on goldlink's flow
!!!!!! looooord Posted 1 year ago 1 year
on Oh
:):) Posted 1 year ago 1 year on Arms
hard as shit Posted 1 year ago 1 year
on DROELOE - zZz
i like it Posted 1 year ago 1 year
on 20 gauge
actually pretty sick Posted 1 year ago 1 year on Night Swim Radio - 25th Anniversary Show
:) Posted 1 year ago 1 year on Night Swim Radio - 25th Anniversary Show
great mix Posted 1 year ago 1 year on Night Swim Radio - 25th Anniversary Show
righr Posted 1 year ago 1 year
on CV006: NO7iCE - Spring In Rio this is fresh!!!!! Posted 1 year ago 1 year
on Kingbnjmn ~ What I Like (Ft. Krs. & Dutchboy)
@lam_86: take note guys: how not to share your music Posted 1 year ago 1 year
on china
fam Posted 1 year ago 1 year
on china
damn mad trill Posted 1 year ago 1 year
on woods
: ) Posted 1 year ago 1 year
on woods
super fresh vibes over here Posted 1 year ago 1 year
on cloudz i like you Posted 1 year ago 1 year
on cloudz
massaging my eardrums Posted 1 year ago 1 year
on drank
nigga you are wicked wild Posted 1 year ago 1 year
on drank
spectacular Posted 1 year ago 1 year
on i ____ you.
<3<3<3<3<3<3<3<3<3<3<3<3<3<3<333333333333333 3333333333333 nash Posted 1 year ago 1 year
on Feels
@dontmakemusic: hahahahah Posted 1 year ago 1 year
on Selfish @rhoda: you'll get a wide variety that way Posted 1 year ago 1 year on Dave Winnel - Don't Stop (Metro & Proxic Remix)
nicely done Posted 1 year ago 1 year
on Alex G: "Break"
loved it man Posted 1 year ago 1 year
on 3lo - Steps [SOUNDASLEEP Premiere]
fuckin looooove me some god damned 3lo Posted 1 year ago 1 year
on High Pizza Guy
mm mmm mmmm Posted 1 year ago 1 year
on six
goodness gracious. just lovely Posted 1 year ago 1 year
on six
yup!! Posted 1 year ago 1 year
on a 3d girl
: ) Posted 1 year ago 1 year
(ߝ (follow me on twitter: @meltycanonڥon 䜐
cool samplin Posted 1 year ago 1 year
(ߝ (follow me on twitter: @meltycanonڥon 䜐
hey man, just passing through. love ya Posted 1 year ago 1 year on VAGUE001givesnofuckstyperemix - Happy Waka, Sad Waka
i'm dead Posted 1 year ago 1 year on VAGUE001givesnofuckstyperemix - Happy Waka, Sad Waka
x_x Posted 1 year ago 1 year
on Krept & Konan - Falling (Eljay Remix)
tight remix fam. i dig Posted 1 year ago 1 year
on datgurl (1/2)
awesome percussion Posted 1 year ago 1 year
on datgurl (1/2)
i am really really enjoying this Posted 1 year ago 1 year
on ICYCAVE
thick kiccs Posted 1 year ago 1 year
on ICYCAVE
boooooooy this is straight eerie Posted 1 year ago 1 year on Sylvan Lacue - Heavenly (Prod. By Fortune)
spice! Posted 1 year ago 1 year
on Selfish
sick dude Posted 1 year ago 1 year on Enschway & Holly - Bring It Back
golly Posted 1 year ago 1 year
on pockets
@isaacchanmusic: i don't get it either Posted 1 year ago 1 year
on pockets
^^^^^^ Posted 1 year ago 1 year
on pockets
these chords are incredible Posted 1 year ago 1 year
on pockets
goodness cheryl Posted 1 year ago 1 year
on Horizons
gw Posted 1 year ago 1 year on Horizons
i like how fast you keep it moving Posted 1 year ago 1 year
on Horizons
screamin percs fam Posted 1 year ago 1 year
on juice (prod. tails)
slammin Posted 1 year ago 1 year on Earth Wind & Fire - September (Atolla Remix)
<3 ; ) Posted 1 year ago 1 year
on LOQUINCE- 50K Deep (Prod. Ricandthadeus)
spicy Posted 1 year ago 1 year
on Lowself - Some Minds (Rework) (FREE DL)
lowself 4 life Posted 1 year ago 1 year on Lowself - Some Minds (Rework) (FREE DL)
fantastic work Posted 1 year ago 1 year on Major Lazer - Be Together feat. Wild Belle (LOWSELF Remix)
swooooooooop Posted 1 year ago 1 year on Major Lazer - Be Together feat. Wild Belle (LOWSELF Remix)
lovely Posted 1 year ago 1 year
on Lotus Hills
sidechain caught me Posted 1 year ago 1 year
on IXTLI
fancy raunch fest Posted 1 year ago 1 year
on Nakala - I Know (ayo. & .disfnk Official Remix)
this shit here right Posted 1 year ago 1 year
on what have I done kanye? rip Posted 1 year ago 1 year
on what have I done kanye?
help Posted 1 year ago 1 year
on BLANDA & SINEPHRO - Relief
what they say is true Posted 1 year ago 1 year
on BLANDA & SINEPHRO - Relief
man, they are right about you Posted 1 year ago 1 year on Decap - Gramz (Feat. Hit Boy & Jedi Jordan)
ridic Posted 1 year ago 1 year on Decap - Gramz (Feat. Hit Boy & Jedi Jordan)
on that godly shit Posted 1 year ago 1 year
on Don't Move love it! Posted 1 year ago 1 year
on stack 'em up ft. misfit
@suuspended: triathlon squad Posted 1 year ago 1 year
on repeat
@suuspended: get zestfully clean™ Posted 1 year ago 1 year
on Avionics - Shores
slammin shakemasta Posted 1 year ago 1 year
on rotation
this part evil Posted 1 year ago 1 year
on rotation
imaginative Posted 1 year ago 1 year
on rice rain remix
good one m8 Posted 1 year ago 1 year
on rice rain remix
eplah Posted 1 year ago 1 year
on rice rain remix
so compact Posted 1 year ago 1 year
on out of here
coolin it Posted 1 year ago 1 year
on storm
magnificent Posted 1 year ago 1 year
on Burn
unique as fuck Posted 1 year ago 1 year on Be My Valentine - Angel Mo (Prod by Coubo)
wow holy moly Posted 1 year ago 1 year
on Ark Patrol - Hex
such heat Posted 1 year ago 1 year
on Ark Patrol - Hex
blazin thru Posted 1 year ago 1 year
on expectations (ft. brunswick) a hawk outside my window screeched on beat like five times Posted 1 year ago 1 year
on Sango & SPZRKT - JMK (HaanSolo Remix)
slam Posted 1 year ago 1 year
on ASTR - Bleeding Love (Thijs Bos Remix)
!!!!!!!! whaaa Posted 1 year ago 1 year
on Triple Dad - Profits (Prod. XXYYXX)
#gooooooooodshit Posted 1 year ago 1 year on From the Ground Up i usually don't care for country but this is dope Posted 1 year ago 1 year
on Massa Sir
hot Posted 1 year ago 1 year
on I LIKE // LSD
@sayanymore: what why Posted 1 year ago 1 year
on lytebounce
super sick Posted 1 year ago 1 year
on I LIKE // LSD
with you Posted 1 year ago 1 year
on wrds (ft. ben beal) [prod. lonemoon]
wow. fantastic tune Posted 1 year ago 1 year on idle hour ft. dawson & kolada
@thehollow: watch it boy Posted 1 year ago 1 year
on Woohah!
this is bliss Posted 1 year ago 1 year
on Where Was You
perfect Posted 1 year ago 1 year
on Where Was You
oh shit Posted 1 year ago 1 year
on G
goodness dude how Posted 1 year ago 1 year
on G
fuck Posted 1 year ago 1 year on G
this is some sinister ass shit Posted 1 year ago 1 year
on G
satan comin Posted 1 year ago 1 year
on i (used to) love kanye (until he took my song down) sorry about your track. this is one's amazing as well tho Posted 1 year ago 1 year
on GOLDEN LAGOON w/ eℒĸamıx
still smokin Posted 1 year ago 1 year
on GOLDEN LAGOON w/ eℒĸamıx
rare Posted 1 year ago 1 year
on i got a problem. (10 mins ¯\_(ϑ)_/¯ )
<3<3 Posted 1 year ago 1 year on i got a problem. (10 mins ¯\_(ϑ)_/¯ ) stackin some power in this shit huh Posted 1 year ago 1 year
on Atolla & Shahly - On The Dock
the pauses hold me tight Posted 1 year ago 1 year
on Vol. 9 With Zephyr
troyboiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii Posted 1 year ago 1 year
on nothing was the same
such sweet and gentle care Posted 1 year ago 1 year
on HXNS x R.O.M x Lege Kale - Blues
yes yes yes mother fucking yes Posted 1 year ago 1 year
on misted [bump]
superb Posted 1 year ago 1 year
on SoundCloud 60: Flamingosis hell yeah, we gotta toss disc some time Posted 1 year ago 1 year
on SoundCloud 60: Flamingosis
hahahah lit Posted 1 year ago 1 year
on compound
@1um1: my lord n savior Posted 1 year ago 1 year
on 3lo ~ Bed, Bap & Beyond
@treehouse-vibes: but when are they not at their best Posted 1 year ago 1 year
on umru―dry spell
my boy Posted 1 year ago 1 year
on finesse
@chillmvtic: fucking super same Posted 1 year ago 1 year
on longing. [] thank you for gracing me with this heavenly experience Posted 1 year ago 1 year
on longing. []
this is where i belong[ing.] Posted 1 year ago 1 year
on Siesta Key (Surreal Release)
damn Posted 1 year ago 1 year
on Siesta Key (Surreal Release)
ridiculous Posted 1 year ago 1 year
on Siesta Key (Surreal Release)
@keota-us: a thousand times this Posted 1 year ago 1 year
on Morals
golly Posted 1 year ago 1 year
on Morals
asmr af mf Posted 1 year ago 1 year
on Day 29
fuck... Posted 1 year ago 1 year
on Day 29
just copped that dl, tysvm Posted 1 year ago 1 year on WHITE GIRLS FT. NESSLY (PROD. RICHIE SOUF)
24 Posted 1 year ago 1 year on WHITE GIRLS FT. NESSLY (PROD. RICHIE SOUF)
god damn Posted 1 year ago 1 year
on OUTLOOK chris you are wreaking havok with this track Posted 1 year ago 1 year
on OUTLOOK
hold the phone Posted 1 year ago 1 year on Pharrell Williams - Can I Have It Like That (Blackmar Remix)
nice Posted 1 year ago 1 year
on Mike Posner - Please Don't Go (Ronin Remix)
good shit dude Posted 1 year ago 1 year
on Mike Posner - Please Don't Go (Ronin Remix)
bumpin Posted 1 year ago 1 year
on 3lo ~ Bed, Bap & Beyond
ridiccccccccc holy shit Posted 1 year ago 1 year
on 3lo ~ Bed, Bap & Beyond
cannot get over this lead Posted 1 year ago 1 year
on 3lo ~ Bed, Bap & Beyond
i'm going to have a heart attack Posted 1 year ago 1 year on 3lo ~ Bed, Bap & Beyond
3lo!!! yess!!! Posted 1 year ago 1 year
on La Fuente
supreme Posted 1 year ago 1 year
on La Fuente
<3<3<3<3 whoa Posted 1 year ago 1 year
on La Fuente and they all fit together so wonderfully Posted 1 year ago 1 year
on La Fuente
very peculiar sounds you've chosen Posted 1 year ago 1 year
on sober
wow Posted 1 year ago 1 year on Admiration
fantastic Posted 1 year ago 1 year
on Admiration these are hi hats are murdering me Posted 1 year ago 1 year
on Admiration
fam fam fam Posted 1 year ago 1 year on Cavan Brady & Machinesix - Separate
<3<3 Posted 1 year ago 1 year on Cavan Brady & Machinesix - Separate
dang this goes deep Posted 1 year ago 1 year
on Merit Your Sleep
f i re e Posted 1 year ago 1 year on Merit Your Sleep
whoa! legendary shit happening here! Posted 1 year ago 1 year
on Day 25
take that math Posted 1 year ago 1 year
on Day 25
i guess 1:1 because it just happened Posted 1 year ago 1 year
on Day 25 what are the chances that you reply to my tweet while i'm listening to this lmfao Posted 1 year ago 1 year
on Day 25
like so much Posted 1 year ago 1 year
on Day 25
i fucking love you dude Posted 1 year ago 1 year on Day 25
oh man Posted 1 year ago 1 year
on Day 25
hahahahahahaha Posted 1 year ago 1 year on Roses w. yaguar (06pm–06am edit)
niiiiice <333 Posted 1 year ago 1 year
on let me back in (w/ SPONT)
simply lovely Posted 1 year ago 1 year
on find me ○
slammin! Posted 1 year ago 1 year
on breathe w/ emzhi
: ) : ) : ) Posted 1 year ago 1 year
on ℒ o s t c h i l d nice feels dude Posted 1 year ago 1 year
on 8 0 8 N I N J A ☔ (visuals in description)
i am r o l l i n g Posted 1 year ago 1 year
on 8 0 8 N I N J A ☔ (visuals in description)
yakuza ass ninjas Posted 1 year ago 1 year
on SK¥PIERR & daRealright - flip flaps [GUCCI]
fuck! lit snarage Posted 1 year ago 1 year
on depth great composition dude. really love everything you've packed into this Posted 1 year ago 1 year
on Hati - Homage To Dr. Derg
help me Posted 1 year ago 1 year on Hati - Homage To Dr. Derg
slice and dice Posted 1 year ago 1 year
on Fly With You (w/ $hy)
<3 Posted 1 year ago 1 year
on Fly With You (w/ $hy)
sick hits Posted 1 year ago 1 year on idle hour ft. dawson & kolada
@elevationishere: <3<3 Posted 1 year ago 1 year
on Don't Look! (Ft.Jamison)
experiencial Posted 1 year ago 1 year
on DGRG (DopeGameRapGame)
dank Posted 1 year ago 1 year
on Hip Hop Ric Flair ^^^ Posted 1 year ago 1 year
on Hip Hop Ric Flair
yeeeeeeeee Posted 1 year ago 1 year
on HuLK
love how dark it feels Posted 1 year ago 1 year
on HuLK
evil shit Posted 1 year ago 1 year
on Tibe - Prism
this that good shit Posted 1 year ago 1 year
on what u sippin on
^^^^supremacy love do good yess hahahaha :DDD wooo Posted 1 year ago 1 year
on compound @octn: ∆∂µ¬∑ Posted 1 year ago 1 year
on ember island - need you (AIRWAV remix)
great tune fam Posted 1 year ago 1 year
on ember island - need you (AIRWAV remix)
all airwav is good Posted 1 year ago 1 year
on ember island - need you (AIRWAV remix) not to say the usual airwav connotes anything bad either Posted 1 year ago 1 year
on ember island - need you (AIRWAV remix)
different from the usual airwav, but in a fantastic way Posted 1 year ago 1 year
on HOP BOX - Waiting for the Bus
shit son, picking it uppp Posted 1 year ago 1 year
on Finding Light
super sick Posted 1 year ago 1 year
on Finding Light got that froyo olli feel Posted 1 year ago 1 year
on compound
@james-gent: thasg Posted 1 year ago 1 year
on compound
whuuu Posted 1 year ago 1 year
on compound
vialaa Posted 1 year ago 1 year
on compound
checmial Posted 1 year ago 1 year
on Cypher Why I Suck
hahah tight Posted 1 year ago 1 year
on Cypher Why I Suck
banging!!! Posted 1 year ago 1 year
on Cypher 4 - No Theme
good shit Posted 1 year ago 1 year
on Cypher 4 - No Theme i feel you on the fuck required tags Posted 1 year ago 1 year
on Cypher 4 - No Theme
swingbouncegang Posted 1 year ago 1 year
on Cypher 4 - No Theme
i like the vibes you've got Posted 1 year ago 1 year
on Cypher 7: No Theme
heaaat Posted 1 year ago 1 year on Cypher 7: No Theme
storytellin sass Posted 1 year ago 1 year
on Cypher 7: No Theme
and this beat is fucking sick Posted 1 year ago 1 year
on Cypher 7: No Theme
dope dope dope! Posted 1 year ago 1 year
on Living A Lie (Prod. 10A)
sweet peace Posted 1 year ago 1 year
on Yeek ~ The Drums (Lege Kale Remix)
super tight Posted 1 year ago 1 year
on gellaitry groove remix
!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!ego death Posted 1 year ago 1 year on Day 28
@tiberarchives: you are really good Posted 1 year ago 1 year on "MONEYCALL" - AARON CARTIER FT. NESSLY (PROD. RYANJACOB)
those keys in the back <3<3 Posted 1 year ago 1 year
on Day 28
so are you secretly flamingosis? Posted 1 year ago 1 year
on Day 28
you've got me speechless Posted 1 year ago 1 year
on Be Down
take me awaayyyyyyyy Posted 1 year ago 1 year
on SOMNAMBULISM // AWAKEN
you a demon Posted 1 year ago 1 year on SOMNAMBULISM // AWAKEN
incredibly catchy Posted 1 year ago 1 year
on SOMNAMBULISM // AWAKEN
mystical Posted 1 year ago 1 year
on four reasons to fall in love with me - Reason II
deeep Posted 1 year ago 1 year
on Money & Power w/ Cresce this shit got even harder the second time around wtf Posted 1 year ago 1 year
on west metro ft. MAYZiN - make a way (petrii remix)
really well done Posted 1 year ago 1 year
on west metro ft. MAYZiN - make a way (petrii remix)
supersynths Posted 1 year ago 1 year
on west metro ft. MAYZiN - make a way (petrii remix) magnificent~~ everything is pleasing Posted 1 year ago 1 year
on Day 27
good lord Posted 1 year ago 1 year
on Day 27
envious i am Posted 1 year ago 1 year
on Day 27
total pump mode Posted 1 year ago 1 year
on On My Mind
hott with two ts Posted 1 year ago 1 year
on On My Mind
y aint i herd disa Posted 1 year ago 1 year
on On My Mind daaaaaaamn daniel... Posted 1 year ago 1 year
on grape fanta
@wizetheproducer: no problem dude. keep feeding me tunes Posted 1 year ago 1 year
on grape fanta
i have enjoyed watching you develop in the last several months. not many artists have such noticeable progress tbh, but you seem to be constantly stepping it up, so good work man Posted 1 year ago 1 year
on Chazzz Allen - LoveMeBack awesome vibes. i don't really hear stuff like this in my realm very often. refreshing! Posted 1 year ago 1 year
on Money & Power w/ Cresce
da paaaaan thooooo Posted 1 year ago 1 year
on Money & Power w/ Cresce
i'm literally dead (metaphorically speaking) Posted 1 year ago 1 year on Money & Power w/ Cresce
x _ x Posted 1 year ago 1 year
on Money & Power w/ Cresce
calm tf down guys!!! Posted 1 year ago 1 year
on Money & Power w/ Cresce
hooooooooold uuuuuuuup Posted 1 year ago 1 year
on she thinks im wonky af
magnificent keys Posted 1 year ago 1 year
on she thinks im wonky af
and u sure are Posted 1 year ago 1 year on She, Among the Overgrowth
^^^^ Posted 1 year ago 1 year on She, Among the Overgrowth your instruments fit together in such a peculiar way Posted 1 year ago 1 year
on She, Among the Overgrowth
i love this kinda of shit Posted 1 year ago 1 year
on Day 18
^^^ Posted 1 year ago 1 year
on Day 18
my god Posted 1 year ago 1 year
on uth fruit - night (moments)
just flawless man Posted 1 year ago 1 year
on Rihanna - Work (Vandalized Cover)
sick piano Posted 1 year ago 1 year on Rihanna - Work (Vandalized Cover)
magical Posted 1 year ago 1 year
on Fly
keepin it trill Posted 1 year ago 1 year
on Zack Bruce - Not Again
zack zack zack zack zack Posted 1 year ago 1 year on Giraffage & Viceroy - Impression Of You (feat. Patrick Baker) [Electric Mantis Remix]
mantis, you just stay holding it down man Posted 1 year ago 1 year
on High Hoops // Ultramood
nice nice nice Posted 1 year ago 1 year
on montell2099 // Possible
love this one - never skipped it Posted 1 year ago 1 year on HIT ME (Prod. by Rex Kudo, Charlie Handsome and Frank Dukes)
chill n ill Posted 1 year ago 1 year
on Runkus - Energy
ragggga Posted 1 year ago 1 year
on Runkus - Energy
: )) Posted 1 year ago 1 year
on STEḶLEO - Full Throttle ft. Kaiiak
damn this sure is lavish Posted 1 year ago 1 year
on Butter Elite
named properly af Posted 1 year ago 1 year
on uth fruit - night (moments)
!!!! heat surfing Posted 1 year ago 1 year
on Ask brand new ????? yessseeeeeseseses Posted 1 year ago 1 year
on BAFFL - Ur Groove
back for more <3 Posted 1 year ago 1 year
on The Kount - Contact!
da kountttttt Posted 1 year ago 1 year
on Srsly - Tunnel Vision (ft. Anuka) [NEST HQ Premiere]
driving force powerful intensity Posted 1 year ago 1 year
on Quad
fam fam fam fam fam fam fam fam Posted 1 year ago 1 year on Porter Robinson - Sad Machine (Cosmo's Midnight Remix)
awesome remix Posted 1 year ago 1 year
on Be Down miami lead topped it all off Posted 1 year ago 1 year
on Healer
luv luv luv Posted 1 year ago 1 year
on Healer
swell Posted 1 year ago 1 year
on Be With U
helluva tune Posted 1 year ago 1 year
on Electric Body (Z W Edit)
percussion on point Posted 1 year ago 1 year
on Holy
good lord Posted 1 year ago 1 year
on Thoughts
wicked Posted 1 year ago 1 year
on Thoughts
mad dope my friend Posted 1 year ago 1 year
on Day 23
what the hell how are you so creative Posted 1 year ago 1 year
on Day 23
you liar this is fuckin magma Posted 1 year ago 1 year
on stack 'em up ft. misfit
@dreamer_productions: hahahahah Posted 1 year ago 1 year on Ascension ft. exyle [Debris EP - Out Now]
outstanding gentlemen Posted 1 year ago 1 year
on Echavox - Living Rooms
yes Posted 1 year ago 1 year
on låpsley - love is blind (sam gellaitry remix)
mad cool Posted 1 year ago 1 year
on låpsley - love is blind (sam gellaitry remix)
@james_bryce: truly Posted 1 year ago 1 year
on Cool Thingy[demo]
@brothermynor: nice to see pano getting some attention. dude makes some dope shit Posted 1 year ago 1 year
on Living that life
hell yeah fam Posted 1 year ago 1 year
on JESSE TYLER - HEFTY BAG BOYS FT. DAM
sixck Posted 1 year ago 1 year
on Day 24
jesus dude, i wish i had your talent Posted 1 year ago 1 year
on Day 24 badoom bap badoom boodoom dabap! Posted 1 year ago 1 year
on Dylan Kidd - Alright Alright Alright
<3 just lovely Posted 1 year ago 1 year
on Dylan Kidd - Alright Alright Alright
super vibes Posted 1 year ago 1 year
on Ice Climbers
goodness gracious holy moly Posted 1 year ago 1 year
on matt
. Posted 1 year ago 1 year
on GOLDEN LAGOON w/ eℒĸamıx
smoking Posted 1 year ago 1 year on GOLDEN LAGOON w/ eℒĸamıx
stellar!! Posted 1 year ago 1 year
on Take You
sounding good man Posted 1 year ago 1 year
on oylo - graded
@yungbrtrnd: thanks dude! Posted 1 year ago 1 year
on oylo - graded
@officialimotep: all i do is chill Posted 1 year ago 1 year
on oylo - graded
@godofgroove: <3<3 Posted 1 year ago 1 year
on oylo - graded
@z7e7n: i love you too mazen Posted 1 year ago 1 year on The State Of Things
: ) Posted 1 year ago 1 year
on The State Of Things
very calming Posted 1 year ago 1 year
on why am I so alone
damn this shit is dangerous Posted 1 year ago 1 year
on DRE/\MER - Stand Up
i like you dreamer. you are dark Posted 1 year ago 1 year
on I Just Want To Know You so much heat screaming out of this Posted 1 year ago 1 year
on Wings - Piano Cover
good stuff fam Posted 1 year ago 1 year on finesse will this ever get old? no Posted 1 year ago 1 year
on Crapface - Purrfect
ßoß Posted 1 year ago 1 year
on Crapface - Purrfect
watch me work it Posted 1 year ago 1 year
on winter rush
good looks Posted 1 year ago 1 year
on winter rush
i quit Posted 1 year ago 1 year
on winter rush
hahaha what the fuck Posted 1 year ago 1 year
on winter rush god damn Posted 1 year ago 1 year
on hey girl
experiential Posted 1 year ago 1 year
on something blue
<3 Posted 1 year ago 1 year
on something blue
ugh these hats are deeeeaaaath Posted 1 year ago 1 year
on something blue
bro i really admire you Posted 1 year ago 1 year
on Sax Beat Freestyle
slaughtered it Posted 1 year ago 1 year on Flume - Smoke & Retribution (Medasin Remix & Cover) Ft. Tyler Carter this is stellar Posted 1 year ago 1 year on Flume - Smoke & Retribution (Medasin Remix & Cover) Ft. Tyler Carter
@samsam: i love you Posted 1 year ago 1 year on Flume - Smoke & Retribution (Medasin Remix & Cover) Ft. Tyler Carter
@theo_here: ^^ Posted 1 year ago 1 year
on She Knows
nice feeling Posted 1 year ago 1 year
on She Knows
damn boy Posted 1 year ago 1 year
on NEW PHONE WHO DIS
folkkkk Posted 1 year ago 1 year on Lotus Blossom [tape 2]
hahah this is cool as hell Posted 1 year ago 1 year
on Lotus Blossom [tape 2]
sweet Posted 1 year ago 1 year
on Pull Up (Prod.Mikey The Magician)
!! Posted 1 year ago 1 year
on Pull Up (Prod.Mikey The Magician)
real Posted 1 year ago 1 year
on leaving this is quit the spectacle of human ingenuity Posted 1 year ago 1 year
on Hands Up
great tune!! Posted 1 year ago 1 year
on OUSKΛ - Major interesting. really love the soft percs Posted 1 year ago 1 year
on Day 22 i am really impressed by these 29 days for dilla Posted 1 year ago 1 year
on Day 22
tiber understands how to storytell w his vibes Posted 1 year ago 1 year
on Fry Daze (duncantaylor x BeeAreAyeDee)
wow this is my kinda jam Posted 1 year ago 1 year
on Teklife Tribute Mix
smeckin Posted 1 year ago 1 year
on ZEN - Choking
buddy buddy buddy Posted 1 year ago 1 year
on ZEN - Choking fairytale Posted 1 year ago 1 year
on Creepa - Lush
my creepa holdin it down Posted 1 year ago 1 year
on Money Longer
wholy Posted 1 year ago 1 year
on Money Longer
lit Posted 1 year ago 1 year
on Something
@oylo: truuu Posted 1 year ago 1 year
on birth great combination of synths. all perfect complements Posted 1 year ago 1 year
on SRNO - TRY
damn Posted 1 year ago 1 year
on depression [free]
elegance Posted 1 year ago 1 year on Legoon - What To Do (Prod. Dr. Derg)
damn this lines are choice Posted 1 year ago 1 year
on and my life turned around
goodness gracious Posted 1 year ago 1 year
on do you hate me
spank that shit Posted 1 year ago 1 year
on Relax yo
oh baby <<33 Posted 1 year ago 1 year
on lightitup [free]
good shit man, be easy Posted 1 year ago 1 year
on lightitup [free]
daaaaamn derggg Posted 1 year ago 1 year
on Japaneasy
smack smackkkk! Posted 1 year ago 1 year
on Dark Trap Challenge (JRaB Remix)
jrab Posted 1 year ago 1 year
on cocaina
this is true divinity Posted 1 year ago 1 year
on cocaina
you must enlightened man Posted 1 year ago 1 year
on finesse literally every single fucking time Posted 1 year ago 1 year on naji - Fallen (prod. Howle)
what a delicacy Posted 1 year ago 1 year
on Majid Jordan - Her (Rxl Edit)
boy this sure grooves Posted 1 year ago 1 year on Rogue - Goodbye (Winter Chords) Send Off Remix
holy smokes we trailblazin Posted 1 year ago 1 year
on YoZ - Say What You Want (Prod By Pirooz Beats)
hot damnn dude Posted 1 year ago 1 year
on twelve [cries]
very nice very nice! Posted 1 year ago 1 year
on Home/Ignition/YAMH (TONAK Mashup)
nice Posted 1 year ago 1 year on Pick Ups with Jonah Baseball Episode 014
r.i.p. Posted 1 year ago 1 year
on ZAYN - PILLOWTALK (Stwo Remix)
really clean. love it Posted 1 year ago 1 year
on languid (with maxwell)
<3<3<3<3<3 Posted 1 year ago 1 year
on languid (with maxwell)
wow u guys are uncontrollably cute Posted 1 year ago 1 year
on Raiku - Aperture
bigg tune Posted 1 year ago 1 year
on Bloodfeather
thps Posted 1 year ago 1 year on yoki - rather be with you, electric bungaloo
cool composition yoki Posted 1 year ago 1 year
on thor kvisgaard - don't leave me alone
hoppin Posted 1 year ago 1 year
on thor kvisgaard - don't leave me alone
damn i really dig Posted 1 year ago 1 year
on todd siesel - groove
i dig Posted 1 year ago 1 year
on recreation (thanks for 35k plays!!)
blazing Posted 1 year ago 1 year
on recreation (thanks for 35k plays!!)
supersolid Posted 1 year ago 1 year
on stack 'em up ft. misfit @the-always: thank you!! Posted 1 year ago 1 year
on stack 'em up ft. misfit
@officialloki: yes, yes it is bass jesus Posted 1 year ago 1 year
on stack 'em up ft. misfit
@benicemakesmusic: you know Posted 1 year ago 1 year
on stack 'em up ft. misfit
@madnap: broh Posted 1 year ago 1 year
on stack 'em up ft. misfit
@henryanthony-duscheid: okie doke breh Posted 1 year ago 1 year
on stack 'em up ft. misfit
@mikevongold: ay Posted 1 year ago 1 year
on stack 'em up ft. misfit @mikevongold: appreciate it man <3 Posted 1 year ago 1 year
on stack 'em up ft. misfit
@baebrito: glad you liked it! Posted 1 year ago 1 year
on stack 'em up ft. misfit
@swtrwthr: thanks dude Posted 1 year ago 1 year
on stack 'em up ft. misfit
@tiberbeats: don't even Posted 1 year ago 1 year
on stack 'em up ft. misfit
@atolla-1: ; ) Posted 1 year ago 1 year on Amy Winehouse - Rehab (Mark Johns Cover Prod. Tennyson)
good shit mark Posted 1 year ago 1 year
on Yung Wall Street - Baby
massive Posted 1 year ago 1 year
on Dangerous
aka this Posted 1 year ago 1 year
on Sunny D. Light - ATM (Prod. By Cresce)
this right here Posted 1 year ago 1 year
on You Should Be Here
pretty good Posted 1 year ago 1 year on Shleepytime - Eyes 4 U (Glass Arrowhead Remix)
spectacular Posted 1 year ago 1 year
on Post Chrome (Faded)
sidechain = life Posted 1 year ago 1 year
on Post Chrome (Faded)
<3<3<3 Posted 1 year ago 1 year
on Post Chrome (Faded) goodness gracious this is some crazy shit Posted 1 year ago 1 year
on Test 5 (Story Telling)
nice one m8 Posted 1 year ago 1 year
on Test 5 (Story Telling)
whoa Posted 1 year ago 1 year
on Test 5 (Story Telling)
sparkling atmosphere Posted 1 year ago 1 year
on oviim- Vision
sick Posted 1 year ago 1 year
on Vallis Alps - Young (Feki Remix)
so sweet Posted 1 year ago 1 year on LIL AARON - ME (PROD. SHELL SPORT)
dang boys Posted 1 year ago 1 year
on Hey
mad shit Posted 1 year ago 1 year
on phuck a grammy whoa dude. slow down so the rest of us can catch up Posted 1 year ago 1 year
on Hyperballad with Luke Howard
<3 Posted 1 year ago 1 year
on Ke-Chi x Icarus Moth - Moon Children
insanely creative minds Posted 1 year ago 1 year
on Ke-Chi x Icarus Moth - Moon Children
damn this fancy Posted 1 year ago 1 year on Day 16
inspired Posted 1 year ago 1 year
on True and Real
@akihabara: hahahah Posted 1 year ago 1 year
on True and Real
cwby, this track is a fucking kiler Posted 1 year ago 1 year
on 06:47 (Rethink)
@beatsbyhalpe: u remixing instupendo!! what a fantastic world Posted 1 year ago 1 year
on Good Morning
serious waves pulsing through my face rn Posted 1 year ago 1 year
on Good Morning
this some good shit Posted 1 year ago 1 year on 06:47 (Rethink)
<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3 Posted 1 year ago 1 year
on 06:47 (Rethink)
well i never Posted 1 year ago 1 year
on 06:47 (Rethink)
wow Posted 1 year ago 1 year
on 06:47 (Rethink)
first of all, is this actually what i think it is Posted 1 year ago 1 year
on Daybreak
slicing like a space sword Posted 1 year ago 1 year
on Yogi - SIRI ft. Pusha T & Elliphant (KRANE Remix)
knre Posted 1 year ago 1 year on Later Tonight w/ falcxne
influencing Posted 1 year ago 1 year
on Later Tonight w/ falcxne
super sick guys Posted 1 year ago 1 year
on Later Tonight w/ falcxne
@octn: most def Posted 1 year ago 1 year on TAKE A SHOT feat. CAVEWERK & TIBE
@tiberbeats: for suree Posted 1 year ago 1 year on TAKE A SHOT feat. CAVEWERK & TIBE
click Posted 1 year ago 1 year
on Expectations
damn Posted 1 year ago 1 year
on Expectations whole song stayed at 100 Posted 1 year ago 1 year
on Expectations
like wtf Posted 1 year ago 1 year
on Expectations
chill fam Posted 1 year ago 1 year
on graves & Havok Roth - Imaginary Friends [NEST HQ Premiere]
jesus christ Posted 1 year ago 1 year
on graves & Havok Roth - Imaginary Friends [NEST HQ Premiere]
such a filling mix ugh how do Posted 1 year ago 1 year on KEI-LI x Robotaki x falcxne - WAV Raiders (Team Supreme Vol. 133 Remix)
!~!~!~!~! Posted 1 year ago 1 year on KEI-LI x Robotaki x falcxne - WAV Raiders (Team Supreme Vol. 133 Remix)
tight Posted 1 year ago 1 year on KEI-LI x Robotaki x falcxne - WAV Raiders (Team Supreme Vol. 133 Remix)
yoooooooo Posted 1 year ago 1 year on KEI-LI x Robotaki x falcxne - WAV Raiders (Team Supreme Vol. 133 Remix)
holy smokes what's this all about!! Posted 1 year ago 1 year
on breed w/ Oʀᴅɴʀʏ Yɴɢsᴛʀ
wacky shit dude - kicks are insaaane Posted 1 year ago 1 year
on breed w/ Oʀᴅɴʀʏ Yɴɢsᴛʀ
are the hats building or am i just high Posted 1 year ago 1 year
on Cas Cray - Like It (Prod. 6.18) [FREE DOWNLOAD]
excellent Posted 1 year ago 1 year on JonEcks - Rare Beat Cypher VOL 1
spiffy Posted 1 year ago 1 year
on ӍҾӅӅ // ºӇ_ӆҾ
abstract feelings Posted 1 year ago 1 year
on Daybreak
you're a true creative genius Posted 1 year ago 1 year
on Reborn
ck ck ck ck Posted 1 year ago 1 year
on we'll both be out soon.
son Posted 1 year ago 1 year
on we'll both be out soon.
very very chill Posted 1 year ago 1 year on six forty seven.
yung aido Posted 1 year ago 1 year
on Wake
this is wicked Posted 1 year ago 1 year
on deadbeat valentine
lovely Posted 1 year ago 1 year on I'm Going To Tell You Feat Jordan Rakei (Prod. Alfa Mist & Jordan Rakei)
emitting sparks Posted 1 year ago 1 year
on Valentines Mix: Jarreau Vandal's What Is Love Mix ♥
swanggg Posted 1 year ago 1 year
on Valentines Mix: Jarreau Vandal's What Is Love Mix ♥
^^^^^ Posted 1 year ago 1 year on Valentines Mix: Jarreau Vandal's What Is Love Mix ♥
i am in love with this Posted 1 year ago 1 year
on Evenire Live #12 : Tonak Room (Preview Mix)
my vibess Posted 1 year ago 1 year
on Evenire Live #12 : Tonak Room (Preview Mix)
sick Posted 1 year ago 1 year
on Evenire Live #12 : Tonak Room (Preview Mix)
in for a treat i can feel it Posted 1 year ago 1 year
on Xpress (Prod. Flip)
smooth bruv Posted 1 year ago 1 year
on Creepa x Mo Vibez x Paisan - Dimensions
:D:D:D Posted 1 year ago 1 year on crush, death and fear
dank Posted 1 year ago 1 year
on crush, death and fear
ayyy buddy Posted 1 year ago 1 year
on crush, death and fear
sliquid Posted 1 year ago 1 year
on Kompany - Free Serum Presets
whoa Posted 1 year ago 1 year
on Warm Up Freestlye (Prod. Defkon)
mother fucker Posted 1 year ago 1 year on Froogle - Mark My Words (ft. Josh Rubin) (Erik Soto Remix)
-tastic Posted 1 year ago 1 year
on Elevation - Love Song sinister Posted 1 year ago 1 year
on how do i uninstall myself?
this dope tho Posted 1 year ago 1 year
on how do i uninstall myself?
same Posted 1 year ago 1 year
on Ta-Ku - Love Again (Omari MC Remix)
beautiful tune! Posted 1 year ago 1 year
on Undone
fire Posted 1 year ago 1 year
on finesse this is my favorite track right now. blows my mind every time i listen Posted 1 year ago 1 year
on Soco & Caden Jester - Secret Lover (Ft. Christopher Blake) lovely tune!!! glad i heard it! Posted 1 year ago 1 year
on Day 12
got me hooked Posted 1 year ago 1 year
on apartment [bump]
complete flames Posted 1 year ago 1 year
on Northside Girls w/ Atlas Greene
@3lofam: in any case, i'm glad i have now Posted 1 year ago 1 year
on Northside Girls w/ Atlas Greene
why have i not heard this Posted 1 year ago 1 year
on solitude
yoi! Posted 1 year ago 1 year
on You Got Me Thinking Prod. Padillion la la la la laaaaaaa Posted 1 year ago 1 year
on Hurry Slowly (Manatee Commune Rmx)
spec attacked me Posted 1 year ago 1 year
on Tre Samuels - Purple (prod. Aybner)
wow Posted 1 year ago 1 year
on breathing
<3<3 2 keen on dis Posted 1 year ago 1 year
on yu [86]
forward thinking Posted 1 year ago 1 year on Too Late Now (Produced by Jarreau Vandal)
slammin as fuck Posted 1 year ago 1 year
on Frost - Kentaur
i felt this Posted 1 year ago 1 year
on Rocks FOE - 23rd (Prod. Rocks FOE)
mad!! Posted 1 year ago 1 year
on y y y - aaa
what do i even say Posted 1 year ago 1 year
on remember?
divine Posted 1 year ago 1 year
on remember?
nash. where did this come from Posted 1 year ago 1 year on Hesitate ft. MaSAXgo (prod. by Tyshane)
fantastic tune Posted 1 year ago 1 year on Hesitate ft. MaSAXgo (prod. by Tyshane)
dreamy Posted 1 year ago 1 year
on XXX
this is magnificent Posted 1 year ago 1 year
on my dreams (ft. oylo)
killa Posted 1 year ago 1 year
on my dreams (ft. oylo)
daaaaamn. i forgot about this Posted 1 year ago 1 year
on yes and no
sassafrass Posted 1 year ago 1 year
on yes and no
whoa bro! you got that groove Posted 1 year ago 1 year
on on n on kinda reminds me of some banjo kazooie sounds Posted 1 year ago 1 year on on n on
hahah yeah! love the fx Posted 1 year ago 1 year
on simplicity
damn good Posted 1 year ago 1 year
on simplicity such sharp strings! i need to figure this out Posted 1 year ago 1 year
on Trying To Succeed
cool atmosphere Posted 1 year ago 1 year
on WONKIX
how wonderful Posted 1 year ago 1 year
on WONKIX
me lool omg Posted 1 year ago 1 year on WONKIX
sick!! this is messing w/ tih Posted 1 year ago 1 year
on rembot x trvsgxd - giving up on sleep dark n spooky - just how i like my haunted houses Posted 1 year ago 1 year
on chamber of glass
whip them 808s boy Posted 1 year ago 1 year
on oh. [FREE DOWNLOAD - DESCRIPTION] really enjoyable. like a bouncy oriental carnival ride Posted 1 year ago 1 year
on REECE - GHOST (TRVSH REMIX)
<3 Posted 1 year ago 1 year
on REECE - GHOST (TRVSH REMIX)
wicked blazin hats fam Posted 1 year ago 1 year on Oakland (Free Rootnote Comp)
this is something special. behold it Posted 1 year ago 1 year
on Flamingosis - Oakland (Feat. Bollywood Life)
flamingosis just gets me hypin Posted 1 year ago 1 year
on Lazyboy Empire - Vampire (AObeats Remix)
quite the chune Posted 1 year ago 1 year
on al dente vol.1
good vibrations Posted 1 year ago 1 year on Elhae Ft. Rick Ross & Tory Lanez - All Away (Evil Needle Remix)
nice spice Posted 1 year ago 1 year
on whtvr
tight! Posted 1 year ago 1 year
on cat's cradle/ remarkable Posted 1 year ago 1 year
on All Times - Lil Yachty (Prod. By Burberry Perry)
rachet Posted 1 year ago 1 year
on Kingbnjmn ~ S.J.L.M (Ft. SOS Dynamikz & Krs.)
still hot on this shit Posted 1 year ago 1 year
on Samplephonics - Pixelized by Pixelord
nice one Posted 1 year ago 1 year
on Worse Not Better w/ Chiefs
sweet sounds! fresh Posted 1 year ago 1 year on Keith Ape - IT G MA Remix (josh pan Opus) w/ sakuraburst, MISOGI, X&G, MEDASIN., oshi
wild Posted 1 year ago 1 year on Keith Ape - IT G MA Remix (josh pan Opus) w/ sakuraburst, MISOGI, X&G, MEDASIN., oshi
rockin grunge Posted 1 year ago 1 year on Keith Ape - IT G MA Remix (josh pan Opus) w/ sakuraburst, MISOGI, X&G, MEDASIN., oshi
dumb crazy Posted 1 year ago 1 year
on harris cole - winterlude
bumpin as fuck Posted 1 year ago 1 year
on mirage
is that a rotary saw Posted 1 year ago 1 year
on error (kinda a description down below)
wicked Posted 1 year ago 1 year
on error (kinda a description down below)
i want your mind Posted 1 year ago 1 year on Hangar
okay mate Posted 1 year ago 1 year
on Hangar
those chords back there <3<3<3 Posted 1 year ago 1 year on Keith Ape - IT G MA Remix (josh pan Opus) w/ sakuraburst, MISOGI, X&G, MEDASIN., oshi
what the fuck man Posted 1 year ago 1 year
on ta-ku - love again feat. jmsn & sango (wntr remix)
frined lol Posted 1 year ago 1 year
on ta-ku - love again feat. jmsn & sango (wntr remix)
you've got a gorgeous piece of work here my frined Posted 1 year ago 1 year
on Dreams Escape ([ocean Jams] Remix)
nice Posted 1 year ago 1 year on Dreams Escape ([ocean Jams] Remix)
good god! this flow is unstoppable Posted 1 year ago 1 year
on Dreams Escape ([ocean Jams] Remix)
swingin!! Posted 1 year ago 1 year
on NYQUILL - I Didn't Need You
unique Posted 1 year ago 1 year
on NYQUILL - I Didn't Need You these kind of things peak my interest like a mf Posted 1 year ago 1 year
on HOME
spectacular Posted 1 year ago 1 year
on HOME
i appreciate you dude Posted 1 year ago 1 year
on Run ^^ Posted 1 year ago 1 year
on Run
str8 power family Posted 1 year ago 1 year
on Shane Coulter ~ Don't Be Shy
needs more plays tbh Posted 1 year ago 1 year
on Øfdream - Indicate
hella! Posted 1 year ago 1 year
on Confession [FREE DL]
@rhodonsound: i see what you did there homie Posted 1 year ago 1 year
on Gleam
ughhhh Posted 1 year ago 1 year
on Gleam teasing me with that melody Posted 1 year ago 1 year
on Shine
me oh my Posted 1 year ago 1 year
on Shine
you are dangerous! Posted 1 year ago 1 year
on Shine
drums on fucking lock Posted 1 year ago 1 year
on Shine
yooo! supreme clean! great mix Posted 1 year ago 1 year
on Tibe - Fluvial i get the heebee jeebees every time i hear this Posted 1 year ago 1 year
on 12 Wit My Crew X 1987 (Produced By FKI)
sick stuff guys Posted 1 year ago 1 year
on All Yours and that baby sneeze is perfect Posted 1 year ago 1 year
on All Yours
good god Posted 1 year ago 1 year
on KEV & steeziak - Crenshaw Blvd
@huckfin-1: agreed Posted 1 year ago 1 year
on KEV & steeziak - Crenshaw Blvd
chills down my spine Posted 1 year ago 1 year
on KEV & steeziak - Crenshaw Blvd
damn boys. doing it right Posted 1 year ago 1 year
on stop (bonus)
bumpin Posted 1 year ago 1 year
on Mo Vibez X Creepa - DR777 how did you fit so much synth into this synth Posted 1 year ago 1 year
on Coast Feels (Prod. By [ocean jams] )
damn. good shit! Posted 1 year ago 1 year
on Coast Feels (Prod. By [ocean jams] )
yeeeeeesss Posted 1 year ago 1 year
on Coast Feels (Prod. By [ocean jams] )
turn up Posted 1 year ago 1 year
on Coast Feels (Prod. By [ocean jams] )
wonderful Posted 1 year ago 1 year
on 11:11 - You (Sevnth Remix)
getting the most chill ride from this Posted 1 year ago 1 year on Reveal
really loving this Posted 1 year ago 1 year
on Reveal
hey fam Posted 1 year ago 1 year on Ivan Ave - The Circle (produced by Mndsgn)
mndsgn slaying Posted 1 year ago 1 year on Ivan Ave - The Circle (produced by Mndsgn)
sickk Posted 1 year ago 1 year
on Ivan Ave - Free Shit (prod. Mndsgn)
yoooo this is searing hot Posted 1 year ago 1 year
on Ouska - Miam Miam Miam
we've reached the pinnacle Posted 1 year ago 1 year on BACK 2 BUSINE$$ (Prod. swisher boyz)
livid Posted 1 year ago 1 year
on Sukh Knight - Hustlerz
stylin! Posted 1 year ago 1 year
on Felicita - 'thanks/bye'
whoaaa Posted 1 year ago 1 year
on Body
pretty neat! Posted 1 year ago 1 year
on Michael Cera - Can I Call You Mine?
god damn it Posted 1 year ago 1 year
on Empty Bottles (Feat. RNDYSVGE)
blowing smoke Posted 1 year ago 1 year on Confession [FREE DL]
sick Posted 1 year ago 1 year
on Confession [FREE DL] this song is like a huge industrial abrasive degrading pendulum Posted 1 year ago 1 year
on Jason Morgan - L3X (Prod By. Dutchmassive)
interesting movement Posted 1 year ago 1 year
on Rabbit Hole feat. BMB Spacekid & Jelani Blackman
very well done Posted 1 year ago 1 year
on Tawrence - Stahp Frontin'
this is wicked Posted 1 year ago 1 year
on Tawrence - Stahp Frontin'
rad Posted 1 year ago 1 year on Methone - Swim
love this one! Posted 1 year ago 1 year
on Silk
very unique Posted 1 year ago 1 year
on Hoodlem - Kintsugi
good shit!! Posted 1 year ago 1 year
on for you
mmm <3 Posted 1 year ago 1 year
on for you
have heard all morning lol Posted 1 year ago 1 year
on for you holy shit this is the cutest thing i Posted 1 year ago 1 year
on Vegetales fresh and funky bassline, killer vocals, sick piece Posted 1 year ago 1 year
on Waveless - Numb feat. Mothica (whereisalex Remix)
!!!!! me too !!! Posted 1 year ago 1 year
on Freak ft. Salomon Faye
powerful track Posted 1 year ago 1 year on Tyler Davis - Let Me Go (Feat. Christopher Aaron & Haley Carter) (Prod. By Relta)
cool Posted 1 year ago 1 year
on One And Only (Oh Boy's Shadow Oh Boy Remix)- Sable
good shit man Posted 1 year ago 1 year
on blessss
@rillaforce: hahah Posted 1 year ago 1 year
on 07022016 i like it Posted 1 year ago 1 year
on Noisia & Phace - Program (AWE Bootleg)
disgusting Posted 1 year ago 1 year
on tinashe (prod. lil rusty nipple)
haha tight Posted 1 year ago 1 year on RED STONE RUST w/ BLVC SVND & JOSH PAN
@mobilepro: no chill Posted 1 year ago 1 year
on clicc clicc
beauty Posted 1 year ago 1 year
on clicc clicc
fuccccckk Posted 1 year ago 1 year
on clicc clicc going bold right out of the pen Posted 1 year ago 1 year
on Feel U
^^^^^ Posted 1 year ago 1 year
on Pollàri ~ Maison (prod. 808 mafia)
tight Posted 1 year ago 1 year
on SG Lewis - Shivers (Delusion Remix)
:):) Posted 1 year ago 1 year
on SG Lewis - Shivers (Delusion Remix)
fancy fancy! Posted 1 year ago 1 year
on Day 8 lol man, on the dl, i think i might be in love with you Posted 1 year ago 1 year
on Panama Wedding - Infinite High (Dim Sum Remix)
clean n simple, i'm feelin Posted 1 year ago 1 year
on whereisalex ~ Double Elephant
magma Posted 1 year ago 1 year
on j.robb & alfonso x - i dont mind
jesus Posted 1 year ago 1 year
on j.robb & alfonso x - i dont mind
loud and fucking clear Posted 1 year ago 1 year
on j.robb & alfonso x - i dont mind
i hear you guys Posted 1 year ago 1 year
on arabesque no. 3
you already know what i'm going to say <3333 Posted 1 year ago 1 year on find your happiness (visuals/video on youtube linked in description)
<3<3 rims!! :,) Posted 1 year ago 1 year on find your happiness (visuals/video on youtube linked in description)
and so are these voxxxxxx whooooooyuuauau Posted 1 year ago 1 year on find your happiness (visuals/video on youtube linked in description)
goodness this beat is butter Posted 1 year ago 1 year
on i could (visuals/video on youtube linked in description)
i like what you're doing here Posted 1 year ago 1 year
on Thru the city.
mad laxed Posted 1 year ago 1 year
on Recreational
holy smokes family Posted 1 year ago 1 year
on Towerz - Flinch
this is miles ahead Posted 1 year ago 1 year on Towerz - Flinch damn son. you're growing so fast it's crazy Posted 1 year ago 1 year
on HERE IT BEGINS
those strings are eerie <3<3 Posted 1 year ago 1 year
on September
oh fuck! Posted 1 year ago 1 year
on possible
unreal Posted 1 year ago 1 year
on possible
aw shit Posted 1 year ago 1 year
on finesse
best shit Posted 1 year ago 1 year on Déjà Vu
this kicks!! Posted 1 year ago 1 year
on decide
yo verzache this is one of my favorite tracks by you. well done dude Posted 1 year ago 1 year
on Between two worlds
supersonic Posted 1 year ago 1 year
on twitter.com/shamanabeats
what Posted 1 year ago 1 year on She Said, "Don't Make Others Suffer For Your Personal Hatred."
i am soaring\ Posted 1 year ago 1 year
on Bones
driving Posted 1 year ago 1 year on TellMe
i can taste this beat Posted 1 year ago 1 year on Darkos Strife - Play (Prod. By Darkos Strife)
whoa those backwards kicks thoooo] Posted 1 year ago 1 year
on Day 6
<3<3<3<3<3 Posted 1 year ago 1 year
on Zephyr x Okami - I Just
good stuff!!1 Posted 1 year ago 1 year
on SPIN
this brings me back Posted 1 year ago 1 year
on just between me and you w/ A M A I
mmmmmm Posted 1 year ago 1 year on H&D - Special (Cresce Remix)
well holy fuck Posted 1 year ago 1 year
on Lmo - Sky Sushi
swagin Posted 1 year ago 1 year
on JAWED
beast Posted 1 year ago 1 year
on MISOGI — EUPHORIA
fantastic Posted 1 year ago 1 year on Creepa - Anata (Remix Contest, read description for info)
stop. i can't take in this much information at once Posted 1 year ago 1 year
on Hey Bae(Nisreen)
sweet Posted 1 year ago 1 year
on Hey Bae(Nisreen) elite as fuck Posted 1 year ago 1 year
on Stir - Me - Nots
supremacy! Posted 1 year ago 1 year
on i'm done, we're through
holy moly Posted 1 year ago 1 year
on selfish
insanely deep waters Posted 1 year ago 1 year
on Zuper x Hapa - Noise
how tf Posted 1 year ago 1 year
on friday (prod. j.robb)
<3 Posted 1 year ago 1 year on WInter Flower (Prod. Goomar) you are on fire Posted 1 year ago 1 year
on WInter Flower (Prod. Goomar)
damn this sick Posted 1 year ago 1 year
on WInter Flower (Prod. Goomar)
yess!!! tell em Posted 1 year ago 1 year
on Vic Alexis - Rosemetals
superb Posted 1 year ago 1 year
on Vic Alexis - Rosemetals
: ) Posted 1 year ago 1 year
on peyote
still holding strong Posted 1 year ago 1 year on 9: Lege Kale - Seasons (feat. Mars Today)
lege kick Posted 1 year ago 1 year
on Who is Stu ?
sweet mercy!! oh god Posted 1 year ago 1 year
on Who is Stu ?
u is stu Posted 1 year ago 1 year
on 813 - Toy Soldiers ( FREE WAV DL )
u something else Posted 1 year ago 1 year
on 813 - Toy Soldiers ( FREE WAV DL )
how so clean what Posted 1 year ago 1 year
on 813 - Toy Soldiers ( FREE WAV DL )
mix game unmatchable Posted 1 year ago 1 year on Pick Up's with Lean Quatifah - Episode 012
gorgeous execution Posted 1 year ago 1 year
on Impulse
e Posted 1 year ago 1 year
on Impulse
str8 grung Posted 1 year ago 1 year
on Impulse this atmosphere is so other world junkyard warring tribe tech attack Posted 1 year ago 1 year
on Impulse
good god man. let go of me!!!! Posted 1 year ago 1 year
on Impulse
heavy Posted 1 year ago 1 year
on weather the storm [w/ Saito]
hnnnnnnng Posted 1 year ago 1 year on weather the storm [w/ Saito]
this beat is serious Posted 1 year ago 1 year
on Nishio 2 (feat. Giraffage)
i am so happy!!!! Posted 1 year ago 1 year
on yugi boi - Don't Leave Me
sick Posted 1 year ago 1 year
on yugi boi - Don't Leave Me
you are a monster!! Posted 1 year ago 1 year
on Girl From Toronto
strong track Posted 1 year ago 1 year
on flowers feat. nori
<3 Posted 1 year ago 1 year on flowers feat. nori
man Posted 1 year ago 1 year
on flowers feat. nori you put everything together very carefully and neatly. i like this so much Posted 1 year ago 1 year
on Comme ci Comme ça feat. Sasha Jelten
@jonnsolo: you get it Posted 1 year ago 1 year
on amindi k. fro$t - wet jeans (prod. valleyz)
got damn this nasty Posted 1 year ago 1 year
on Flume - Smoke & Retribution (Ekali Remix)
sick shit fam Posted 1 year ago 1 year
on hey girl
<3 Posted 1 year ago 1 year on hey girl
smoldering Posted 1 year ago 1 year
on Day 1
aw damnnnn Posted 1 year ago 1 year on If I Was Your Boy (Maxo Sleepmix)
loving it! Posted 1 year ago 1 year on If I Was Your Boy (Maxo Sleepmix)
now this is fresh Posted 1 year ago 1 year
on Chivalry Is Dead
jeez Posted 1 year ago 1 year
on Chivalry Is Dead
!!!!!fire Posted 1 year ago 1 year on Chivalry Is Dead
this is raddd Posted 1 year ago 1 year
on LWR PWR & TSAAB - Mixed Signals [YZZY006]
sparks flying Posted 1 year ago 1 year
on grape jam
damn this is good Posted 1 year ago 1 year
on skater x j.robb - Girls
stay vibin Posted 1 year ago 1 year
on GEOTHEORY Soundpack [Demo]
wonkyyyyy Posted 1 year ago 1 year on *Hoodrich Exclusive* Pollàri & Larry League ~ DISCO (prod. F12)
wow oh wo!! Posted 1 year ago 1 year on kokiri sword
thank you man Posted 1 year ago 1 year
on LGoony & Crack Ignaz - Haname (prod. padillion)
alright fam, i see you! Posted 1 year ago 1 year
on dunbar
@t-biscut: <3 Posted 1 year ago 1 year
on bones ft. domino
why is this kick so thick hahah Posted 1 year ago 1 year on Cool Uncle (Bobby Caldwell & Jack Splash) - Never Knew Love Before
smashing horns! Posted 1 year ago 1 year on Cool Uncle (Bobby Caldwell & Jack Splash) - Never Knew Love Before
f ~ a ~ n ~ t ~ a ~ s ~ t ~ i ~ c Posted 1 year ago 1 year on Cool Uncle (Bobby Caldwell & Jack Splash) - Never Knew Love Before w h a t t h e f u c k a m i l i s t e n i n g t o t h i s i s s o f u c k i n g g o o d Posted 1 year ago 1 year
on Jupiter's Dollhouse
wicked Posted 1 year ago 1 year
on Berry
goodness gracious Posted 1 year ago 1 year
on Berry
like blazing hot Posted 1 year ago 1 year
on Berry
scorching Posted 1 year ago 1 year
on lets fly away (prod. cash only)
and that like sliding metal rod on metal block effect is the trippiest fucking shit Posted 1 year ago 1 year
on lets fly away (prod. cash only)
crazy shit Posted 1 year ago 1 year
on on my lonely (prod. olop)
familia Posted 1 year ago 1 year
on play (prod. olop)
this is sick Posted 1 year ago 1 year
on play (prod. olop)
damn!!! Posted 1 year ago 1 year
on HER OWN (Prod. Akihabara!)
pretty dope fam Posted 1 year ago 1 year on Shift K3Y - Gone Missing (Brasstracks Remix)
good stuff! <3 Posted 1 year ago 1 year on Shift K3Y - Gone Missing (Brasstracks Remix)
smack Posted 1 year ago 1 year on Skrillex & Team EZY (ft. NJOMZA) - Pretty Bye Bye
tbh this mix is kinda weird guys Posted 1 year ago 1 year
on A Song For You (Prod. by Nique)
shittt Posted 1 year ago 1 year
on A Song For You (Prod. by Nique)
mad flow Posted 1 year ago 1 year
on Dr. Fresch X Andrew Luce - Hit It From The Back
difuckingsgusting Posted 1 year ago 1 year
on parties (ft. celadon city)
sweet mercy Posted 1 year ago 1 year on hush w/ cehryl
@fung-sway: f u n g s w a y Posted 1 year ago 1 year on Day Ones ft Novelist & Leikeli47
@brasscats: damn Posted 1 year ago 1 year on Day Ones ft Novelist & Leikeli47
@verxemusic: damn Posted 1 year ago 1 year on Day Ones ft Novelist & Leikeli47
@itsleemz: damn Posted 1 year ago 1 year
on House Of Cards (Radiohead)
!!!!!\ Posted 1 year ago 1 year
on House Of Cards (Radiohead)
mad chill my friend Posted 1 year ago 1 year on Clandenstines
lovely Posted 1 year ago 1 year
on Clandenstines
this reminds me of i am arrows Posted 1 year ago 1 year
on XYXY
killing it my friend Posted 1 year ago 1 year
on Farewell
best elements of everything Posted 1 year ago 1 year
on After School Special
damn this is such a good tune Posted 1 year ago 1 year
on Running Up That Hill - Chromatics
deep trax Posted 1 year ago 1 year on FADE INTO YOU (mazzy star cover) beautiful Posted 1 year ago 1 year
on S E A S O N S (Prod. By MarsUniverse)
dankk Posted 1 year ago 1 year
on Bout It (prod. Ramaj Eroc)
ramaj!! Posted 1 year ago 1 year
on (baby) it's you
good god Posted 1 year ago 1 year
on (baby) it's you
chord prog on locc Posted 1 year ago 1 year
on (baby) it's you these melodies are so sweet and delectable!!! Posted 1 year ago 1 year
on Hypocritical (feat. Pell) <3<3<3<3 Posted 1 year ago 1 year on Hypocritical (feat. Pell)
oh fuck i am in Posted 1 year ago 1 year
on Daily
so clean Posted 1 year ago 1 year
on Daily
love you guys Posted 1 year ago 1 year
on late nights (2014)
on par Posted 1 year ago 1 year
on Ataraxia
soothing Posted 1 year ago 1 year
on High Stakes
smashing Posted 1 year ago 1 year
on Smoke And Retribution feat. Vince Staples & Kučka
basically the whole track is mad cash Posted 1 year ago 1 year
on Smoke And Retribution feat. Vince Staples & Kučka vox are perfect, synths are perfect, cymbals are perfect Posted 1 year ago 1 year
on Smoke And Retribution feat. Vince Staples & Kučka
this is fucking legendary Posted 1 year ago 1 year
on Inner Beauty (Out Now, Free)
very interesting Posted 1 year ago 1 year
on Katy B x KAYTRANADA - Honey
<3<3 Posted 1 year ago 1 year
on josh pan & X&G - platinum
hella hot shit mann Posted 1 year ago 1 year
on try to change your name
keep up the good work Posted 1 year ago 1 year
on falcxne - Forthenight
absolutely stunning Posted 1 year ago 1 year on Day Ones ft Novelist & Leikeli47
@uuvvuu: damn Posted 1 year ago 1 year on Day Ones ft Novelist & Leikeli47
damn Posted 1 year ago 1 year
on Volcano Zone
spicy! Posted 1 year ago 1 year
on fumes
: ) Posted 1 year ago 1 year on Sunny D. Light - Stay Down (Prod. By Cresce)
dang Posted 1 year ago 1 year on Paying Dues Ft. Ramaj Eroc (Prod. Casanova Beats)
hold up Posted 1 year ago 1 year
on residential representation
@foolish_artist: i appreciate that! Posted 1 year ago 1 year
on #DaFutureShow #15 BAESIC
yee Posted 1 year ago 1 year
on Tuesday
mad relaxing. thanks dudd Posted 1 year ago 1 year
on trust
damn otxhello Posted 1 year ago 1 year on Darker Waters
sick Posted 1 year ago 1 year
on Andrew Luce - You Should Go
this has just the right amount of intensity Posted 1 year ago 1 year
on Fame (feat. Clans)
@officialloki: right??? jesus Posted 1 year ago 1 year
on PARTY IN THE USA (DOJO! REMIX)
@oylo: needless to say mine suuuuucked Posted 1 year ago 1 year
on PARTY IN THE USA (DOJO! REMIX) i remixed this once when i had like 54 followers haha Posted 1 year ago 1 year
on PARTY IN THE USA (DOJO! REMIX)
very nice <33 Posted 1 year ago 1 year on Tory Lanez - Woods (Vices Remix)
raunchy as hellllll Posted 1 year ago 1 year
on Tory Lanez - Woods (Vices Remix)
sweet Posted 1 year ago 1 year on Mozado - Home For The Night (feat. Rosé)
super smooth Posted 1 year ago 1 year on YELLOW ALERT (FEAT. DUMBFOUNDEAD)
damn son Posted 1 year ago 1 year
on Intimate Feat. E.Doza
very nice vibe. elegant Posted 1 year ago 1 year
on MGMT - KIDS (LUCA LUSH REDO)
nice one Posted 1 year ago 1 year
on withdrawn, without dawg Posted 1 year ago 1 year
on finesse
i am finessed Posted 1 year ago 1 year on Can't You See feat Kolada
: ) Posted 1 year ago 1 year on Can't You See feat Kolada
@coubo: love you homie Posted 1 year ago 1 year
on fall
son of a gun Posted 1 year ago 1 year
on woosta- bakery
magnificent Posted 1 year ago 1 year
on woosta- bakery !~@o@~! Posted 1 year ago 1 year
on Kingbnjmn ~ What I Like (Ft. Krs. & Dutchboy)
fuccccccck Posted 1 year ago 1 year
on Kingbnjmn ~ S.J.L.M (Ft. SOS Dynamikz & Krs.) if this ain't the most gorgeous shit i've heard all week Posted 1 year ago 1 year
on Kingbnjmn ~ Right Now (Ft. Krs.)
i'm stuck Posted 1 year ago 1 year
on Kingbnjmn ~ Right Now (Ft. Krs.)
i'm just sitting here, idle, with a smile on my face Posted 1 year ago 1 year
on Wifi Emoji
holy Posted 1 year ago 1 year
on Cronii - Cartier Wrist (Prod. By Antonio)
h a r d aka my dick rn bc this shit is cash Posted 1 year ago 1 year
on Down For Whatever (feat. Pell)
sex Posted 1 year ago 1 year
on Down For Whatever (feat. Pell)
i'm envious of you Posted 1 year ago 1 year
on Towerz - Mesh
bells are just ridiculous Posted 1 year ago 1 year
on Towerz - Mesh
fuck Posted 1 year ago 1 year
on Towerz - Mesh you got these trap patterns on lock!! Posted 1 year ago 1 year
on Towerz - Mesh
hahah daaaaaaamn Posted 1 year ago 1 year
on Towerz - Mesh
telling a story Posted 1 year ago 1 year
on RESET
str8 grime Posted 1 year ago 1 year
on Dugong Jr - Secrets (feat. Tashka)
beautiful <3333 Posted 1 year ago 1 year
on Dugong Jr - Secrets (feat. Tashka)
you done did it now son Posted 1 year ago 1 year on graves & Dreamer - im friends w 25 letters of the alphabet, i dont know y
raw Posted 1 year ago 1 year
on Disney Castle ft.vicking
@vicking1998: nah dude, thank you guys Posted 1 year ago 1 year
on slowmix #3
<3 Posted 1 year ago 1 year
on slowmix #3
damn this gets me Posted 1 year ago 1 year
on slowmix #3
@lechefolife: hooray Posted 1 year ago 1 year
on Saen. - All I Need
@xxx: but do you tho?? do you bro?? due ewe?????? Posted 1 year ago 1 year
on Pink Cloud (Madnap Remix) [feat. Max Collins]
oh my Posted 1 year ago 1 year
on SG Lewis - No Less (Phairo Remix)
sick Posted 1 year ago 1 year on SG Lewis - No Less (Phairo Remix)
we've got the groove over here! come join yeee Posted 1 year ago 1 year
on EXPIRED
savage Posted 1 year ago 1 year
on cruel intentions
goodness Posted 1 year ago 1 year
on Saen. - All I Need
insaen drumwork Posted 1 year ago 1 year on Cosmic Quest & RJ Tripps - Drip Quark ft. Monster Lips
love this! Posted 1 year ago 1 year on Cosmic Quest & RJ Tripps - Drip Quark ft. Monster Lips
this is some fancy ish Posted 1 year ago 1 year on Y2K & lil aaron - DAMN
hot diggity Posted 1 year ago 1 year
on Discontent
i like it Posted 1 year ago 1 year
on Hansol,YANO - The Monster (Cover)
rad! Posted 1 year ago 1 year on Ye Eun - I Love You 원더걸스 예은 - 난 널 사랑해 Yesterday 20140329
the crowd = my feelings Posted 1 year ago 1 year on Ye Eun - I Love You 원더걸스 예은 - 난 널 사랑해 Yesterday 20140329
<3<3 beautiful Posted 1 year ago 1 year
on J - Man X Jeong Uk - Hello Bitches Remix
god damn Posted 1 year ago 1 year on D.O.D -SOOM
i'm doing my power dance Posted 1 year ago 1 year
on JEONG UK - START
!!!! Posted 1 year ago 1 year
on JEONG UK - START daaaaamn y'all go hard over there Posted 1 year ago 1 year
on DAY6 - OOH - AHH하게
dope Posted 1 year ago 1 year
on ZONE 3
: ) : ) Posted 1 year ago 1 year
on baku 劋
lord have mercy Posted 1 year ago 1 year
on Crapface x ZEN - Bounce Babes dang Posted 1 year ago 1 year
on Crapface x ZEN - Bounce Babes
is that kelis????? Posted 1 year ago 1 year
on Crapface x ZEN - Bounce Babes
holy smokes Posted 1 year ago 1 year
on My Crib this is actually really fresh. who prod? Posted 1 year ago 1 year
on olli - i had you
oh olli Posted 1 year ago 1 year
on Terrified (Cover) Katherine McPhee
nice one Posted 1 year ago 1 year on LOVING YOU (Minnie Riperton) - COVER cute Posted 1 year ago 1 year
on seeing things
medasin Posted 1 year ago 1 year on for a good friend of mine [prod. SNUKA]
@notallofme-notnoneofme: <4 Posted 1 year ago 1 year
on Right 4 Me (prod. By R.O.M)
fiery Posted 1 year ago 1 year on for a good friend of mine [prod. SNUKA]
<3 Posted 1 year ago 1 year
on i will do what i have to do
!!!!! whaaaaat Posted 1 year ago 1 year
on different
man u r good Posted 1 year ago 1 year
on 10. Pretty Baby Dozier (lets Go Study Og)
cool Posted 1 year ago 1 year on Louis The Child - It's Strange (SoySauce Remix)
huuuuge remix Posted 1 year ago 1 year on Louis The Child - It's Strange (SoySauce Remix)
wow -- flames Posted 1 year ago 1 year
on LIPS w/ Mike Frost & Save
!!!!! Posted 1 year ago 1 year
on no losses
you are fucking crazy Posted 1 year ago 1 year
on aqua
yuppp Posted 1 year ago 1 year
on aqua
gotta catch mu breathe Posted 1 year ago 1 year
on UP w/ Smino, Monte Booker & Elias Abid
: ) Posted 1 year ago 1 year
on Pick Up's with Akouo - Episode 006
wow this shit is dope Posted 1 year ago 1 year
on Jack Chainz - Lust
nicely done Posted 1 year ago 1 year
on sing to me (feat. peter collins)
<3<3 OoO Posted 1 year ago 1 year
on sing to me (feat. peter collins) oh fuck!! two new swell posts??!?!? my birthday is in like six months man, you are early Posted 1 year ago 1 year
on Zekk - Bumps (Elevation Remix)
hooooooly Posted 1 year ago 1 year on NO MORE PARTIES IN L.A. FEAT. KENDRICK LAMAR
god damn kanye Posted 1 year ago 1 year on NO MORE PARTIES IN L.A. FEAT. KENDRICK LAMAR
damn this is hard Posted 1 year ago 1 year
on Nyck Caution ft. Dyemond Lewis & Denzel Curry - "Nyctophilia" (Prod. by Soulstruck)
well i'm dead Posted 1 year ago 1 year
on Dawn To Flight
i can dig Posted 1 year ago 1 year
on Towerz - Breach
killin Posted 1 year ago 1 year
on Towerz - Breach
good composition. keeping me interested Posted 1 year ago 1 year
on Towerz - Breach
this is fresh fam! Posted 1 year ago 1 year
on LeafHurricaneKix
lit Posted 1 year ago 1 year on Pink Freud plays Autechre LP – B2 - Basscadet
wicked wild Posted 1 year ago 1 year
on Soul
good golly Posted 1 year ago 1 year
on Elevation - Gone
chameleon Posted 1 year ago 1 year on GET DRESS TO THIS // baby & ness mix
can anyone spell ' d a n k ' ???? Posted 1 year ago 1 year
on harris cole - rain (aedfx remix)
fuck em up fam Posted 1 year ago 1 year
on harris cole - rain (aedfx remix)
dope remix. this is hella my shit Posted 1 year ago 1 year
on If You Ain't
kill it Posted 1 year ago 1 year
on If You Ain't
this some real trap shit Posted 1 year ago 1 year
on whispers really loving this man! keep it up. drums kept me bumpin Posted 1 year ago 1 year on ayo. & .disfnk - Perfecto. (ft. Daniela Andrade)[Download Link In Description]
man why didn't i hear this earlier. gg Posted 1 year ago 1 year
on vbnd - memories
vbnd Posted 1 year ago 1 year
on VBND - Where Did Your Love Go
u take me there Posted 1 year ago 1 year
on Level Up
bruh Posted 1 year ago 1 year
on How Deep Is Your Voice
damn this deep Posted 1 year ago 1 year
on Flume - Some Minds (ft. Andrew Wyatt) [Frison Remix]
wavy! Posted 1 year ago 1 year on Aaron Cartier - YMCA
good stuff Posted 1 year ago 1 year
on Go Away (VIDEO IN DESCRIPTION)
hell nah don't need em Posted 1 year ago 1 year
on Alizé
really into this Posted 1 year ago 1 year
on Day I Die [Prod.Shax Maja]
tight Posted 1 year ago 1 year
on destination feat. rom oh man. everything i've heard today has just been perfect Posted 1 year ago 1 year
on You & I (w/ ConsciousThoughts)
disco!!!! Posted 1 year ago 1 year on You & I (w/ ConsciousThoughts)
catchin waves left and right Posted 1 year ago 1 year
on You & I (w/ ConsciousThoughts)
happy surfing everybody Posted 1 year ago 1 year on Kill Our Way To Heaven (No Tv No Radio Remix)
that snare Posted 1 year ago 1 year
on Life's A Game
sure is Posted 1 year ago 1 year
on Airwav - Dreaming In Colour
you are so creative dude Posted 1 year ago 1 year
on Saccharine
just lovely Posted 1 year ago 1 year
on Saccharine so fun and vibrant Posted 1 year ago 1 year
on Zodiac feat. Masego (prod. by Tedd Boyd)
y'all Posted 1 year ago 1 year
on PRAYER
oh god this right here Posted 1 year ago 1 year
on PRAYER
fantastic. drums are mad Posted 1 year ago 1 year
on beyourgirl
<3 Posted 1 year ago 1 year
on kev & cehryl - Fragments
@max-reist: whoa. what a journey of a comment thread Posted 1 year ago 1 year
on BLANDA - Sinquisitive [Nest HQ Premiere] yeesssss Posted 1 year ago 1 year on Winter Wonderland by Jens Kiilstofte (Machinimasound)
spooky Posted 1 year ago 1 year on Engulfing Shadows by Jens Kiilstofte (Machinimasound)
so good. love this industrial vibe Posted 1 year ago 1 year on Engulfing Shadows by Jens Kiilstofte (Machinimasound)
portal hahaha????? <3 Posted 1 year ago 1 year
on Ecstatic Wave by Jens Kiilstofte
awesome! Posted 1 year ago 1 year
on 10 Years (Acoustic)
loving this guitar Posted 1 year ago 1 year
on Happy Holidays!
cool Posted 1 year ago 1 year
on MYSELF i am loving my stream right now. thanks man Posted 1 year ago 1 year
on Wiwek - Speedy Birds
omg Posted 1 year ago 1 year
on 01 Jack Boy Anthem (Prod. Mason Flynt & Buji)
damn this is tight Posted 1 year ago 1 year
on 01 Jack Boy Anthem (Prod. Mason Flynt & Buji)
these drums are lit Posted 1 year ago 1 year
on FORGIVE ME
nigga you evil Posted 1 year ago 1 year
on INTERNAL DISINTEGRATION (w/[MSTR SHRDR])
<3 this synth so much jfc Posted 1 year ago 1 year
on INTERNAL DISINTEGRATION (w/[MSTR SHRDR])
insane 808s Posted 1 year ago 1 year
on INTERNAL DISINTEGRATION (w/[MSTR SHRDR])
it's like being beaten up by concrete Posted 1 year ago 1 year on Seasons (w/ verzache) - STU DRUMKIT VOL 2 - https://sellfy.com/ p/DUej/
tribin?? Posted 1 year ago 1 year on Seasons (w/ verzache) - STU DRUMKIT VOL 2 - https://sellfy.com/ p/DUej/
!~! Posted 1 year ago 1 year
on IN VAIN
lovely Posted 1 year ago 1 year
on IN VAIN
wow. what a ride Posted 1 year ago 1 year
on IN VAIN good thing i took a shit before i heard this Posted 1 year ago 1 year
on IN VAIN
hnnnnnnng Posted 1 year ago 1 year
on IN VAIN
you're gonna overheat Posted 1 year ago 1 year
on IN VAIN
calm down fam Posted 1 year ago 1 year
on Fever Dreams (feat. Taylor Fernandez)
@frisonmusic: thiss x 10000000 Posted 1 year ago 1 year
on Fever Dreams (feat. Taylor Fernandez)
@iamdukes: right Posted 1 year ago 1 year
on O.rka x Ykwo - Cruithne (Free Download)
dark Posted 1 year ago 1 year
on O.rka || PRTYNXTDR
these synths are luscious Posted 1 year ago 1 year
on O.rka || PRTYNXTDR
super! Posted 1 year ago 1 year
on residential representation
@o-rka: <3<3 Posted 1 year ago 1 year
on kev - Evening News ft. NATEY (remix)
@coubo: hahah what's up buddy Posted 1 year ago 1 year on Young Thug - With That (Cresce x Sensi Sye Remix)
ughhhhhh <3<3<3<3 Posted 1 year ago 1 year on Young Thug - With That (Cresce x Sensi Sye Remix) every fucking time i hear this. it never gets old omg Posted 1 year ago 1 year
on Set It Out
outstanding Posted 1 year ago 1 year
on Set It Out
man music is getting wild yall Posted 1 year ago 1 year
on Set It Out
fancy fancy Posted 1 year ago 1 year
on Late Nights (Prod. Blair Norf)
lines 4 dayssss Posted 1 year ago 1 year
on Late Nights (Prod. Blair Norf)
good god man Posted 1 year ago 1 year on Welcome In (Prob. Blair Norf)
this is lit Posted 1 year ago 1 year
on Welcome In (Prob. Blair Norf)
dank Posted 1 year ago 1 year
on We Out (Prod. By MIAZ)
miaz killin Posted 1 year ago 1 year
on We Out (Prod. By MIAZ)
u sure do have bars Posted 1 year ago 1 year
on We Out (Prod. By MIAZ)
mad clean Posted 1 year ago 1 year on Rich Boy - Throw Some D's (CiDi Flip)
!!!!!!!!! i'm dead Posted 1 year ago 1 year on Leah Suh - What If (Mezzo Remix)
i love you Posted 1 year ago 1 year
on Robin Hood
fuck Posted 1 year ago 1 year
on Robin Hood
i just Posted 1 year ago 1 year
on Robin Hood so goddamn hard fam. like how Posted 1 year ago 1 year
on Halpe - Emerald (Mezzo Remix)
!!!!!! can't believe this rn Posted 1 year ago 1 year
on Panda
outstanding Posted 1 year ago 1 year
on Panda hahaha w h a t the f u c k i ng h elll Posted 1 year ago 1 year
on Grafta Presents - SUMMER UNWIND
spankin Posted 1 year ago 1 year
on Unexplained Produced By Chris Fields
ayy Posted 1 year ago 1 year
on Vega22 - GHETTO22(Serge P Remix) [Mako Records]
damn this dark Posted 1 year ago 1 year on Lipstick & Liquor x Mixtape 3.0 (Hosted By MC Undercover)
mad dance vibes Posted 1 year ago 1 year
on Come On (Original Mix) [MHTRSH088]
<3 Posted 1 year ago 1 year
on Cntrld (Original Mix) [live mix] dang dude Posted 1 year ago 1 year
on Cntrld (Original Mix) [live mix]
clap clapclapclap clap clapclap clap clap Posted 1 year ago 1 year
on Alcala -Day By Day
slamming Posted 1 year ago 1 year
on Journey Together (Now on Vinyl)
<3<3 wonderful Posted 1 year ago 1 year on Tory Lanez - Diego [ERRE CONWAY BOOTLEG] FREE DOWNLOAD
grooving Posted 1 year ago 1 year
on rt - plnz
deep in there Posted 1 year ago 1 year
on rt - plnz
this is a nice one Posted 1 year ago 1 year
on Myriad Mix II
vibes af Posted 1 year ago 1 year
on Myriad Mix II
these synths are sick Posted 1 year ago 1 year
on Myriad Mix II
tight! Posted 1 year ago 1 year
on Dope Fiend.
flyin Posted 1 year ago 1 year
on Hard Hitta i was born in evansville Posted 1 year ago 1 year
on Hard Hitta
lit claps Posted 1 year ago 1 year
on Space Oddity (Lido's Salute)
@prestigeelite: #whereintheworldisoylo Posted 1 year ago 1 year
on Space Oddity (Lido's Salute)
@gbsp: where's oylo Posted 1 year ago 1 year
on Red
good shit Posted 1 year ago 1 year on Love Yourself [ben maxwell X Futuristic X Devvon Turrell Flip] (buy = free DL)
!!!!! Posted 1 year ago 1 year
on Space Oddity (Lido's Salute)
lido Posted 1 year ago 1 year
on brother mynor - paint by numbers
love you man Posted 1 year ago 1 year
on Jungle (Feat. Masego)
<3 mmmm Posted 1 year ago 1 year
on llamar
go!! Posted 1 year ago 1 year
on 4 Hours In Phoenix didn't mean to make two(three) comments Posted 1 year ago 1 year
on 4 Hours In Phoenix scream improv vocals over the entire track Posted 1 year ago 1 year
on 4 Hours In Phoenix
u know it's fantastic when you Posted 1 year ago 1 year
on Dream Gurl
slammin emotions Posted 1 year ago 1 year on Take Two
superb tune Posted 1 year ago 1 year
on the escape from the evil queen ft. zack villere
you guys are so dope together Posted 1 year ago 1 year on Alison Wonderland - Already Gone (ft. BRAVE & Lido) [Far & Few X LOKI Flip]
outstanding Posted 1 year ago 1 year
on all you were
<3<3 Posted 1 year ago 1 year
on Drew Howard & Birthday Boy - They Love Me
@coubo: hello good friend <3 Posted 1 year ago 1 year
on Drew Howard & Birthday Boy - I Won't Judge You
this is just outstanding Posted 1 year ago 1 year on Drew Howard & Birthday Boy - Robin Williams
this is where this came from?? Posted 1 year ago 1 year
on Drew Howard & Birthday Boy - Robin Williams
whoa Posted 1 year ago 1 year
on Walk
supreme Posted 1 year ago 1 year
on Dear Love Ft. Dana
wow Posted 1 year ago 1 year
on Beyonce- Party (Birthday Boy Version) i am tripping out right now. like you're giving me tunnel vision Posted 1 year ago 1 year
on Drew Howard & Birthday Boy - They Love Me
still hot on this shit Posted 1 year ago 1 year on Drew Howard & Birthday Boy - They Love Me
hubba hubba Posted 1 year ago 1 year
on Clutch
hahah yeaaah Posted 1 year ago 1 year
on Clutch
this brings me back Posted 1 year ago 1 year
on kev - Evening News ft. NATEY (remix)
sick break Posted 1 year ago 1 year
on Grey Killer - Fancy
super trill Posted 1 year ago 1 year
on Genghis Khan (Louis The Child Remix)
spacey Posted 1 year ago 1 year on Baja Seol
super clean mix! very cool Posted 1 year ago 1 year
on HOP BOX - Standoff
swangin Posted 1 year ago 1 year
on Take/Five & DELAY - Alone
okayy Posted 1 year ago 1 year
on Robin (Summer 2013)
fuckin love ya nature!! Posted 1 year ago 1 year
on llamar
boy Posted 1 year ago 1 year on happytree - Rolex (prod. lewi astro)
slayer Posted 1 year ago 1 year on Lil Dicky - $ave Dat Money (Guyboy Remake)
livid clapping going on over there Posted 1 year ago 1 year
on Flea
!!! Posted 1 year ago 1 year
on Guyboy - Customer Service
god damn Posted 1 year ago 1 year
on Guyboy - Specialty Jobs
flowing like a river Posted 1 year ago 1 year
on Guyboy - Specialty Jobs
excellence Posted 1 year ago 1 year
on OG 177
haunted egyptian mansion type vibes Posted 1 year ago 1 year
on OG 177 already tell this shit og Posted 1 year ago 1 year
on Lonely for Christmas :'( ...... <3
delicious. had a fun time. ty Posted 1 year ago 1 year
on Lonely for Christmas :'( ...... <3
up! Posted 1 year ago 1 year
on Lonely for Christmas :'( ...... <3
litttt Posted 1 year ago 1 year
on Lonely for Christmas :'( ...... <3
serenity <3 Posted 1 year ago 1 year on I Still Think About You All The Time. (and It Kills Me)
!!!!!!!!!!!!!! Posted 1 year ago 1 year on I Still Think About You All The Time. (and It Kills Me) good fucking god! every piece is so beautifully intertwined with the others in such a delicate and powerful manner like wtf Posted 1 year ago 1 year
on I Still Think About You All The Time. (and It Kills Me)
so thickkkkkkkk Posted 1 year ago 1 year
on I Still Think About You All The Time. (and It Kills Me)
you deserve everything Posted 1 year ago 1 year
on I Still Think About You All The Time. (and It Kills Me)
oh god i am in this shit Posted 1 year ago 1 year
on Sometimes You Never Know
wutran this shit is so damn good Posted 1 year ago 1 year
on Red Bull And Versace
good lord Posted 1 year ago 1 year
on Red Bull And Versace geez dude this is flamin Posted 1 year ago 1 year
on alma
full of love Posted 1 year ago 1 year
on Mura Masa ~ Midas Touch (Somba Melt)
holy moly Posted 1 year ago 1 year on Autolaser & Father Dude - About Face [Thissongissick.com Premiere] [Free Download]
my oh my yall Posted 1 year ago 1 year
on Get Back ft. Grande Marshall x Pauly Sue
feelin it Posted 1 year ago 1 year
on aching for you
:) Posted 1 year ago 1 year
on lofi.hiphop [ 001 ] good golly Posted 1 year ago 1 year on M'$ (KYRAL X BANKO X G-REX REMIX) *FREE DL IN BUY*
yeeee Posted 1 year ago 1 year
on Got Me (Prod By. Hudson East, Scoops & Rascal)
damn this is fine Posted 1 year ago 1 year
on saito - college drop
whuttt Posted 1 year ago 1 year
on Q U A T T R Ø ~ DRIZZY
ice cold Posted 1 year ago 1 year
on The Ride (Video in Description)
very very cool Posted 1 year ago 1 year
on The Ride (Video in Description) wicked Posted 1 year ago 1 year
on There Are No Angels Watching Over Us
kinda spooky my man Posted 1 year ago 1 year
on Tibe - Cliffhanger Ft. Falcxne
sweatin Posted 1 year ago 1 year
on U & I (Deathtoven x Holy Rain)
dank Posted 1 year ago 1 year on Maxo - Reach You (Mitomoro Remix) [NEST HQ PREMIERE]
<3 Posted 1 year ago 1 year
on SC036 Ducky - SPLIT
whuuuuut Posted 1 year ago 1 year
on heir to the sugar honey queen
welp this is too frickin tight Posted 1 year ago 1 year
on heir to the sugar honey queen
mad swifty Posted 1 year ago 1 year
on striped
killed it Posted 1 year ago 1 year
on Im Blessed w/ Mayzin & Toni B
yessss Posted 1 year ago 1 year
on allah - jordans (whereisalex remix)
gorgeous Posted 1 year ago 1 year on deDunamis - "Voyage" [RMG EXCLUSIVE SINGLE]
damn this a fantastic track Posted 1 year ago 1 year
on Intro
*man Posted 1 year ago 1 year
on Intro
you've got me chillin me Posted 1 year ago 1 year
on dojo - Blossom
;) Posted 1 year ago 1 year
on Find My Way
nice Posted 1 year ago 1 year
on Why u Did This
this is fucking ridiculous Posted 1 year ago 1 year
on SAY THAT!
my boy Posted 1 year ago 1 year on [X] A T L A N T I S - R I S I N G
getting intense Posted 1 year ago 1 year on Mynerva - Passion Fruit
:) :) Posted 1 year ago 1 year
on ICE
tells a good story Posted 1 year ago 1 year
on lux.impala - Wrist
@sharpflame: are you really that much of an ass Posted 1 year ago 1 year
on at odds
@indigobeck: i got you fam Posted 1 year ago 1 year
on at odds
@geethanksmister: appreciate it man Posted 1 year ago 1 year
on at odds
@traxell: thank you dad Posted 1 year ago 1 year on at odds
@officialloki:
on at odds
@maggysu: thanks man Posted 1 year ago 1 year
on at odds
@crapface: :) Posted 1 year ago 1 year
on at odds
@indigobeck: yeah... accidental Posted 1 year ago 1 year
on lose you w/ mydigo
done gone the fuck off Posted 1 year ago 1 year
on lose you w/ mydigo
bruh Posted 1 year ago 1 year on lose you w/ mydigo
jeez Posted 1 year ago 1 year
on run with me good lord. i am blown away rn Posted 1 year ago 1 year
on run with me
kingly Posted 1 year ago 1 year
on run with me
r.i.p. everyone else Posted 1 year ago 1 year
on run with me so much sass in this lead omg Posted 1 year ago 1 year
on run with me
what the fuck is going on Posted 1 year ago 1 year
on run with me dude. this is a side of you i have not seen Posted 1 year ago 1 year
on run with me
damn what a round kick Posted 1 year ago 1 year
on Rango 001
love it Posted 1 year ago 1 year
on Rango 001
power Posted 1 year ago 1 year
on Tomato Land
wicked Posted 1 year ago 1 year
on Tomato Land excited to hear what's coming from you two this year. cheers Posted 1 year ago 1 year
on OPTIMISM seno!!!!!!! whaaaaatttt Posted 1 year ago 1 year
on Imad Royal - Queen of France (Delamare Remix)
good stuff delamare! Posted 1 year ago 1 year
on you're alright
bullet train to flamin town Posted 1 year ago 1 year
on [Exclusive} fvchsia & oceans - rain
only feeld Posted 1 year ago 1 year on Original Dope Crew - Know Better [prod. No Tv No Radio]
og dope for real Posted 1 year ago 1 year
on Hailstorm
goodness me Posted 1 year ago 1 year
on Hailstorm damn i'm all about this shit Posted 1 year ago 1 year
on Loop.holes - MARY JANE.WAV
@occultscience: yes snare Posted 1 year ago 1 year
on Confliction
am i tripping Posted 1 year ago 1 year
on the journey
@weirdromance: i love your comments Posted 1 year ago 1 year
on the journey
i really like this josh Posted 1 year ago 1 year
on Traxell X Mo Vibez - Absolution
awesome Posted 1 year ago 1 year
on Traxell X Mo Vibez - Absolution
v dope Posted 1 year ago 1 year
on Traxell X Mo Vibez - Absolution
the pan here is destroying my reality Posted 1 year ago 1 year
on Michael Jackson - Dirty Diana (kellbender remix)
good god how amazing Posted 1 year ago 1 year
on Michael Jackson - Dirty Diana (kellbender remix)
you understand me Posted 1 year ago 1 year
on WHAT YOU SEEK
mad chill Posted 1 year ago 1 year
on i just want you to know
sick! Posted 1 year ago 1 year
on i just want you to know every once in a while a gem like this comes flowing through. straight to the top my friend Posted 1 year ago 1 year on J.Robb & West1ne - Don't Stop
rad Posted 1 year ago 1 year on J.Robb & West1ne - Don't Stop
rippin Posted 1 year ago 1 year on J.Robb & West1ne - Don't Stop
robust Posted 1 year ago 1 year on J.Robb & West1ne - Don't Stop
real Posted 1 year ago 1 year on J.Robb & West1ne - Don't Stop
raging Posted 1 year ago 1 year on J.Robb & West1ne - Don't Stop
rapid Posted 1 year ago 1 year
on Senojnayr - Haze
this that pant-shitting kinda tune Posted 1 year ago 1 year
on Senojnayr - Haze
incredible Posted 1 year ago 1 year on Rossario - Life Goes On [Rough Frank Ocean Freestyle]
^^ Posted 1 year ago 1 year on Rossario - Life Goes On [Rough Frank Ocean Freestyle]
tell em bruh Posted 1 year ago 1 year
on Roses (feat. ROZES)
i will i will Posted 1 year ago 1 year
on Renai Circulation (Vantage "Long Version pls" Remix)
!!!!!!!!!!! yeah!!!! Posted 1 year ago 1 year on Winter Haze (prod. Vbnd)
jfc Posted 1 year ago 1 year
on Winter Haze (prod. Vbnd)
holy moly Posted 1 year ago 1 year
on Winter Haze (prod. Vbnd) am throwing up from how beautiful this is Posted 1 year ago 1 year
on Halpe - Dreamcast i just cannot believe how well done this is Posted 1 year ago 1 year
on ෛ͚ͭ෭
i appreciate what youv'e done here Posted 1 year ago 1 year
on Rae Nasty
hnnng those kicks killin me Posted 1 year ago 1 year on Rae Nasty
damn son!!! Posted 1 year ago 1 year
on Creepa - Todos
congrats creepa!! Posted 1 year ago 1 year
on Hide Myself
dope Posted 1 year ago 1 year
on Hide Myself
i like the intense vibes you're tossing Posted 1 year ago 1 year
on Gas
that was really cool Posted 1 year ago 1 year on Young Thug - With That (Cresce x Sensi Sye Remix)
can anybody say dank?? Posted 1 year ago 1 year on Young Thug - With That (Cresce x Sensi Sye Remix)
screamcry Posted 1 year ago 1 year
on residential representation
@insuranceisnotfree: you are sexy Posted 1 year ago 1 year on No Name Lover w/ King Willie [*NEW VIDEO IN DESCRIPTION*]
take me away willie Posted 1 year ago 1 year on No Name Lover w/ King Willie [*NEW VIDEO IN DESCRIPTION*]
turn down the thermostat. holy shit Posted 1 year ago 1 year on No Name Lover w/ King Willie [*NEW VIDEO IN DESCRIPTION*]
i am melting Posted 1 year ago 1 year
on session w/ kolada
@imgoldwater: ayy 2 years strong Posted 1 year ago 1 year
on residential representation @cam_jordyn: thank you wery much! Posted 1 year ago 1 year
on coagulate (w/ cherishh)
meow <3 Posted 1 year ago 1 year
on coagulate (w/ cherishh)
flaming wings Posted 1 year ago 1 year
on coagulate (w/ cherishh)
stay holdin it down Posted 1 year ago 1 year
on kashmir
god damn!!! these keys!!! Posted 1 year ago 1 year
on kashmir
oh so u chill huh Posted 1 year ago 1 year
on kashmir decimation Posted 1 year ago 1 year
on kashmir
<3<3<3 Posted 1 year ago 1 year
on kashmir
i want this snare Posted 1 year ago 1 year
on kashmir oh buddy here it comes Posted 1 year ago 1 year
on Freestyle First Mix
i can dig Posted 1 year ago 1 year
on h&rr
nice Posted 1 year ago 1 year
on stories
@fredsteres: <3 Posted 1 year ago 1 year
on session w/ kolada
@yaejilee: thank you yaeji!! Posted 1 year ago 1 year
on Caturday
good shit fam Posted 1 year ago 1 year
on Disney Castle ft.vicking
d Posted 1 year ago 1 year
on Disney Castle ft.vicking this track is still one of the best things i've ever hear Posted 1 year ago 1 year
on close your eyes
oh snappp Posted 1 year ago 1 year
on idle hour ft. dawson & kolada
@iamairwav: always and forever Posted 1 year ago 1 year
on lux.impala - Wrist
@dj-tapecut: but i mean you used L for the first one, why would the second one be different Posted 1 year ago 1 year
on lux.impala - Wrist
@dj-tapecut: how tf did you manage to type that Posted 1 year ago 1 year
on 1833 Live: The NXCB4XMAS with CRAPFACE
<3<3<3<3 love you crapfaaaaaace Posted 1 year ago 1 year
on my heart weighs me down
hot sugar Posted 1 year ago 1 year
on my heart weighs me down
yo this seriously trippy Posted 1 year ago 1 year
on my heart weighs me down
hey i know you Posted 1 year ago 1 year
on Made You
you are very talented Posted 1 year ago 1 year
on Halpe - Viento
<3 u dawg Posted 1 year ago 1 year on Braeden Bailey - turning into sam gellaitry.
wicked cool homie Posted 1 year ago 1 year
on Teddy - Anxious (Prod. Tülpa)
yes bruh!! Posted 1 year ago 1 year
on What Did You Dream(DEMO)
@teenage-ears: agreed Posted 1 year ago 1 year
on Aire - Tea Time (Kaivaan Remix)
maniacal Posted 1 year ago 1 year on Banana Shake
soaring!! Posted 1 year ago 1 year
on eyes to the sky
♥o♥ Posted 1 year ago 1 year
on Cherry Blossom
<3 Posted 1 year ago 1 year
on Cherry Blossom
damn these hi hats are mad trill Posted 1 year ago 1 year on serea x sayuw - when the rain ends
sunrays Posted 1 year ago 1 year on serea x sayuw - when the rain ends
magnificent Posted 1 year ago 1 year on i don't want to be sad ever again
where have you been all my life Posted 1 year ago 1 year
on (coastal)
@quis-atg-smith: same Posted 1 year ago 1 year
on The Force (TURN UP)
well holy hell Posted 1 year ago 1 year
on Endeavor - Destiny (Julian Remix)
wicked cool man Posted 1 year ago 1 year
on Chemical (FREE DL)
damn this goes deep Posted 1 year ago 1 year on Shockwave [Check Out Armaggedon] - Julian - Bring It Back [Shockwave Remix]
spankin bruh Posted 1 year ago 1 year on Red Legacies
dark Posted 1 year ago 1 year
on señorita (feat. deverano)
slam dunk Posted 1 year ago 1 year on j. roosevelt x Lea Beiley - Subtract & Divide
damn!! this melody is cute Posted 1 year ago 1 year
on Thinking 'Bout You (demo)
<3<3 Posted 1 year ago 1 year
on Thinking 'Bout You (demo)
god damn Posted 1 year ago 1 year
on Sketches
sick!! Posted 1 year ago 1 year on are you that somebody?
boy am i a sucker for super wet percs Posted 1 year ago 1 year
on Bum (Thank you for 300 Followers!)
so cute! <3 Posted 1 year ago 1 year
on Daydreamin Ft. Kuyler (prod.by Manitee)
yuhhhh Posted 1 year ago 1 year on dick up in her (feat. barry love) [prod. j. robb]
rad Posted 1 year ago 1 year
on Bunkin w/ octbr
what now??? Posted 1 year ago 1 year
on Spire - Petal Falls
@tristitia: untilegible... hmm... Posted 1 year ago 1 year on Little Simz x BadBadNotGood - Our Conversations (Red Bull 20 Before 16)
these crying string are god Posted 1 year ago 1 year
on Mas Ysa - Arrows (Love Thy Brother Remix)
for sure deep Posted 1 year ago 1 year on NGHTMRE & Boombox Cartel - Aftershock ($unday $ervice Remix)
she's a beaut Posted 1 year ago 1 year
on K.B - honest (uth fruit & KYLI remix)
wow you two have outdone yourselves Posted 1 year ago 1 year
on 808s & birthdaycakes
great twist man Posted 1 year ago 1 year
on ♡CRÜSH♡ Feat. Virtual Brat
bouncyy Posted 1 year ago 1 year on ♡CRÜSH♡ Feat. Virtual Brat
awh :333 Posted 1 year ago 1 year
on On & On
word Posted 1 year ago 1 year
on Hooptie (prod. D-errick)
dank Posted 1 year ago 1 year
on rained on the bay this morning
kiiiiinnnnnnnddddddddddddd Posted 1 year ago 1 year
on Joseph Ember & False Mystics - Indigo i am seriously inside of this track right now Posted 1 year ago 1 year
on Joseph Ember & False Mystics - Indigo
mad vibes flowing over here Posted 1 year ago 1 year
on face value c: Posted 1 year ago 1 year
on want to see you
good stuff fam Posted 1 year ago 1 year on warm winds : sza cover
goosebumps Posted 1 year ago 1 year on warm winds : sza cover
oh my Posted 1 year ago 1 year
on SZA hiiijack / cover
<3<3 Posted 1 year ago 1 year
on landing
blueberry sunshine Posted 1 year ago 1 year
on landing beachtime bassline Posted 1 year ago 1 year
on heart
indie as fuck Posted 1 year ago 1 year
on Phantoms {prod. PLC}
mad!! Posted 1 year ago 1 year
on I'm sorry (feat. shiloh)
my man Posted 1 year ago 1 year
on Anxiety
@mynameisconrad: don't you forget it bub Posted 1 year ago 1 year on Premiere: Cosmo's Midnight ft Kucka 'Walk With Me' (Skylar Spence Remix)
flying! Posted 1 year ago 1 year
on 22 i am lit Posted 1 year ago 1 year
on under the wire
bass is str8 swipin Posted 1 year ago 1 year
on gulbran
can anyone say funk?? Posted 1 year ago 1 year
on falcxne - FWB
outrageous guitar Posted 1 year ago 1 year
on falcxne - FWB
falcxne!! Posted 1 year ago 1 year
on falcxne - FWB
jesus christ man. cool it!! Posted 1 year ago 1 year on WondaGurl, Rich Kidd, Chef Byer, J Reid, Nick Nikon, Superville, 2oolman, DZL & C-Sharp - 416 4 1 6 Posted 1 year ago 1 year on WondaGurl, Rich Kidd, Chef Byer, J Reid, Nick Nikon, Superville, 2oolman, DZL & C-Sharp - 416
nuts Posted 1 year ago 1 year
on WETLANDS
sweet mercy Posted 1 year ago 1 year
on woke up twice today
how nice Posted 1 year ago 1 year
on woke up twice today
wow Posted 1 year ago 1 year
on awkward.
wicked synth Posted 1 year ago 1 year
on FullyAutomaticDrayco // No Fuck Shit $ (Prod. by 1Mind) damn slugga Posted 1 year ago 1 year
on DUST
righteous Posted 1 year ago 1 year
on miles to go.
mastermind Posted 1 year ago 1 year on Chubby Putty ft. Beats Antique (griff Remix)
cool as hell Posted 1 year ago 1 year on Chubby Putty ft. Beats Antique (griff Remix)
whoa! very unique Posted 1 year ago 1 year
on stream of consciousness
hell yeah fuck it Posted 1 year ago 1 year
on stream of consciousness
cool beat. mad flow Posted 1 year ago 1 year
on Opera - Ctrl + Shift + N (CHROME REMIX)
nice!! Posted 1 year ago 1 year
on I will hate you with love and love you with hate..
music for the gods Posted 1 year ago 1 year
on Daniel Wall - Timeless Control [FREE DOWNLOAD]
very cooll Posted 1 year ago 1 year
on Daniel Wall - Timeless Control [FREE DOWNLOAD] creepy atmosphere. makes me want to play some kind of post-apocalyptic future game Posted 1 year ago 1 year
on Daniel Wall - Arpin Bird.
omg Posted 1 year ago 1 year
on Daniel Wall - Arpin Bird.
sick! Posted 1 year ago 1 year on Put Shit On The Map ft. Boogie [Prod. By Tony Bodega & Boogie]
daaaaamn haha Posted 1 year ago 1 year on Put Shit On The Map ft. Boogie [Prod. By Tony Bodega & Boogie]
these chords!!! Posted 1 year ago 1 year
on JAMBI (pt. I) ft. Tony Bodega (prod. by stripes iii)
heavyy Posted 1 year ago 1 year
on 508Prelude [VIDEO IN DESCRIPTION]
this is tight. like playing ssx on dmt Posted 1 year ago 1 year
on Cheddar Bring (Prod. By Dumdrumz)
and awesome beat Posted 1 year ago 1 year
on Cheddar Bring (Prod. By Dumdrumz)
sick Posted 1 year ago 1 year
on 10 DEEP Feat. A.Tibbz
this is tight~ Posted 1 year ago 1 year
on Plan A
hell yeah boy Posted 1 year ago 1 year on Maurice Moore ~ Christmas Eve.
sick Posted 1 year ago 1 year on Maurice Moore ~ Christmas Eve.
whoaaa Posted 1 year ago 1 year
on Cant Help
good stuff dude Posted 1 year ago 1 year
on Flojo Vol.4
mad intense groove Posted 1 year ago 1 year on Old Day
can't breathe Posted 1 year ago 1 year
on Old Day
hnnnnnnnnng Posted 1 year ago 1 year on Comme ci Comme ça feat. Sasha Jelten
love Posted 1 year ago 1 year on Comme ci Comme ça feat. Sasha Jelten
friendship Posted 1 year ago 1 year on Comme ci Comme ça feat. Sasha Jelten
completeness Posted 1 year ago 1 year on Comme ci Comme ça feat. Sasha Jelten
togetherness Posted 1 year ago 1 year on Comme ci Comme ça feat. Sasha Jelten
stress-free Posted 1 year ago 1 year on Comme ci Comme ça feat. Sasha Jelten
bliss Posted 1 year ago 1 year on Comme ci Comme ça feat. Sasha Jelten
happiness Posted 1 year ago 1 year
on Ache
yes that's right, such much Posted 1 year ago 1 year
on Ache
such much emotion in these keys Posted 1 year ago 1 year
on Waking Up Together
i cant Posted 1 year ago 1 year on Waking Up Together
oh god. i'm going to have a heart attack Posted 1 year ago 1 year
on Soft Spirit
thank you eastghost Posted 1 year ago 1 year
on Palace (ft. Theo Hoarau)
sick Posted 1 year ago 1 year
on Lmly
really chill Posted 1 year ago 1 year
on Of Late
good stuff Posted 1 year ago 1 year
on Shut It Down [ben maxwell edit]
damn ben Posted 1 year ago 1 year on Jan Level - I Believe (videoclip in description) screaming across the sky en Posted 1 year ago 1 year
on San Holo - Can't Forget You (ft. The Nicholas)
my oh my Posted 1 year ago 1 year
on freak no mas
: ) Posted 1 year ago 1 year on 19. Madijuwon - 1994 (back in a day w/ Mariah)
serenity Posted 1 year ago 1 year
on Download: Impey - Squarewave Shuffle
got it down pat Posted 1 year ago 1 year
on Download: Impey - Squarewave Shuffle
son of a bitch Posted 1 year ago 1 year
on Download: Impey - Squarewave Shuffle okay i'm on board Posted 1 year ago 1 year on Capture x Gonzo Lechat - Rules
sweet Posted 1 year ago 1 year
on Amazonia
intergalactic forest Posted 1 year ago 1 year
on wensel
s e x Posted 1 year ago 1 year
on ANGER
good god Posted 1 year ago 1 year
on ANGER
this is evil fam Posted 1 year ago 1 year
on ANGER
ntrapnr Posted 1 year ago 1 year on PVRIS - St. Patrick (Lurk x Wavvegawd Flip)
nice Posted 1 year ago 1 year
on JUST ANOTHER DAY [ fla }
light it up Posted 1 year ago 1 year
on Play
seriously enjoying this Posted 1 year ago 1 year
on Bubbymane X Hellion- Murder
straight homocide Posted 1 year ago 1 year
on Jonny Ha$h - Blueberry
!! Posted 1 year ago 1 year
on Jonny Ha$h - Blueberry
i wanna eat this bc its so tasty Posted 1 year ago 1 year
on Cashmere Cat/Hud Mo - Forever 1 (Azura Edit)
another one Posted 1 year ago 1 year
on Cashmere Cat/Hud Mo - Forever 1 (Azura Edit)
strong Posted 1 year ago 1 year
on Foals - London Thunder [Lakechild Edit]
i feel nostalgiac Posted 1 year ago 1 year on Devilish Kontra ~ F.T.N (ft. Tee FLii x Ty Dolla $ign) (prod. by DJ Mustard)
looord Posted 1 year ago 1 year
on Outlit - Trypto'd
@ethan-17: yep Posted 1 year ago 1 year
on Outlit - Trypto'd
wicked Posted 1 year ago 1 year
on blue
chill as fuck bruh Posted 1 year ago 1 year
on VBND - Where Did Your Love Go
nowhere bb its right here Posted 1 year ago 1 year on Dont Kall My Name w/Smino || prod. by THEMPEOPLE
damn this is madd Posted 1 year ago 1 year
on Stay/stars crossed (produced by @DonnieTrumpet)
so soft Posted 1 year ago 1 year
on Stay/stars crossed (produced by @DonnieTrumpet)
magical Posted 1 year ago 1 year
on Want Some (feat. DJ Chose)
chill fam Posted 1 year ago 1 year on Want Some (feat. DJ Chose)
akon got a sc now????? Posted 1 year ago 1 year
on Levitate
that was perfect Posted 1 year ago 1 year
on gina w/ jay2
god damn y'all. this is h o t Posted 1 year ago 1 year
on gina w/ jay2
turnt!! Posted 1 year ago 1 year
ێon ၚ
sick Posted 1 year ago 1 year
ێon ၚ this that kind of track you hear in a cinematic parkour video Posted 1 year ago 1 year ێon ၚ
deadly Posted 1 year ago 1 year
on ozzy ~ TheMan
trillin Posted 1 year ago 1 year on RNDYSVGE - Igotwtuneed
@rndysvge: ♡♡♡ Posted 1 year ago 1 year
on Kno It
givn me a spankn Posted 1 year ago 1 year
on help u...
wonderfully done Posted 1 year ago 1 year
on Shine
sparkling tune Posted 1 year ago 1 year on Front Load
strong Posted 1 year ago 1 year
on Choppa Dunks X Dapp - Let's Go Now
dunk Posted 1 year ago 1 year
on the deep
<3<3 Posted 1 year ago 1 year
on lux.impala - Wrist
help im dying Posted 1 year ago 1 year on not finished, with METHONE (FREE DOWNLOAD)
raw as fuck Posted 1 year ago 1 year on not finished, with METHONE (FREE DOWNLOAD)
i am way about this Posted 1 year ago 1 year on Swim
supersolid Posted 1 year ago 1 year
on Swim
!!!! Posted 1 year ago 1 year
on Swim
having a ton of fun dancing to this Posted 1 year ago 1 year
on Swim
whoooaaaaaa Posted 1 year ago 1 year
on Swim you know exactly how to hook me fam Posted 1 year ago 1 year
on Swim
fuckk this ill Posted 1 year ago 1 year
on dojo. - Wishes strongg Posted 1 year ago 1 year
on dojo. - Wishes
luv u boo Posted 1 year ago 1 year on Document One - Run The Block [Friction Fire BBC Radio 1]
hell ye Posted 1 year ago 1 year on Document One - Run The Block [Friction Fire BBC Radio 1]
blazing trails Posted 1 year ago 1 year on Document One - Run The Block [Friction Fire BBC Radio 1]
it's bit a bit since i've heard any document one Posted 1 year ago 1 year on Document One - Run The Block [Friction Fire BBC Radio 1]
i do love it Posted 1 year ago 1 year
on fishing for gawd [mactopus x brother mynor] <3<3 Posted 1 year ago 1 year
on fishing for gawd [mactopus x brother mynor]
u guys got this on lock Posted 1 year ago 1 year
on work
heat heat heat!! Posted 1 year ago 1 year
on work
supreme switch Posted 1 year ago 1 year
on oysters
another ~pearl of a track. ayy Posted 1 year ago 1 year on Sylvan LaCue ft. Linzi Jai - Caravan 04 [Prod.by Fortune]
sick Posted 1 year ago 1 year
on Alizzz - Your Love (Hoodboi Remix)
:' ) Posted 1 year ago 1 year on NGHTMRE & Boombox Cartel - Aftershock (Yung Death Ray Remix)
licc Posted 1 year ago 1 year
on Sivey - Slow Wave
i love it Posted 1 year ago 1 year
on Sivey - Church Eye
soulection is basically the type of music that appeal to everyone Posted 1 year ago 1 year
on O.rka || Singularity
<$ <% <^ <& Posted 1 year ago 1 year
on O.rka || Singularity
<3<# Posted 1 year ago 1 year
on O.rka || Singularity
gg those claps k.o.ed me Posted 1 year ago 1 year
on O.rka || Singularity
bwooooooom Posted 1 year ago 1 year
on O.rka || Singularity
drums are too on point Posted 1 year ago 1 year
on O.rka || Singularity
deep sounds Posted 1 year ago 1 year on All Good (LeMarquis & Marlin Remix)
super Posted 1 year ago 1 year on All Good (LeMarquis & Marlin Remix)
ooh this is groovy Posted 1 year ago 1 year on All Good (LeMarquis & Marlin Remix)
sweet as pie Posted 1 year ago 1 year on manic with cute melancholic
goodness Posted 1 year ago 1 year on manic with cute melancholic
these chops are sinister Posted 1 year ago 1 year on manic with cute melancholic
deadly Posted 1 year ago 1 year
on Candy Land (Prod. Sivey)
loving this! Posted 1 year ago 1 year
on Candy Land (Prod. Sivey)
nice and smooth Posted 1 year ago 1 year
on Candy Land (Prod. Sivey)
oh hell yes Posted 1 year ago 1 year on California (ft. Ehiorobo & Alo Lee)
aw snap Posted 1 year ago 1 year
on Snakey J
killin Posted 1 year ago 1 year
on XYLØ - Afterlife (Ark Patrol Remix)
gorgeous Posted 1 year ago 1 year
on Zephyr & Kimani - Love The Way
!!!! Posted 1 year ago 1 year
on Zephyr & Kimani - Love The Way
sing it Posted 1 year ago 1 year on Christmas Time Is Here (prod. kev)
nothing but love Posted 1 year ago 1 year on please, let it snow (w/ natey subi & kev)
:^) Posted 1 year ago 1 year on please, let it snow (w/ natey subi & kev)
these snaps Posted 1 year ago 1 year on please, let it snow (w/ natey subi & kev)
<3<3<3 Posted 1 year ago 1 year
on Keota - Kahlua in My Cereal
damn son Posted 1 year ago 1 year
on CAESAR - MEMÉS
dead Posted 1 year ago 1 year
on CAESAR - MEMÉS
i like what you've done here Posted 1 year ago 1 year on RNDYSVGE - Igotwtuneed i'm just kinda speechless at this point. you made my best artists of 2015 list Posted 1 year ago 1 year
on Reading Soundcloud Comments: Instupendo
this is fucking perfect Posted 1 year ago 1 year
on Reading Soundcloud Comments: Instupendo
hhaha with like a tear and an o for lips. i'm dying Posted 1 year ago 1 year
on Reading Soundcloud Comments: Instupendo
ayyyyy the first one is my comment Posted 1 year ago 1 year
on JNTHN STEIN Berlin III
spinning Posted 1 year ago 1 year
on Spire - Petal Falls
done right Posted 1 year ago 1 year on Arman Cekin ft. BR/\VE - Hold On (Staygo Flip)
nicely done Posted 1 year ago 1 year
on 813 x R3LL - Night Jazz
sex melodies and sick kicks Posted 1 year ago 1 year
on Idk
i am in this damn synth Posted 1 year ago 1 year
on w∆vy
smooth Posted 1 year ago 1 year
on odyssey
im relaxed af Posted 1 year ago 1 year
on odyssey
enjoying your shit man. Posted 1 year ago 1 year
on home i would eat this for every meal Posted 1 year ago 1 year
on i need u (thanks for 10k plays!!)
good lord this is so beautiful Posted 1 year ago 1 year
on tom
@superb-lyres: yesss, it's v dope Posted 1 year ago 1 year on Coming Of Age | Prod. Harris Cole *** SHORT FILM IN DESC so many great things have come from this harris track Posted 1 year ago 1 year
on GRIMEY BOI - Big Boy Tings (Prod by. @MeatyJohnson)
wilin Posted 1 year ago 1 year
on Jigglypuff
aye fam i am hot on this Posted 1 year ago 1 year
on Jigglypuff boy i am fucking dipping over here Posted 1 year ago 1 year
on Jigglypuff
dunk Posted 1 year ago 1 year
on Jigglypuff
slam Posted 1 year ago 1 year on The Iambic Cleaning Song {prod. Soulstruck & Breeze}
: ) Posted 1 year ago 1 year on The Iambic Cleaning Song {prod. Soulstruck & Breeze}
this is what i'm lookin for Posted 1 year ago 1 year
on Helena's Skin
50 mf gs Posted 1 year ago 1 year
on Blue Boss prod. Godriguez
this is so fucking hot Posted 1 year ago 1 year
on Blue Boss prod. Godriguez
royal bassline Posted 1 year ago 1 year
on Blue Boss prod. Godriguez
god damn!! what's going on here!! Posted 1 year ago 1 year
on J.Robb - Down
my heart skips a beat when jrobb come on Posted 1 year ago 1 year
on breakyouofff w/ j.robb
outstanding Posted 1 year ago 1 year
on breakyouofff w/ j.robb is there another mine i don't know about? ay Posted 1 year ago 1 year
on breakyouofff w/ j.robb
where did you capture this essence??? Posted 1 year ago 1 year
on Been About You
sick break Posted 1 year ago 1 year
on Been About You
bouncin' Posted 1 year ago 1 year
on phobia
<3 u man Posted 1 year ago 1 year
on IRIDATA
sweet Posted 1 year ago 1 year on still feat. sumthin sumthin
that vocal ;DDDD Posted 1 year ago 1 year
on Cool Song
!!!!! Posted 1 year ago 1 year on Nas - Nas Is Like (Just Fuzz Remix)
@hoodooofficial: preciate it! Posted 1 year ago 1 year
on Doja Cat - So High (StéLouse Flip) i used to say 'stay-loo-ease' before, and for a short bit of time after i realized it was just 'stay loose' Posted 1 year ago 1 year
on missing
lit Posted 1 year ago 1 year
on follow me down the rabbithole w/apart (2013)
dank Posted 1 year ago 1 year
on goodbye
always a pleasure Posted 1 year ago 1 year
on tabla
bass got me feelin funny Posted 1 year ago 1 year on good old days
beautiful Posted 1 year ago 1 year
on good old days
super playful!! Posted 1 year ago 1 year on TRAVIS SCOTT - ANTIDOTE (LUCA LUSH REMIX)
whaaaaa Posted 1 year ago 1 year on Feelings of sentimentality due to getting curved
you sure know how to vibe bruh Posted 1 year ago 1 year
on Dirty Chocolate - Flutter
@theofficialdjinn: tasty tasty Posted 1 year ago 1 year
on Dirty Chocolate - Flutter
@inter-vene: +10 u mean Posted 1 year ago 1 year on Dirty Chocolate - Flutter
holy fuck. i wish i heard this yesterday Posted 1 year ago 1 year
on //\\ERGE
spectacular Posted 1 year ago 1 year
on Wolff Parkinson.
u r just beyond belief Posted 1 year ago 1 year
on deadxbeat - dreamin'2 every time the sub hits another note my personality switches Posted 1 year ago 1 year
on lemme feel real
: ) Posted 1 year ago 1 year
on lemme feel real
great shit Posted 1 year ago 1 year on lemme feel real
this percussion is like paint chips Posted 1 year ago 1 year
on UWM (Feat. Leland Whitty)
lordy Posted 1 year ago 1 year
on UWM (Feat. Leland Whitty)
incredible track Posted 1 year ago 1 year
on WEPKEY
trill Posted 1 year ago 1 year
on Tears In The Rain
<3<3 Posted 1 year ago 1 year on Aloe Yoroi - Gucci Vera (feat. Eric North)
oh snap Posted 1 year ago 1 year on Aloe Yoroi - Gucci Vera (feat. Eric North)
my boy eric Posted 1 year ago 1 year on 10 Tsuki 1-nichi (Masuku Klan Anthem)
rip oylo died from aloe Posted 1 year ago 1 year
on Always Something. . .
slick Posted 1 year ago 1 year
on flower without a scent
;') Posted 1 year ago 1 year
on Sivey - Ascension
catch my drift Posted 1 year ago 1 year
on Sivey - Ascension
straight spice rack Posted 1 year ago 1 year
on Brawl (Open Cypher Contest Entry) god damn Posted 1 year ago 1 year
on woosta // Frothed Milk those hollow hits drive me bonkers Posted 1 year ago 1 year
on woosta // Frothed Milk
really enjoying your stuff woosta Posted 1 year ago 1 year
on Fine
<3<3<3<3<3<3 Posted 1 year ago 1 year
on Fine
oh my how lovely Posted 1 year ago 1 year
on Fine
keys 2 lit!!!! Posted 1 year ago 1 year
on Soul dumb good 808 birdies yeeeee Posted 1 year ago 1 year
on Soul
duper dope Posted 1 year ago 1 year
on Soul
break it apart leggoooo Posted 1 year ago 1 year
on Soul daaaaamn these chords are milky Posted 1 year ago 1 year
on Purpose
whoaaa. very cool Posted 1 year ago 1 year
on Flirt
happy friday Posted 1 year ago 1 year
on Flirt
y'all don't even know Posted 1 year ago 1 year
on Flirt
is what i am listening to real? Posted 1 year ago 1 year
on Flirt
this is real? Posted 1 year ago 1 year
on Flirt
pfffftt Posted 1 year ago 1 year
on Flirt
marry me kev Posted 1 year ago 1 year on Ryan Hemsworth & Lucas - U Remain
: ) Posted 1 year ago 1 year
on Sloan's Dress
dark Posted 1 year ago 1 year
on what is the next level?
wow dude Posted 1 year ago 1 year
on what is the next level?
god damn it Posted 1 year ago 1 year
on what is the next level?
i have never heard anything liek this Posted 1 year ago 1 year
on what is the next level?
like what the fuck is this fucking shit right here Posted 1 year ago 1 year
on what is the next level? who even fucking knows anymore. you all are just pushing/ bending/warping/obliterating the boundaries Posted 1 year ago 1 year
on val - Shapeshifter
ill!! Posted 1 year ago 1 year
on val - Shapeshifter
quite enjoyable Posted 1 year ago 1 year
on val - Shapeshifter
very elegant Posted 1 year ago 1 year
on val - Shapeshifter
nicely done Posted 1 year ago 1 year
on Robots Have A Voice
neat beat Posted 1 year ago 1 year on Tongue (Ochre on vinyl now available!)
cool Posted 1 year ago 1 year
on fluxxy - dab wench
yooooo Posted 1 year ago 1 year on thoughts of you
this one is tasty Posted 1 year ago 1 year
on DISORIENTED
well it worked Posted 1 year ago 1 year
on 3Hunnit
whoa Posted 1 year ago 1 year
on Ben Boomin
ultra trill Posted 1 year ago 1 year on VAGUE001 - Dark Waters
soo fucking demonic Posted 1 year ago 1 year on VAGUE001 - Dark Waters this is from another world Posted 1 year ago 1 year on poetic justice
good god. this is so fucking thick Posted 1 year ago 1 year on Midnight Club - No One Understands
incredible Posted 1 year ago 1 year on Midnight Club - No One Understands
no one understands Posted 1 year ago 1 year
on Emotional Heat
whoa dude. stunning Posted 1 year ago 1 year
on forever
lonemizzle Posted 1 year ago 1 year
on forever
what the shit!! yooooo Posted 1 year ago 1 year on Mandeh - Often
super chill Posted 1 year ago 1 year on Lil West - After Me [prod. EMW & RyanJacob]
lit it up Posted 1 year ago 1 year
on Ryan Hemsworth & Lucas - Long Time
nice one guys!! perfect ending Posted 1 year ago 1 year
on Sailors - Crazy About You
ill track Posted 1 year ago 1 year
on Comeback of the Century [Prod. Jgramm]
this beat is unreal Posted 1 year ago 1 year
on Comeback of the Century [Prod. Jgramm]
fucking light this shit uppp Posted 1 year ago 1 year
on U beautiful piece of work my friend Posted 1 year ago 1 year
on U
@spireproject: hahahah Posted 1 year ago 1 year
on U
so much work went into this Posted 1 year ago 1 year
on U
yup Posted 1 year ago 1 year
on U
very very v e r y cool Posted 1 year ago 1 year
on StéLouse - Couch Surf
couch hangliding Posted 1 year ago 1 year
on KVN - Unknown kvn constantly pulls through Posted 1 year ago 1 year
on ghetto birds
thank you for adding to my night Posted 1 year ago 1 year
on Elevation - Agressive Macintosh On The Loose
dank Posted 1 year ago 1 year
on HOME
lit Posted 1 year ago 1 year
on 4 U
@stelouse: damn... it's been a while since anyone has mentioned afi Posted 1 year ago 1 year
on Kan-G - The Last of Us
doin it Posted 1 year ago 1 year on KRNE x Stooki Sound - Medicine [Thissongissick.com Premiere] [Free Download] keep that krne on blast. glad to see this collab. stooki has been slaying for a good minute Posted 1 year ago 1 year
on Noer The Boy - In Flux
oh my Posted 1 year ago 1 year
on 4. // Concepts
goodie goodie Posted 1 year ago 1 year
on Stuck Between [Prod. Kaido & Eevee] *video in description*
incredibly chilly in here isn't it? Posted 1 year ago 1 year
on Stay Around
in there Posted 1 year ago 1 year
on babe
nice Posted 1 year ago 1 year
on In So Far As Noah (W/ Joe Petersen) insanity Posted 1 year ago 1 year
on EARTHGANG - Missed Calls (DrewsThatDude Remix)
mad Posted 1 year ago 1 year
on EARTHGANG - Missed Calls (DrewsThatDude Remix)
daaaaaamn Posted 1 year ago 1 year
on EARTHGANG - Missed Calls (DrewsThatDude Remix)
everything is so clean Posted 1 year ago 1 year
on Sonder
done Posted 1 year ago 1 year
on four in the morning
4adamn Posted 1 year ago 1 year on I'm so sorry, I'm not used to be alone, but I can wait for you all my life good god Posted 1 year ago 1 year
on Des McMahon - A Darker Shade
lit Posted 1 year ago 1 year
on Chet Porter - Awakening
that whooping wind effect kills me Posted 1 year ago 1 year
on 4 U
@stelouse: as long as your transitions are gooch (which they are) nobody is even going to notice Posted 1 year ago 1 year
on 4 U
!!!! cant type tooo ecxict Posted 1 year ago 1 year
on 4 U
mmmm tasty pan <# Posted 1 year ago 1 year
on 4 U these arps are from another planet i sweat Posted 1 year ago 1 year
on 4 U super chill as always. dope snare too my boy Posted 1 year ago 1 year on REVERB BROTHER (SATURATE RECORDS VOL 5)
jesus christ Posted 1 year ago 1 year
on catacombs. w/ manitee
creepy shit man. love it Posted 1 year ago 1 year
on c a t b o n g
wicked!! Posted 1 year ago 1 year
on c a t b o n g
ummmmm Posted 1 year ago 1 year
on c a t b o n g ....cat.....bong? Posted 1 year ago 1 year on American Ride (Colab Leif Ka/A Wood)
<3<3 Posted 1 year ago 1 year
on boy, don't play
beautiful Posted 1 year ago 1 year
on B00N - No Real Direction
sound design on point Posted 1 year ago 1 year
on B00N - No Real Direction
insane! Posted 1 year ago 1 year
on sinuous feat. tibe
not sure why i haven't heard this Posted 1 year ago 1 year
on sinuous feat. tibe
mad wicked guys Posted 1 year ago 1 year
on rainbow road
@oylo: smack! Posted 1 year ago 1 year
on rainbow road
@dwaimusic: 100% this Posted 1 year ago 1 year
on GHOULS i will have you know that i am spooked shitless Posted 1 year ago 1 year
on Would you wander with me? w/ doin
love Posted 1 year ago 1 year
on Would you wander with me? w/ doin
anywhere you wanna go Posted 1 year ago 1 year
on -ToBy- | La Vie (prod. Nuri)
lit Posted 1 year ago 1 year
on -ToBy- | La Vie (prod. Nuri) is it only tuesday. bc this track is straight sunday Posted 1 year ago 1 year
on Manifold (snippet)
nigga u wacko Posted 1 year ago 1 year
on Devin Miles ~ My table (Oy bootleg remix)
i Posted 1 year ago 1 year
on Devin Miles ~ My table (Oy bootleg remix)
this melody inst is dopee Posted 1 year ago 1 year
on Devin Miles ~ My table (Oy bootleg remix)
quick moving percs. damn Posted 1 year ago 1 year
on iknwitsalittlelate // JAIRE x SOULE
nice vibrations man Posted 1 year ago 1 year on DumDeeDum// Keys n Krates [BassBoosted BassBoost]
slick rapin Posted 1 year ago 1 year on JordanBelfort// Wes Walker (wolimmammoth dirty bass boost)
whuuuuuuw Posted 1 year ago 1 year
on MIDI Swoon
lovely work! Posted 1 year ago 1 year
on Sanguine
lovely Posted 1 year ago 1 year
on nothing to write home about mane (read description)
good work Posted 1 year ago 1 year
on Elevation - Splattered Concrete (Feat. ♥GOJII♥)
gg life Posted 1 year ago 1 year on Elevation - Splattered Concrete (Feat. ♥GOJII♥)
love you man Posted 1 year ago 1 year
on Interlude 2
w h o a r e y o u Posted 1 year ago 1 year
on Interlude 2
°(ಗдಗ̶)°. Posted 1 year ago 1 year
on Interlude 2
i wish i could rap Posted 1 year ago 1 year
on Interlude 2
i have an intense urge to rap right now Posted 1 year ago 1 year
on French Kiss (Original Mix)
entrancing Posted 1 year ago 1 year on ˾˼ s o f t l y ⟡ g r a n t e d ˻˽⟐ [ yaeji ✖ n t o ~ ] ⟐
oh my goodness gracious Posted 1 year ago 1 year
on bones ft. domino
@vega: yo dude, thank you Posted 1 year ago 1 year
on HOCO
slick hats boi Posted 1 year ago 1 year
on Contraband
still dope Posted 1 year ago 1 year
on Contraband
thick hits. kick carries weight Posted 1 year ago 1 year
on Dragon Emperor
machine gun kicks Posted 1 year ago 1 year on linkin park - crawling (bb's ayylmao quickflip)
whoaaaa Posted 1 year ago 1 year
on Young Thug - Hercules (KXA Remix)
i am o n Posted 1 year ago 1 year
on J P O L O - On Ice
smooooth Posted 1 year ago 1 year
on Padillion - Honeytail
a million ws Posted 1 year ago 1 year
on Padillion - Honeytail
get it mf Posted 1 year ago 1 year
on into the trees
cavernous Posted 1 year ago 1 year
on Wolff Parkinson. prayer hands Posted 1 year ago 1 year on Vice City prod. mza
yuhhh Posted 1 year ago 1 year on Vice City prod. mza
do it! Posted 1 year ago 1 year
on Corals
mad Posted 1 year ago 1 year
on session w/ kolada
@yvnggxxn: lol!! Posted 1 year ago 1 year
on C Y G N - Tropical
hot hot hot Posted 1 year ago 1 year
on C Y G N - Tropical sweet mother of pearl Posted 1 year ago 1 year
on POYINZI hwoooooohh hahah love it! Posted 1 year ago 1 year
on POYINZI
no evil Posted 1 year ago 1 year
on POYINZI supreme chopping ughhh! Posted 1 year ago 1 year
on POYINZI
shitting emotions Posted 1 year ago 1 year
on POYINZI soft. snare so punctual <33 Posted 1 year ago 1 year
on POYINZI
such a beautiful tune Posted 1 year ago 1 year
on MFKNPORSCH
ahhhhhhh Posted 1 year ago 1 year
on MFKNPORSCH i am frickin stunned. what is going it Posted 1 year ago 1 year
on nessly - why pretend (prod nessly)
incredible track Posted 1 year ago 1 year
on nessly - why pretend (prod nessly)
chill homie Posted 1 year ago 1 year
on Jives - Pardalote
nicely done! Posted 1 year ago 1 year
on Jives - Pardalote
!!!!!!!!!!!!!!!!!!!!!!!!!! Posted 1 year ago 1 year
on Jives - Pardalote this is super cool... oh my shit Posted 1 year ago 1 year
on Jives - Pardalote
oh so we bangin then Posted 1 year ago 1 year
on despite our faults, we stay
emotional Posted 1 year ago 1 year
on Hollow
chilll! Posted 1 year ago 1 year
on Hollow
sick! Posted 1 year ago 1 year
on Hollow
fresh! Posted 1 year ago 1 year on Hollow
cute! Posted 1 year ago 1 year
on gold coast
@iamairwav: :* Posted 1 year ago 1 year
on mus.hiba - heya
<3<3 Posted 1 year ago 1 year
on "hitoe" trailer (new EP)
ughhhhh Posted 1 year ago 1 year
on "hitoe" trailer (new EP) why don't i follow you?? you guys been hiding him or?? Posted 1 year ago 1 year
on Darkness
flawless synths Posted 1 year ago 1 year on Darkness i am just blown away by this Posted 1 year ago 1 year
on Darkness
wow Posted 1 year ago 1 year
on Darkness
teach me your ways Posted 1 year ago 1 year
on Darkness
master Posted 1 year ago 1 year
on Saturday Night Fever
killer flamingo...sis Posted 1 year ago 1 year
on saywhat
this is unreal Posted 1 year ago 1 year on saywhat j.robb you create such mysterious and intense masterpieces. like even all the shit on your demo account just drives like no other. you've got some serious talent my friend Posted 1 year ago 1 year
on mndsgn - camel blues (The Kount X MiddleEast bootleg)
wheeewwww Posted 1 year ago 1 year
on mndsgn - camel blues (The Kount X MiddleEast bootleg)
goodness gracious Posted 1 year ago 1 year
on mndsgn - camel blues (The Kount X MiddleEast bootleg)
whoaaa what the fuck is this Posted 1 year ago 1 year
on gold coast
make room bitches Posted 1 year ago 1 year
on gold coast
airwav coming through Posted 1 year ago 1 year on dont fret
C: Posted 1 year ago 1 year
on dont fret damn boy u just a beam of sunshine aint u Posted 1 year ago 1 year
on save me
lol stealthy Posted 1 year ago 1 year
on save me
very steathly Posted 1 year ago 1 year
on In Bloom
spooked Posted 1 year ago 1 year
on In Bloom
got damn Posted 1 year ago 1 year on In Bloom
get hard you guys time to jerk Posted 1 year ago 1 year on Major Lazer - Be Together (feat. Wild Belle) (Far & Few Remix)
raw Posted 1 year ago 1 year
on 2: Kiiara - Gold (Masego & TrapHouseJazz Band Remix)
yuuuuuuuuhhh Posted 1 year ago 1 year
on 2: Kiiara - Gold (Masego & TrapHouseJazz Band Remix)
ultra smooth groovin' Posted 1 year ago 1 year
on signature
killer drums Posted 1 year ago 1 year
on signature
very relaxing Posted 1 year ago 1 year
on body on a wire deeeeeeeep in there Posted 1 year ago 1 year on we can split these nachos, I probably can't finish them by myself anyways, idk
mark Posted 1 year ago 1 year
on from tha neck up
rich Posted 1 year ago 1 year
on from tha neck up
keep it up homie. you are great Posted 1 year ago 1 year
on Klouds Ep ft. son & Soulstruck [Click 'Buy' to DL]
oh man this my shit Posted 1 year ago 1 year
on drop it like its icy . . . ❤ [free download]
good stuff Posted 1 year ago 1 year
on out of reach w/ andrew 10/10 Posted 1 year ago 1 year
on out of reach w/ andrew
delicate Posted 1 year ago 1 year
on out of reach w/ andrew yall got these chord progs down af Posted 1 year ago 1 year
on Rush Feat. Abjo
str8 pyramids Posted 1 year ago 1 year
on Rush Feat. Abjo
scorching hot Posted 1 year ago 1 year
on love lost (prod. vik)
real Posted 1 year ago 1 year
on Lost [FREE DL] inspoo son. where am i Posted 1 year ago 1 year
on Tyler Davis - Adjusted
i hear you man. real talk Posted 1 year ago 1 year on accidentally saved over this project before I was done lol
live Posted 1 year ago 1 year on accidentally saved over this project before I was done lol
werk bitch! Posted 1 year ago 1 year
on daze feat. jb
sweet as pie Posted 1 year ago 1 year
on Ո湂
heavenly Posted 1 year ago 1 year
on Mumbla - Sorry Ain't Cuttin It
smackk!! Posted 1 year ago 1 year
on Mumbla - Sorry Ain't Cuttin It
this is a super cool thing Posted 1 year ago 1 year
on Attracted
<3<3 Posted 1 year ago 1 year
on Attracted
@devisionary: but will i tho? Posted 1 year ago 1 year on BiTCH I'M FUCKING GORGEOUS (PROD. BRAVESTARR)
soapy Posted 1 year ago 1 year on BiTCH I'M FUCKING GORGEOUS (PROD. BRAVESTARR)
holla Posted 1 year ago 1 year
on Jetson - Melancholy [prod. woodzsthlm]
hot damn this tracc Posted 1 year ago 1 year on Jetson - Melancholy [prod. woodzsthlm]
yes! tell em Posted 1 year ago 1 year
on 123Mrk - Untroubled [S&C007]
wonderful Posted 1 year ago 1 year
on Ouska - Pyramid
fuck son Posted 1 year ago 1 year
on Velour
gather your strength Posted 1 year ago 1 year
on Velour
rest Posted 1 year ago 1 year
on Velour
is that a bicycle Posted 1 year ago 1 year on ILLIMILI FEAT BEMMY BEMMY
this is my shit dude Posted 1 year ago 1 year
on ILLIMILI FEAT BEMMY BEMMY
̓T__T̈́ Posted 1 year ago 1 year
on ILLIMILI FEAT BEMMY BEMMY
crazy mf Posted 1 year ago 1 year
on ILLIMILI FEAT BEMMY BEMMY
smoking percs!!!! damnnnn Posted 1 year ago 1 year on Kaytranada - Ive Got Your (ouska redo)
damn son where'd you find this Posted 1 year ago 1 year on Kaytranada - Ive Got Your (ouska redo)
i am s o a r i n g Posted 1 year ago 1 year on Kaytranada - Ive Got Your (ouska redo) take note everybody. ouska's got that special kind of groove Posted 1 year ago 1 year
on a night in seoul
my body ﾟஇ‸இﾟ Posted 1 year ago 1 year
on odium
lordd Posted 1 year ago 1 year
on odium
some voodoo ass shit Posted 1 year ago 1 year
on odium
sacrificial Posted 1 year ago 1 year
on Singes
exotic af Posted 1 year ago 1 year on Singes
these vox are so outlandsih Posted 1 year ago 1 year
on Singes
fuck this hitss Posted 1 year ago 1 year
on Bird
@ouska: grats on 4k bruh~~ Posted 1 year ago 1 year
on sherbet shades (music video in description)
@superb-lyres: hahah, of course! it's true!! Posted 1 year ago 1 year
on something cute 4 u (from sign offline & MISOGI)
this is what i'm talking about Posted 1 year ago 1 year
on Time
@glass-arrowhead-music: looking forward man! Posted 1 year ago 1 year on 1moredrink bassline hooked me all the way thru Posted 1 year ago 1 year
on 1moredrink
very interesting Posted 1 year ago 1 year
on swtrwthr - Beach Cities
:D Posted 1 year ago 1 year
on swtrwthr - Beach Cities
always a pleasure Posted 1 year ago 1 year
on Hold You (Unfinished)
i dig Posted 1 year ago 1 year
on Hold You (Unfinished)
slick rollin Posted 1 year ago 1 year
on Breeze can anyone say ~d a ~ n k ~ ? Posted 1 year ago 1 year
on Time
god damn Posted 1 year ago 1 year
on See You Space Cowboy...
mad relaxed Posted 1 year ago 1 year on GLASS ARROWHEAD - INNERCOSMOS [ FREE DOWNLOAD ]
fantastic Posted 1 year ago 1 year on GLASS ARROWHEAD - INNERCOSMOS [ FREE DOWNLOAD ]
superstar level galaxies son Posted 1 year ago 1 year
on puddle jumping
i should just go to bed. u fucked me up Posted 1 year ago 1 year
on ate bit rain :, ( Posted 1 year ago 1 year
on ate bit rain
guys it;s rlly not fair Posted 1 year ago 1 year
on tom
i just fucking love you Posted 1 year ago 1 year
on tom
the scared the fucking fuck out of me Posted 1 year ago 1 year
on Flo - Live With Me(Prod.by Superb Lyres)
i applaud you both Posted 1 year ago 1 year
on Flo - Live With Me(Prod.by Superb Lyres) this is the wildest thing i have heard all month!!!!!!!!!! oh my god1!!!!!! Posted 1 year ago 1 year
on Flo - Live With Me(Prod.by Superb Lyres) holy fucking shit!!! i want to use caps lock so badly but i've branded myself lowercase!!!!!!!!! Posted 1 year ago 1 year
on Flo - Live With Me(Prod.by Superb Lyres)
cry cry cry Posted 1 year ago 1 year
on swindail - four story home (SL flip)
b e s t Posted 1 year ago 1 year
on swindail - four story home (SL flip)
asshole Posted 1 year ago 1 year
on swindail - four story home (SL flip)
i want to make music so badly right now but i can't stop listening to you Posted 1 year ago 1 year
on swindail - four story home (SL flip)
ugh fuck. why are you so good Posted 1 year ago 1 year
on sherbet shades (music video in description) and i adored every single second of it Posted 1 year ago 1 year
on sherbet shades (music video in description) this is like sunshine and love and the beach and puppies and folgers and tube socks and green grass and bike rides and bubblegum and childhood and jolly roger's lagoon and everything kawaii rolled into one beast of a track Posted 1 year ago 1 year
on superb lyres - INTERSTELLAR
sick as frick Posted 1 year ago 1 year
on five hundred seems too little
<3<3 Posted 1 year ago 1 year
on five hundred seems too little
damn i have heard soooo many wonderful tunes tonight. thanks everyone! Posted 1 year ago 1 year
on Do Not Adjust Your Set
chilling Posted 1 year ago 1 year
on Do Not Adjust Your Set
i can't think straight Posted 1 year ago 1 year
on Do Not Adjust Your Set
so lost in this Posted 1 year ago 1 year
on Do Not Adjust Your Set these sounds have scattered me Posted 1 year ago 1 year
on Do Not Adjust Your Set
insanity!! Posted 1 year ago 1 year
on overthink
mmm mm mm mm Posted 1 year ago 1 year
on overthink
this man know how to do it Posted 1 year ago 1 year on transcendental smashing. enjoying your tracks!! Posted 1 year ago 1 year
on puddle jumping
you're basically milking my tears Posted 1 year ago 1 year
on daze feat. jb
this is huge!! Posted 1 year ago 1 year
on Nokiakoda
i like u already man Posted 1 year ago 1 year
on Nokiakoda
oh how pretty Posted 1 year ago 1 year
on sky
: ) Posted 1 year ago 1 year on Icarus Moth X Hotwagner - Chirp
incredible work you guys Posted 1 year ago 1 year
on Icarus Moth X Hotwagner - Chirp
this doesn't words Posted 1 year ago 1 year
on Icarus Moth X Hotwagner - Chirp how do i describe what i'm feeling Posted 1 year ago 1 year
on Icarus Moth X Hotwagner - Chirp
what even Posted 1 year ago 1 year
on Icarus Moth X Hotwagner - Chirp
i guess there is a heaven Posted 1 year ago 1 year
on Icarus Moth X Hotwagner - Chirp
i just died Posted 1 year ago 1 year on Icarus Moth X Hotwagner - Chirp thick kicks. sweet birdies. living percs. Posted 1 year ago 1 year
on sérénité
tight vocals Posted 1 year ago 1 year
on pyramids at sea
fuckk i forgot this was you atolla!!! Posted 1 year ago 1 year
on sérénité
u sure know how to vibe my man Posted 1 year ago 1 year
on Bird
ousktanding Posted 1 year ago 1 year
on Bird
so perfect!! Posted 1 year ago 1 year
on Bird w h a t t h e f u c k i s t h i s ! ? ! ? ! Posted 1 year ago 1 year
on Bird
excuse me what the fuck am i listening to Posted 1 year ago 1 year
on Bird
the noise is massaging me Posted 1 year ago 1 year
on Love Games
oh hellllll noooo. this can't be this goood Posted 1 year ago 1 year
on Love Games
this is revolutionary music Posted 1 year ago 1 year
on Skylines (ft. Whispa) uhguhguhguhgughhgughughughughu musco Posted 1 year ago 1 year
on lonely delicious Posted 1 year ago 1 year
on M2U - Masquerade
fancy uptown beat making Posted 1 year ago 1 year
on '97 [clip]
good looking man Posted 1 year ago 1 year on W. A. Production & Redhead Roman - Delayed Drop Plucks Tutorial + FLP, Presets & Samples
biggg Posted 1 year ago 1 year
on SnowTape Vol. 4 Feat. Moving Castle All Stars || SG15
<3 Posted 1 year ago 1 year
on Mick Jenkins - Your Love (Da-P Remix )
spectacular Posted 1 year ago 1 year
on Mick Jenkins - Your Love (Da-P Remix ) fresh one!! Posted 1 year ago 1 year
on Athabaskan [OUT NOW] you know it's good when you start freestyling Posted 1 year ago 1 year
on Signal
chords sweet as caramel Posted 1 year ago 1 year
on Signal
i am inspired by this lakey Posted 1 year ago 1 year
on Kobe
storytella Posted 1 year ago 1 year
on Nocturnal Frustrations
slap slap what Posted 1 year ago 1 year
on unfinished
some dank shit right here fam mhm Posted 1 year ago 1 year
on Now
yeeeee Posted 1 year ago 1 year
on yet another preview
sickk Posted 1 year ago 1 year
on ewonee - 12.24[lude] i'm about to follow the fuck out of you Posted 1 year ago 1 year
on ewonee - 1.10.
illustrious Posted 1 year ago 1 year
on ewonee - 8.16.
this slays Posted 1 year ago 1 year
on ewonee - 1.23[ntro]
elegant Posted 1 year ago 1 year
on Up There
frick Posted 1 year ago 1 year
on Up There
sexual Posted 1 year ago 1 year
on Up There
damn this is good fam Posted 1 year ago 1 year
on slow hours
hot dibbly diggity Posted 1 year ago 1 year
on Serenity
great track!! Posted 1 year ago 1 year on Rezonate - Rebirth (feat. Ashley Apollodor)
demons be escaping Posted 1 year ago 1 year on WHYTRAP(preview)
yee yeee Posted 1 year ago 1 year
on GOONS
this one toooo Posted 1 year ago 1 year
on GOONS
♥ that kick so much. it's perf Posted 1 year ago 1 year
on blu.moon
fresh ideas mate. keep this shit up Posted 1 year ago 1 year
on (insert japanese word)
sick Posted 1 year ago 1 year
on (insert japanese word) boom bap baboom bap boom bap baboombaboom bap Posted 1 year ago 1 year on Speedin’ Bullet 2 Heaven
bruhh Posted 1 year ago 1 year
on gawdlee & badsummer - loveit/hateit
yeee slaughter Posted 1 year ago 1 year
on gawdlee & badsummer - loveit/hateit
m a d ! Posted 1 year ago 1 year on MAJID JORDAN - MY LOVE FEAT. DRAKE (MAX90. REMIX)
amazed Posted 1 year ago 1 year on MAJID JORDAN - MY LOVE FEAT. DRAKE (MAX90. REMIX)
tink! Posted 1 year ago 1 year on MAJID JORDAN - MY LOVE FEAT. DRAKE (MAX90. REMIX)
snare is so smack. holyyy Posted 1 year ago 1 year on ultra rhymes w/lazy temple
♥♥♥ Posted 1 year ago 1 year
on ultra rhymes w/lazy temple
oh my. this is just what i needed to hear at this moment! thanks so much guys. fantastic collab!! Posted 1 year ago 1 year
on WYLN - Want You damn that one that went out of tune.... fuckkkking delicious Posted 1 year ago 1 year
on WYLN - Want You
lovey dovey as shit Posted 1 year ago 1 year
on LOST AND FOUND
go go go Posted 1 year ago 1 year
on sick የ䶲ͽ
pant shat Posted 1 year ago 1 year on sick የ䶲ͽ
ok i'm spooked Posted 1 year ago 1 year
on LORD OF ENERGY
sexy composition Posted 1 year ago 1 year on LOVE FLAGS RAISED HIGH
beauty Posted 1 year ago 1 year
on Cynthia
u 2 sinister omggg Posted 1 year ago 1 year
on Gen.A
i Posted 1 year ago 1 year
on Gen.A
a Posted 1 year ago 1 year on Gen.A
entrancing. take me away famil Posted 1 year ago 1 year
on [.hoodoo] - twig
i am dead Posted 1 year ago 1 year on Nas - Nas Is Like (Just Fuzz Remix)
dl pls?? Posted 1 year ago 1 year on Nas - Nas Is Like (Just Fuzz Remix)
<3 Posted 1 year ago 1 year on Nas - Nas Is Like (Just Fuzz Remix)
cool night time ride bounce Posted 1 year ago 1 year on Nas - Nas Is Like (Just Fuzz Remix)
this is real tight Posted 1 year ago 1 year on Woah
cool synth work fam Posted 1 year ago 1 year
on Woah
wonky af Posted 1 year ago 1 year
on Woah
very cool! Posted 1 year ago 1 year
on session w/ kolada
@officialloki: bet you have an mpk mini too huh Posted 1 year ago 1 year on Cosmic Minute: Back in Time to the First StarTalk Live!
my man Posted 1 year ago 1 year
on Urban Spaceman - Plush(Stone Temple Pilots)
i feel it! Posted 1 year ago 1 year
on Late at night loved it man Posted 1 year ago 1 year
on a theme to the last days. whereisalex - blowin up glo-in up goin up showin up bro-in up Posted 1 year ago 1 year
on fvo rta - water (wūsh rmx)
cool shit fam Posted 1 year ago 1 year
on fvo rta - water (wūsh rmx)
wtfff wtf was tahtttt <3<3 Posted 1 year ago 1 year
on fvo rta - water (wūsh rmx)
here have some more Posted 1 year ago 1 year
on fvo rta - water (wūsh rmx)
heard you like to drink hi hats and death Posted 1 year ago 1 year
on fvo rta - water (wūsh rmx) cute cute cute Posted 1 year ago 1 year
on Rango 006
so good Posted 1 year ago 1 year
on Rango 006 can i please get a download Posted 1 year ago 1 year
on Rango 006
supremacy Posted 1 year ago 1 year
on BNR MEGAMIX
oh man oh man Posted 1 year ago 1 year
on Pact
bc that is def what you are Posted 1 year ago 1 year
on Pact you picked the perfect handle fam Posted 1 year ago 1 year
on halpe~crystal tower (steelix remix)
a great remixing another great. mk mk slow down guys. i am not adjusted to this new world of explosive creativity yet. everyone is moving too fast for me. you are all so fucking good at everything, like wtf... so much talent flowing through this endearing, broken little website. luv u sc, fuck ups & all <3<3<3 big thanks to you steelix. keep throwing down fire as long as you live. and halpe, please remember our good old days when you huge famous n traveling the world bruh. i love you. thank you everyone else reading this. keep making great tunes, and keep supporting the magnificent mother fuckers who make them Posted 1 year ago 1 year
on Holy Goof - When I'm Ere [Bootleg] [Free Download]
<3 Posted 1 year ago 1 year
on Holy Goof - When I'm Ere [Bootleg] [Free Download]
whup whip. whup whip whop Posted 1 year ago 1 year
on Holy Goof - When I'm Ere [Bootleg] [Free Download]
damn leggooo Posted 1 year ago 1 year on Holy Goof - When I'm Ere [Bootleg] [Free Download] scary ass pirate trance comin to you fast. get prepped! Posted 1 year ago 1 year
on TURN THIS UP
oh glory Posted 1 year ago 1 year on OG Bobby Johnson (Psychic Pressure & Karol Tip 'Next Order' Remix)
mhm Posted 1 year ago 1 year on OG Bobby Johnson (Psychic Pressure & Karol Tip 'Next Order' Remix)
sweet as candy, but still kickin ass tho Posted 1 year ago 1 year on OG Bobby Johnson (Psychic Pressure & Karol Tip 'Next Order' Remix)
elegant but direct Posted 1 year ago 1 year on OG Bobby Johnson (Psychic Pressure & Karol Tip 'Next Order' Remix)
buildbuildbuilduibl Posted 1 year ago 1 year
on OG Bobby Johnson (Psychic Pressure & Karol Tip 'Next Order' Remix)
yee, good stuff Posted 1 year ago 1 year
on OG Bobby Johnson (Psychic Pressure & Karol Tip 'Next Order' Remix) cool lil twist back there i am liking it so far good good good Posted 1 year ago 1 year
on Not The Only One (Prod By. Lege Kale)
damn is right Posted 1 year ago 1 year
on Not The Only One (Prod By. Lege Kale)
y'all Posted 1 year ago 1 year
on Not The Only One (Prod By. Lege Kale)
oh snap this is so well done Posted 1 year ago 1 year
on Not The Only One (Prod By. Lege Kale) damn boy i hear you on that beat. much love Posted 1 year ago 1 year
on Andra Day - Rise Up (JR Nelson Remix)
gonna do it hard i see Posted 1 year ago 1 year
on FUN
yessssssss Posted 1 year ago 1 year
on The Image (Feat. Itto)
family family hot damn Posted 1 year ago 1 year
on Shawn Wasabi + YDG - Burnt Rice (feat. YUNG GEMMY)
nice as hell Posted 1 year ago 1 year
on Shawn Wasabi + YDG - Burnt Rice (feat. YUNG GEMMY) this is my shit. and your shit. this is their shit, our shit his, her, the shit Posted 1 year ago 1 year
on theresa get dat flame niggassss Posted 1 year ago 1 year
on molecular w/ MYTHIC
cloud trap evolved Posted 1 year ago 1 year
on molecular w/ MYTHIC
u crazy homie Posted 1 year ago 1 year
on molecular w/ MYTHIC
nice! Posted 1 year ago 1 year
on molecular w/ MYTHIC hot slippin damnnnn hahah this shit is sick Posted 1 year ago 1 year
on molecular w/ MYTHIC
gulp af Posted 1 year ago 1 year
on molecular w/ MYTHIC
already hooked me. continue Posted 1 year ago 1 year
on Rationale - Fast Lane (MXXWLL Remix)
very majestic Posted 1 year ago 1 year
on Rationale - Fast Lane (MXXWLL Remix)
much smooth Posted 1 year ago 1 year
on Things change superb composition! kept me interested Posted 1 year ago 1 year
on Fast Lane [SOLD]
arp got me dyin over here Posted 1 year ago 1 year
on Fast Lane [SOLD]
very neat : ) Posted 1 year ago 1 year
on Serbian Films
<3<3<3 Posted 1 year ago 1 year
on Serbian Films
beauty Posted 1 year ago 1 year
on Serbian Films
good lord Posted 1 year ago 1 year
on Serbian Films
; ( Posted 1 year ago 1 year
on Creepa - Todos
11/10 Posted 1 year ago 1 year
on Creepa - Todos creepa this is insane dude. all of your drums are perfectly matched. the breakdowns are so fucking i l l l l l l l ugh Posted 1 year ago 1 year
on Huntington Beach
wow. fucking love this so much Posted 1 year ago 1 year
on ur buggin me
never doubt u Posted 1 year ago 1 year
on badmuhfucker
sass mouth!!!! fcuk Posted 1 year ago 1 year
on diamonds
*let me whisper in your ear... about the past of future years* Posted 1 year ago 1 year
on diamonds
keys telling the most interesting story u ever heard Posted 1 year ago 1 year
on diamonds
fresh Posted 1 year ago 1 year
on Neverland [Reprise]
wonderful Posted 1 year ago 1 year
on When You're a Kid
about right Posted 1 year ago 1 year
on An Awfully Big Adventure
yessssss this is great Posted 1 year ago 1 year
on Overture
<3 <3 Posted 1 year ago 1 year on graves & tynvn - The Holy Mountain
insane collaboration Posted 1 year ago 1 year on graves & tynvn - The Holy Mountain
you > everybody Posted 1 year ago 1 year on graves & tynvn - The Holy Mountain
rip oylo Posted 1 year ago 1 year on graves & tynvn - The Holy Mountain these synths are welting me like my grandmother's paint stick Posted 1 year ago 1 year
on verzache - el amor
@readmywrights: this guy gets it Posted 1 year ago 1 year
on i just loved you (w/ tomppabeats & oiseaubizarre)
legendary Posted 1 year ago 1 year
on i just loved you (w/ tomppabeats & oiseaubizarre)
you guys...... Posted 1 year ago 1 year
on i just loved you (w/ tomppabeats & oiseaubizarre)
holy cow man this is gorgeous Posted 1 year ago 1 year
on DGAF (Vocal Mix) (Feat The Gift)
drums are aliiiive Posted 1 year ago 1 year on Work (prod. Neid)
i can ride Posted 1 year ago 1 year
on Work (prod. Neid)
cool. dig the new and old Posted 1 year ago 1 year on Ellusive & Eljay - Like This Before...
:):) Posted 1 year ago 1 year on Ellusive & Eljay - Like This Before...
breaking boundaries Posted 1 year ago 1 year on Ellusive & Eljay - Like This Before...
smashing track Posted 1 year ago 1 year
on Chef Red ft. No Tv No Radio - King
smackkk Posted 1 year ago 1 year on Chef Red ft. No Tv No Radio - King
y i aint heard this Posted 1 year ago 1 year
on CLOSURE):
dank track. so masterful Posted 1 year ago 1 year
on CLOSURE): this is what i am fucking talking about Posted 1 year ago 1 year
on verzache - el amor
weighty Posted 1 year ago 1 year
on verzache - el amor
honorable Posted 1 year ago 1 year
on verzache - el amor
magnificent Posted 1 year ago 1 year on Sweet Yogurt X Liquid - Peppermint
sweet baby jesus Posted 1 year ago 1 year
on Feels this that kinda tune you smash somebody's face in with a shovel to Posted 1 year ago 1 year
on Jupe - Hurry (2.0)
this shit is monstrous!! Posted 1 year ago 1 year
on Set It Off (ft. Aaron Cartier & Dylan Brady)
l i t Posted 1 year ago 1 year
on Set It Off (ft. Aaron Cartier & Dylan Brady)
set me off! Posted 1 year ago 1 year
on instupendo - free space
hey homie, back 2 tell u that i love u Posted 1 year ago 1 year on Major Lazer - Be together (Saen. Remix)
hoppin hard Posted 1 year ago 1 year on Major Lazer - Be together (Saen. Remix)
mad slick brother Posted 1 year ago 1 year
on rich girl (prod. domino)
fam fam fam Posted 1 year ago 1 year
on rich girl (prod. domino)
booyyyyyyyy Posted 1 year ago 1 year
on atolla - White Sand
you're the fucking man Posted 1 year ago 1 year
on brooklyn
we dyin' over here Posted 1 year ago 1 year
on brooklyn oh baby Posted 1 year ago 1 year
on idle hour ft. dawson & kolada
@mr_pawn: oh hush Posted 1 year ago 1 year
on Black Dignity
i love this vibe Posted 1 year ago 1 year on Cavalier - COMME Des GARÇONS
cool stuff Posted 1 year ago 1 year
on m o m e n t | o f | l o v e
surreal! Posted 1 year ago 1 year
on m o m e n t | o f | l o v e
holy shit!! Posted 1 year ago 1 year
on m o m e n t | o f | l o v e awh :) how lovely Posted 1 year ago 1 year on Tiber x BADNEW - Yeah
wow Posted 1 year ago 1 year on Tiber x BADNEW - Yeah
unable to disappoint Posted 1 year ago 1 year
on Come Back
great stuff man Posted 1 year ago 1 year
on Come Back
beautiful Posted 1 year ago 1 year
on impetus
whip that shittt Posted 1 year ago 1 year
on TOO GOOD FOR YOU
<3 Posted 1 year ago 1 year
on TOO GOOD FOR YOU
lord have mercy on me Posted 1 year ago 1 year on Flight Facilities - Crave You (SoySauce Remix)
whewwww it is steamy up in here Posted 1 year ago 1 year
on Baby Bash - Suga Suga (SoySauce Remix)
yeahhh Posted 1 year ago 1 year
on Baby Bash - Suga Suga (SoySauce Remix)
i'm about this shit Posted 1 year ago 1 year
on k the infinite - interstellar medium
penetration Posted 1 year ago 1 year
on k the infinite - interstellar medium
i am i n i t Posted 1 year ago 1 year
on Nobody Else feat. Brasstracks & Niya Wells
<3<3<3<3 Posted 1 year ago 1 year
on Nobody Else feat. Brasstracks & Niya Wells
best song so far this month Posted 1 year ago 1 year
on Nobody Else feat. Brasstracks & Niya Wells
i lovehate music so much Posted 1 year ago 1 year
on Nobody Else feat. Brasstracks & Niya Wells and brasstrack is always solid as as all get out. ugh Posted 1 year ago 1 year
on Nobody Else feat. Brasstracks & Niya Wells
niya is fucking destroying it!! Posted 1 year ago 1 year
on Nobody Else feat. Brasstracks & Niya Wells
unmatchable percussion Posted 1 year ago 1 year on Nobody Else feat. Brasstracks & Niya Wells
i just screamed like a little bitch Posted 1 year ago 1 year
on Nobody Else feat. Brasstracks & Niya Wells
jesus lord this tune is moving at a ferocious speed.uughghghghghgh that bounce Posted 1 year ago 1 year
on Nobody Else feat. Brasstracks & Niya Wells
fucking fuccccck Posted 1 year ago 1 year
on Nobody Else feat. Brasstracks & Niya Wells
oh no. r my pants bouta get creamed? Posted 1 year ago 1 year
on MANI007 - "PUSSAYE" BY HOODJOPLIN
hey hey hey hey Posted 1 year ago 1 year on Little Dragon - Pretty Girls (TBG Disco Love Remix)
super groover time Posted 1 year ago 1 year on flora
unreal... Posted 1 year ago 1 year
on cha this is so fucking cool homie Posted 1 year ago 1 year
on cha
oh goodie Posted 1 year ago 1 year
on Kendrick & LOUD - KFC
; )) Posted 1 year ago 1 year
on Kendrick & LOUD - KFC
hggg Posted 1 year ago 1 year
on Kendrick & LOUD - KFC
strong bloops b Posted 1 year ago 1 year on TURN THIS UP
dgaffff Posted 1 year ago 1 year
on TURN THIS UP
turn it up tho Posted 1 year ago 1 year
on TURN THIS UP my ears are bleeding i think? Posted 1 year ago 1 year
on W a t e r W h i p
this is so flipping slick Posted 1 year ago 1 year
on Praia
my boy Posted 1 year ago 1 year
on Electric City W/ akihabara!
hot damn Posted 1 year ago 1 year on Characters (Set)
aighht Posted 1 year ago 1 year
on K. Relly (w/ J.Robb)
y'all crazy Posted 1 year ago 1 year
on When sasha gets fucked
oh my goodness Posted 1 year ago 1 year on hiking in an undiscovered forest on another planet (W. Hot Sugar)
why didn't i know this song existed??? can anyone tell me??? Posted 1 year ago 1 year
on 䙄// (gomen'nasai Remix) [free dl]
whoaa Posted 1 year ago 1 year
on red velvet w/ smino
you've got a gem on ur hands Posted 1 year ago 1 year on Elevation - Gone
evil Posted 1 year ago 1 year
on nostalgia
cutting edge Posted 1 year ago 1 year
on Use Me
: ) Posted 1 year ago 1 year
on clothes off
ty Posted 1 year ago 1 year
on clothes off this must be a joke. it's like the perfect song? lol Posted 1 year ago 1 year
on clothes off
@whoiskev: room for three? Posted 1 year ago 1 year
on clothes off yup you got it Posted 1 year ago 1 year
on clothes off
already figured out the formula i see Posted 1 year ago 1 year
on TFW u stand on the dj table
wonky Posted 1 year ago 1 year on We All Fall Down Feat. Jamie Lidell (Willy Joy Remix)
damn Posted 1 year ago 1 year
on Peaches
most beautiful thing i've heard all night Posted 1 year ago 1 year
on Peaches
scorch! Posted 1 year ago 1 year
on Peaches rip oylo died from deadly guitar Posted 1 year ago 1 year
on Harrison X The Kount - Falling In love Edit
gorgeous Posted 1 year ago 1 year
on Harrison X The Kount - Falling In love Edit
why tf am i not following you Posted 1 year ago 1 year on Bryson Tiller ~ How About Now ( Kount x falcxne edit)
unreal work y'all Posted 1 year ago 1 year on Bryson Tiller ~ How About Now ( Kount x falcxne edit)
maddd! Posted 1 year ago 1 year on Bryson Tiller ~ How About Now ( Kount x falcxne edit)
this groovin' thooo Posted 1 year ago 1 year on Bryson Tiller ~ How About Now ( Kount x falcxne edit)
let's goo Posted 1 year ago 1 year on Bryson Tiller ~ How About Now ( Kount x falcxne edit)
snap and step Posted 1 year ago 1 year
on Pick Up's with Fossa Beats - Episode 003
;) Posted 1 year ago 1 year
on hush w/ cehryl
@escpemusic: water Posted 1 year ago 1 year
on hush w/ cehryl
@beatsbybow: cehryl is a madwoman Posted 1 year ago 1 year
on hush w/ cehryl
@instupendo: ditto, partner Posted 1 year ago 1 year
on hush w/ cehryl
@indigobeck: look at who's talking Posted 1 year ago 1 year
on hush w/ cehryl
@zenzenzenzen: i appreciate you Posted 1 year ago 1 year
on hush w/ cehryl
@whoiskev: c: love you kev Posted 1 year ago 1 year
on Inside me
sorrow Posted 1 year ago 1 year
on @DayDreamMuzic - K.A.W.A.K.A.M.I. [V2] love this atmosphere! reminds me of... home hahah Posted 1 year ago 1 year
on intro (ESCAPISM OUT NOW)
i just don't know what to say Posted 1 year ago 1 year
on re-goodbye
relaxed Posted 1 year ago 1 year on Colours
i never want to leave this place Posted 1 year ago 1 year on Bones - IThinkThereIsSomethingInTheRadiator (Prod. by Misogi)
mega brisk Posted 1 year ago 1 year
on Bob Sinclar & Dimitri From Paris - Love Is The Answer ft Byron Stingily (Club Edit)
i am fucking grooving through the universe Posted 1 year ago 1 year
on instupendo - free space
love one another Posted 1 year ago 1 year
on instupendo - free space
let bygones be bygones Posted 1 year ago 1 year
on instupendo - free space
the world keeps turning Posted 1 year ago 1 year on OCHO (Prod. Mathaius Young)
sick Posted 1 year ago 1 year
on pad wah
dankkk Posted 1 year ago 1 year on Sam Lee and David Rothenberg with a nightingale
: ) Posted 1 year ago 1 year on Sam Lee and David Rothenberg with a nightingale
smooth and administrative Posted 1 year ago 1 year
on Matthew Barley live with a nightingale
very neat Posted 1 year ago 1 year
on Nightingale Short Dry beautiful!! can i use this sample royalty free? Posted 1 year ago 1 year on Ian Ewing & UNDA - You Wanna
coooool Posted 1 year ago 1 year on Bingo - Wavious (Mental Radio)
mad vibes happenin' Posted 1 year ago 1 year
on Coubo - Myrrh ("Selcouth")
;' ) Posted 1 year ago 1 year
on Coubo - Myrrh ("Selcouth")
got fuckin damn it Posted 1 year ago 1 year
on Coubo - Inborn ("Selcouth")
coubo 4 lyfe Posted 1 year ago 1 year
on Coubo - Paradise ("Selcouth")
you are my favorite Posted 1 year ago 1 year on Swinter Prod. bsc.
killing shit, loving it, 10 of 10 Posted 1 year ago 1 year
on Body Not Your Mind i just want you to know that this song actually made me cry Posted 1 year ago 1 year
on till death
i love you brother Posted 1 year ago 1 year
on Porches - Hour
smoother than shaved butter Posted 1 year ago 1 year
on Hana
whewwww Posted 1 year ago 1 year
on Hana
killing this shit bruh Posted 1 year ago 1 year
on review w/ lars fucse @woodsofficial: my boy lars Posted 1 year ago 1 year
on strtn sttn
@johnfhennessy: thank you thank you Posted 1 year ago 1 year
on residential representation
@phuturecollective: thank you for the support!! Posted 1 year ago 1 year
on alone time.
@n0guez: way to go!! Posted 1 year ago 1 year
on alone time.
@itsmvpvche: is that a drooling face, bc i'm taking this Posted 1 year ago 1 year
on alone time.
@dzonzi: hahahha same Posted 1 year ago 1 year
on alone time. @instupendo: <3<3 Posted 1 year ago 1 year
on alone time.
@camelsinigloos: pow Posted 1 year ago 1 year
on alone time.
@whoiskittymars: & stylin Posted 1 year ago 1 year
on alone time.
@roshan-a: i love instupendo Posted 1 year ago 1 year
on alone time.
@lonemoon: what up shem Posted 1 year ago 1 year
on alone time.
@sexypillguy: gr9 Posted 1 year ago 1 year
on alone time.
@softhorizons: everything about this dude is on point. what you talkin' about Posted 1 year ago 1 year
on alone time.
@judah-tru: mine too Posted 1 year ago 1 year
on alone time.
@n0guez: u got a gf yet homie? Posted 1 year ago 1 year
on alone time.
@cnvrtsounds: flaming fire Posted 1 year ago 1 year
on alone time.
@puzzledprod: damn straight Posted 1 year ago 1 year
on 555
kingly as fuck Posted 1 year ago 1 year
on BLIP
whip that synth homie Posted 1 year ago 1 year
on MINDSET
dat mindset Posted 1 year ago 1 year
on SEEMS LEGIT
this is so damn chill Posted 1 year ago 1 year
on SEEMS LEGIT
dumb lickin snare boiiii! Posted 1 year ago 1 year
on FEELINGS
: ) Posted 1 year ago 1 year
on HEALTH
such talent Posted 1 year ago 1 year on LEAN QUATIFAH x Khia // Bustin
congrats on the xxx! Posted 1 year ago 1 year
on SoundPatrol - w/ u
@sound-patrol: i'm excited man. we are all going places Posted 1 year ago 1 year
on Bruce Lee (Evan Inc. x Lean Quatifah Edit)
yuppp u lifted me u!! Posted 1 year ago 1 year
on 3MV
omg Posted 1 year ago 1 year
on Haze.
very serene. got my head spinning Posted 1 year ago 1 year
on Space Time
very cool Posted 1 year ago 1 year
on Space Time
thick Posted 1 year ago 1 year on SoundPatrol - w/ u
: ( <3 Posted 1 year ago 1 year
on 4. // Concepts
mad smooth Posted 1 year ago 1 year
on Claps
good lordd Posted 1 year ago 1 year
on Claps
this is realization Posted 1 year ago 1 year
on Cigarettes On The Balcony
i'm loving your drums!! Posted 1 year ago 1 year on Jeanie & rgry - Set The Pace
slam frickin' dunk Posted 1 year ago 1 year on Jeanie & rgry - Set The Pace
y a l l Posted 1 year ago 1 year
on Jeanie & rgry - Set The Pace
i literally do not believe this Posted 1 year ago 1 year
on Wylen - Dream
: ) : ) awh Posted 1 year ago 1 year
on évoquer
love love love Posted 1 year ago 1 year
on évoquer
so many great tunes today Posted 1 year ago 1 year
on [empty thoughts] tape
@calebxbelkin: not much man. digging this tape! Posted 1 year ago 1 year on [empty thoughts] tape
hey caleb Posted 1 year ago 1 year
on Thoughts
love you man! Posted 1 year ago 1 year
on Thoughts
head splitting Posted 1 year ago 1 year on GONE RMX F. TRE CAPITAL (p. NOVA & DUTCHBOY)
god dank Posted 1 year ago 1 year
on residential representation
@knowonemusic: you are blowing up!!! Posted 1 year ago 1 year
on residential representation
@knowonemusic: thanks dawg! Posted 1 year ago 1 year
on NO STRESS /W ALPHONSE FUNZ well i'll be Posted 1 year ago 1 year
on RIGHT NOW my nigga oclaz comin' thru with them thick ass claps Posted 1 year ago 1 year
on BAE
ughhhhh this reverbbbb Posted 1 year ago 1 year
on ME & MYSELF
wonderful Posted 1 year ago 1 year
on KNOCKED OUT
i like you a lot Posted 1 year ago 1 year
on KNOCKED OUT
yung coubo Posted 1 year ago 1 year
on GOOD MORNING damn homie, it sure is a good morning. thanks! Posted 1 year ago 1 year on Ahh ooh x Muzzy Bearr (ft. K.B. Starr) - Call You Up
so frickin' clean Posted 1 year ago 1 year
on Halpe - Phantom
<3 Posted 1 year ago 1 year
on Halpe - Phantom
hlcckkkkk Posted 1 year ago 1 year
on while you were here
@nxp7: i appreciate that man Posted 1 year ago 1 year
on real
@valentina-marini: <3<3 Posted 1 year ago 1 year
on residential representation
@indigougly: <3<3 Posted 1 year ago 1 year
on while you were here
@jacquesuk: thanks bruh Posted 1 year ago 1 year
on Laetho - Pegasus
cool deal manee Posted 1 year ago 1 year
on Shywalker - Late
c: Posted 1 year ago 1 year
on OWL(Battle of The Beatmakers 2016)
mad Posted 1 year ago 1 year
on TastyTreat x Dathan - Get Creative
lit Posted 1 year ago 1 year
on TastyTreat x Dathan - Get Creative whatever this muffled toy telephone sound is has got me melting Posted 1 year ago 1 year
on TastyTreat x Dathan - Get Creative
mother of pearl Posted 1 year ago 1 year
on Slumberjack - Enigma ft. GRRL PAL how have i been shitting my pants for three minutes Posted 1 year ago 1 year
on Raindance
excellent Posted 1 year ago 1 year
on Raindance
looney Posted 1 year ago 1 year
on Chaos Theory - DisMissedFit X Sir Name
mad lyrics bruh Posted 1 year ago 1 year
on Emerald Halls
smick smack booty whack Posted 1 year ago 1 year on Ryan Hemsworth - Snow In Newark (Grynpyret Remix)
c: Posted 1 year ago 1 year
on Keii - She
lickin Posted 1 year ago 1 year
on Slasher
boyyyy u better watch urself Posted 1 year ago 1 year
on residential representation
@scotthubbard: thank you! Posted 1 year ago 1 year
on residential representation
@henryanthony-duscheid: ga Posted 1 year ago 1 year
on ...
super unique! Posted 1 year ago 1 year on Run Back Home to Me (Leif Ka)
@leifka: :' ) keep it up! Posted 1 year ago 1 year
on dead by christmas
i'm getting emotional Posted 1 year ago 1 year
on Run Back Home to Me (Leif Ka) love the low roar on the guitar. gives it a nice powerful, 'not messing around' vibe Posted 1 year ago 1 year
on Run Back Home to Me (Leif Ka)
tell em' leif Posted 1 year ago 1 year
on plastic w/ inimicvs (OUT NOW)
clink clonk Posted 1 year ago 1 year
on today
sweeter than pumpkin pie Posted 1 year ago 1 year on Chahine & Ocelli - Brazilian 420
i am swooned Posted 1 year ago 1 year
on FRAME [NEST HQ Premiere]
fucking fuck Posted 1 year ago 1 year
on Never
spankin' Posted 1 year ago 1 year
on Run It Up
<3 this flow Posted 1 year ago 1 year
on leave a little on the dresser
masterdank Posted 1 year ago 1 year on kolada - i know u know (Stevie Flip)
my boy Posted 1 year ago 1 year on GONE (prod. @SoundsByNova)
holla Posted 1 year ago 1 year
on I. Con Sordino [Godwin and the Beast]
sunshine time thooo Posted 1 year ago 1 year on I. Valse Moderato [Waltz Reprise and Horse Dream]
you tell stories very well with your music Posted 1 year ago 1 year on I. Valse Moderato [Waltz Reprise and Horse Dream]
very cool!! Posted 1 year ago 1 year
on Swag Swag
damn bruhh Posted 1 year ago 1 year
on I. Tre Volte Piu [The Debtors Call]
amazingly powerful <3 Posted 1 year ago 1 year on I. Valse Accelerando [Cassandra's Waltz]
: ) : ) Posted 1 year ago 1 year
on I. Valse Accelerando [Cassandra's Waltz]
loving the playful strings!! Posted 1 year ago 1 year
on I. Allegretto Maestoso [Belle's Dream]
glamorous Posted 1 year ago 1 year
on C Y G N - Pop A Cherry
@dominosmusic: what i'm saying. my jaw broke Posted 1 year ago 1 year
on C Y G N - Pop A Cherry
g o o d f u c k i n g l o r d Posted 1 year ago 1 year
on Lege Kale - Syzurp (w/ KMB, OY, Amazing Prophet)
i'm in Posted 1 year ago 1 year
on Lege Kale - Syzurp (w/ KMB, OY, Amazing Prophet) shit's a delicacy Posted 1 year ago 1 year
on graves & MYRNE - Tiger Blood
superb track dudes Posted 1 year ago 1 year
on graves & MYRNE - Tiger Blood
just lost my marbles Posted 1 year ago 1 year on A-Trak - We All Fall Down (Fung Sway Remix)
intense feelings Posted 1 year ago 1 year
on Short Feelings
enter the dream world' Posted 1 year ago 1 year
on park
<3 Posted 1 year ago 1 year
on Christian Dean - Yonce damn. heavy Posted 1 year ago 1 year
on Slim Guerilla - 50 Points (Prod.SavZilla)
aye Posted 1 year ago 1 year
on Bounce Back
alright i'm feelin' it Posted 1 year ago 1 year
on Fleeting Moment
pristine Posted 1 year ago 1 year
on Fleeting Moment
drums sailing Posted 1 year ago 1 year on Tall Black Guy - Sade's Taboo(Sweetest Taboo Blap-Up)
this is good Posted 1 year ago 1 year
on 777 (p. Säge, The 64th Wonder)
dang boy Posted 1 year ago 1 year
on Feelin Gud
oh goodness Posted 1 year ago 1 year
on GoldLink - Dance On Me (Lege Kale Remix)
@legekale: all good homie Posted 1 year ago 1 year
on Champagne And Pools (feat. Blackbear & KYLE)
this is so chill Posted 1 year ago 1 year
on bon voyage. (Loin de Paris)
ill Posted 1 year ago 1 year
on October
everything will be okay Posted 1 year ago 1 year on Universal Music Group, Disclosure Sounds Like Geotheory.
@greatrelease: : ) Posted 1 year ago 1 year on Universal Music Group, Disclosure Sounds Like Geotheory.
@n4c10: wtf. fuck you mate Posted 1 year ago 1 year
on Edo Lee - Shadow Box
super cool tune homie Posted 1 year ago 1 year
on DOKUE - Who Needs Me
arcade Posted 1 year ago 1 year
on capt. pizza - Living Room Flow
i am drenched Posted 1 year ago 1 year
on HUNTS. - Hai
hot fucking damn this is so cute Posted 1 year ago 1 year
on west1ne - Wake Me
nigga you my jinzo Posted 1 year ago 1 year on west1ne - Wake Me you're like the one rare yugioh card you get after having bought 55 individual packs Posted 1 year ago 1 year
on west1ne - Wake Me
son of a gun Posted 1 year ago 1 year
on montell2099 - Pa Boy
squad Posted 1 year ago 1 year
on plusma x bess one - sumpaya
my god Posted 1 year ago 1 year
on plusma x bess one - sumpaya
did someone order a dusty phase burger hefuwei Posted 1 year ago 1 year
on Universal Music Group, Disclosure Sounds Like Geotheory.
alright jimbim Posted 1 year ago 1 year on Montell2099 - Apply
this guy is not human lol Posted 1 year ago 1 year
on Creepa & Comodo - ChinaTown great work capturing the oriental vibes Posted 1 year ago 1 year
on sonao
beatz Posted 1 year ago 1 year on GoldLink - Dance On Me (Lege Kale Remix)
C: Posted 1 year ago 1 year on GoldLink - Dance On Me (Lege Kale Remix)
my ears bleeding dawg Posted 1 year ago 1 year
on HH - LUKEY
spankin' bruhh. thesseee stabssss Posted 1 year ago 1 year on Khary ~ Ambidextrous (Lege Kale Remix)
legend kaller Posted 1 year ago 1 year
on BAFFL - Ur Groove
fresh Posted 1 year ago 1 year
on somewhere.else. (beattape)
:') Posted 1 year ago 1 year
on Baht - Pop That
donk. donkadankodonk Posted 1 year ago 1 year
on Sleep (4am)
gooood shit Posted 1 year ago 1 year
on stories
@kittynxc: danke! Posted 1 year ago 1 year on Killa Ft. Waddafuhkgang
@m_i_g: you said "hell nah" at the place i commented bruh hahah Posted 1 year ago 1 year
on Maxx Baer - Otherside
snapping fire Posted 1 year ago 1 year
on Maxx Baer - Otherside
i am impressed Posted 1 year ago 1 year
on JOEY BADA$$ - CHRIST CONSCIOUSNESS (NOIZE REMIX)
fuckin' kilaaa Posted 1 year ago 1 year
on SevnthWonder - Drift (ft. CAPSUN)
son!! Posted 1 year ago 1 year
on SevnthWonder - Drift (ft. CAPSUN)
mad drift Posted 1 year ago 1 year on Zero Tep & Holly - By The Throat
tryna give me a heart attack or Posted 1 year ago 1 year
on Slipperz
thank you Posted 1 year ago 1 year
on Slipperz
blessed Posted 1 year ago 1 year on exyle x Dirty Chocolate - Main Memory
!!!!!!!!!!!!!! Posted 1 year ago 1 year on exyle x Dirty Chocolate - Main Memory
mother of hell Posted 1 year ago 1 year on exyle x Dirty Chocolate - Main Memory
fuck me Posted 1 year ago 1 year on exyle x Dirty Chocolate - Main Memory sickk Posted 1 year ago 1 year on KRANE x Traxell - Initiation [SESSIONS_01.2]
wonderful! Posted 1 year ago 1 year
on KRANE x Warior - Candy [SESSIONS_01.3]
what a beaut Posted 1 year ago 1 year
on KRANE x Warior - Candy [SESSIONS_01.3]
fuck these sounds are thick Posted 1 year ago 1 year on KRANE x West Metro - Pools [SESSIONS_01.4]
beams of exploding sunlight! Posted 1 year ago 1 year
on WYLN x DMND - Fall In Love
i like this onezq Posted 1 year ago 1 year
on qwertyuio holy Posted 1 year ago 1 year
on Only Exception
super cute Posted 1 year ago 1 year
on Chemistry
good lsiten Posted 1 year ago 1 year
on residential representation
@madnap: #2016 Posted 1 year ago 1 year
on residential representation
@paullutz: you're funnier than i am Posted 1 year ago 1 year
on forever
these claps Posted 1 year ago 1 year
on goldwater - glaciate
@thehollow: ; ) Posted 1 year ago 1 year
on Killa Ft. Waddafuhkgang
@m_i_g: your lyrics Posted 1 year ago 1 year
on just in case
@phuturecollective: (๑°꒵°๑) Posted 1 year ago 1 year
on residential representation
@kolada: (♥ *♥ ) Posted 1 year ago 1 year
on residential representation
@orbitual: thanks!! Posted 1 year ago 1 year
on residential representation
@paullutz: some say he's still down there to this day Posted 1 year ago 1 year
on residential representation
@madnap: who knew oylo was such a thug Posted 1 year ago 1 year
on residential representation
@polypinesmusic: <3 u Posted 1 year ago 1 year
on residential representation
@samsinbeats: yeee Posted 1 year ago 1 year
on residential representation
@p-a-n-o: thanks dude! Posted 1 year ago 1 year
on residential representation
@statues: nah nah, u all the way :) Posted 1 year ago 1 year
on residential representation
@iamrethink: hey what's up fam Posted 1 year ago 1 year
on residential representation
@haxaar: thanks haxaar Posted 1 year ago 1 year
on residential representation
@dominosmusic: ;' ) Posted 1 year ago 1 year
on residential representation
@makeyours:⃛ヾ (๑❛ ▿ ◠๑ ) Posted 1 year ago 1 year
on MARVIN
dank as fuck Posted 1 year ago 1 year
on IWANT
"lemme wet my snare b4 i slap u with it" Posted 1 year ago 1 year on Tigers Jaw - Plane vs Tank vs Submarine//Poly Pines Remix
nash Posted 1 year ago 1 year
on Knite Watch - Infamous Crooks
i am wilin' out over here Posted 1 year ago 1 year on Clockwork Radio - Session 037 with BMac & LURKS (Rilla Force Guest Mix)
clickitty clockitty splurppin clurklip percs Posted 1 year ago 1 year
on Brazilian Blowjob
yupp Posted 1 year ago 1 year
on KRANE x Sober Rob - Icy [SESSIONS_01.1]
this is filthy Posted 1 year ago 1 year
on KRANE x Sober Rob - Icy [SESSIONS_01.1] holy shit what a beautiful idea! cannot wait to hear more sessions Posted 1 year ago 1 year
on Rilla Force - Tribal (Rilla Force 1.5 HD Remix)
haha oh buddy this rattles my body Posted 1 year ago 1 year
on Rilla Force - Tribal (Rilla Force 1.5 HD Remix)
neato!!!!!! Posted 1 year ago 1 year
on Rilla Force - Tribal (Rilla Force 1.5 HD Remix)
space trek vibes Posted 1 year ago 1 year
on Lament
in this moment... rest of quote Posted 1 year ago 1 year on Strange Talk - Painted In Gold (Robotaki Remix)
:' ) Posted 1 year ago 1 year
on Zucchini Noodles
(ﾉ^ϻ^)ﾉ*:・ﾟ✧ Posted 1 year ago 1 year
on 2:20 am
it's like a slippery snake Posted 1 year ago 1 year
on Ark Patrol - Primo
ark patrol knows what my brain looks like Posted 1 year ago 1 year
on Life's Too Short To Be Bummed
<3 u man Posted 1 year ago 1 year
on Fraud
straight up bitch Posted 1 year ago 1 year on RiverMoon(feat Aquandre~ and Giulio Xavier Cetto)
these guys are amazing Posted 1 year ago 1 year on RiverMoon(feat Aquandre~ and Giulio Xavier Cetto)
unreal my friend Posted 1 year ago 1 year
on Just for The Night w/ Dylan Brady
trill n chill Posted 1 year ago 1 year
on shells (prod. tomppabeats)
i'm still hyped on this Posted 1 year ago 1 year on damp, still ft. antonio, cat soup, curtis heron, drew the architect & smitty the bg
stress relief Posted 1 year ago 1 year
on Wonder
lakey always comes through with the chillest shit Posted 1 year ago 1 year
on Lemon Eyes (StéLouse Remix)
spank that snare Posted 1 year ago 1 year
on Shahly - Capture My Heart
r Posted 1 year ago 1 year
on Shahly - Capture My Heart
constant suprises Posted 1 year ago 1 year
on Shahly - Capture My Heart
kawaii!! <3 Posted 1 year ago 1 year on Shahly - Capture My Heart
hahah breakdown is jokingly severe Posted 1 year ago 1 year
on Shahly - Capture My Heart
creaming everywhere rn Posted 1 year ago 1 year
on Shahly - Capture My Heart
excited!! Posted 1 year ago 1 year
on Shahly - Capture My Heart
dope movement \ Posted 1 year ago 1 year on 16 **BONUS** Paradise (Produced By Don Cannon)
good work you guys Posted 1 year ago 1 year
on bria's interlude - drake (hellion rmx)
c: Posted 1 year ago 1 year on bria's interlude - drake (hellion rmx) those talking synths got me stroking Posted 1 year ago 1 year
on bria's interlude - drake (hellion rmx)
loving it hellion Posted 1 year ago 1 year on Where'd You Go Yesterday? [prod. greg]
dang Posted 1 year ago 1 year
on Lone
the pannnnn <3<3 Posted 1 year ago 1 year
on Lone
bangin' Posted 1 year ago 1 year
on Eestbound ~ Lines
dat clap yeeee Posted 1 year ago 1 year on Eestbound ~ Lines
i will accept these dark vibes into me Posted 1 year ago 1 year
on Little Boodha - Dust | Free Download Series
zoning Posted 1 year ago 1 year on Noble (feat. Jae Tips) [Prod. Black Milk, Dj Dahi]
them clapsss!!! Posted 1 year ago 1 year
on Pendragon [Prod. By Black Milk]
space-time Posted 1 year ago 1 year
on Wanna Get High With You [Prod. Dj Dahi]
love this so much Posted 1 year ago 1 year
on Wanna Get High With You [Prod. Dj Dahi]
very refreshing beats on this album wow Posted 1 year ago 1 year
on Winners Over All [Prod. Kid Sound] smashh Posted 1 year ago 1 year
on GT$$TD [Prod. Iman Omari]
this intro is mad cool Posted 1 year ago 1 year on Work Out [Prod. Epik Da Dawn]
gorgeous tune! :D Posted 1 year ago 1 year
on NversivE & Harris Cole - Lisse
i am fucking zonked Posted 1 year ago 1 year
on goldwater - glaciate
this must be the afterlife Posted 1 year ago 1 year
on goldwater - glaciate
elegant destruction Posted 1 year ago 1 year
on Red refreshing as hell Posted 1 year ago 1 year
on wifey
sweet caramel Posted 1 year ago 1 year
on poetic justice
yess Posted 1 year ago 1 year
on Moments Of Weakness
nice! Posted 1 year ago 1 year
on amalthea
this is very very cool. i love it Posted 1 year ago 1 year
on Jive
superhero groover Posted 1 year ago 1 year
on Fire & Water wow wow wow~!! this was one of my favourite tunes already but you made it even better!! Posted 1 year ago 1 year
on Toonorth - [4u]
peace Posted 1 year ago 1 year
on i ain't playin
donkey kong 64 trapaholics Posted 1 year ago 1 year
on Tiber - Fantasy 31 the ride cymbal peeking in like heypssst Posted 1 year ago 1 year
on Tiber - The Beginning And The End
soooo cute Posted 1 year ago 1 year
on Tiber - The Beginning And The End
aka tiber Posted 1 year ago 1 year
on Tiber - The Beginning And The End
deathlord Posted 1 year ago 1 year
on Tiber - Somebody Else
tiber u are so dumb talented Posted 1 year ago 1 year
on Tiber - Selfish
hahaha holy fuckkkkkkk\ Posted 1 year ago 1 year
on reach
dope pulsing feeling Posted 1 year ago 1 year
on reach
super interesting Posted 1 year ago 1 year on swindail - gellaitry groove (novus remix)
masterful Posted 1 year ago 1 year on swindail - gellaitry groove (novus remix)
damn!! Posted 1 year ago 1 year
on swindail - gellaitry groove (novus remix)
idk why i haven't heard this one, but i love it! Posted 1 year ago 1 year
on residential representation
@tiberbeats: let me see what i can do Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
@why_you_look_at_my_link_listen_to_my_music: sorry i annoyed you. i was trying to support my friend Posted 1 year ago 1 year
on Fall Asleep Slow
: ) Posted 1 year ago 1 year
on Fall Asleep Slow
funky fresh fuel Posted 1 year ago 1 year
on ϞϷ
respect Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
good shit homie Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon] like a desert movie ending. someone is dead, but everything is right with the situation now Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
sinking Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
love!!! that out of tune effect Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
tension afffffff Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
bruh 2 fucking hard! Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
bass keep on drivin' Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon] i am definitely living bc of this song that's for dayum truuu Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
icy Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
ya heard me Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
chill game stupid phat Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
mad chill Posted 1 year ago 1 year on no masks (ft. irahnik) [prod. lonemoon]
irahnik merkin' Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
clok clok clok clok Posted 1 year ago 1 year
on no masks (ft. irahnik) [prod. lonemoon]
shem this purty Posted 1 year ago 1 year
on Beamon - Nightmare City (produced by K4000 & Unknown)
bruh there's a squirrel outside my window. like two feet away Posted 1 year ago 1 year
on All Yours you've been making some really beautiful stuff here lately Posted 1 year ago 1 year
on Just Wait and See (Ep version)
♥ Posted 1 year ago 1 year
on Just Wait and See (Ep version)
damn this is beautiful! Posted 1 year ago 1 year
on Braeden Bailey - Stick-Up Kids
fucking sick Posted 1 year ago 1 year
on forget
whoa nice! Posted 1 year ago 1 year
on Let It Go
those stabs thoo!! Posted 1 year ago 1 year
on ? i am a sucker for these chords Posted 1 year ago 1 year
on MDMA
this is amazing! Posted 1 year ago 1 year on Troubles
gorg Posted 1 year ago 1 year
on Troubles
mix game dominant Posted 1 year ago 1 year
on morning commute [matisse x kiqo]
@beatsbymatisse: for sure Posted 1 year ago 1 year
on forever (www.traktrain.com/wize)
grime time Posted 1 year ago 1 year
on never no more (www.traktrain.com/wize) those claps create such a scene in my head Posted 1 year ago 1 year
on walking away (www.traktrain.com/wize)
foreign christmas breakdance vibes Posted 1 year ago 1 year on Craneuhm - One4herrr
whoa now Posted 1 year ago 1 year
on Happy
super chill stuff!! Posted 1 year ago 1 year
on Return
<3 Posted 1 year ago 1 year
on Return
sweet bassline Posted 1 year ago 1 year
on Lucid-
love the folky undertones Posted 1 year ago 1 year on morning commute [matisse x kiqo]
sunday on a friday Posted 1 year ago 1 year on bryson tiller~dont (steelix & falcxne remix)
these breathing fx got me spoooooked Posted 1 year ago 1 year
on Gurl
this is wonderful <3<3 Posted 1 year ago 1 year
on chocolate milk (feat. R.O.M)
snappp!!! Posted 1 year ago 1 year on 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 (freestyle)
tv sux Posted 1 year ago 1 year
on cosmos
nicely done Posted 1 year ago 1 year
on Avery Sennin - Who Want It? (prod. elijah wiley)
damn i am spinning Posted 1 year ago 1 year on PZG - PARPLDREENK (Melt Unit Remix)
lord have mercy Posted 1 year ago 1 year
on Nez's Tipi
cash fucking money Posted 1 year ago 1 year on Seven Lions ft. Ciscandra Nostalghia - Serpent Of Old
scary Posted 1 year ago 1 year
on DiamondDahi - N.M.B.D. (feat. Little Simz)
sweet vocal fx Posted 1 year ago 1 year
on Ark Patrol - At All (ft. Veronika Redd)
superb as always Posted 1 year ago 1 year
on shells (prod. tomppabeats)
love it! Posted 1 year ago 1 year on mar|co - 1 2 3 (fern souza Remix)
mmm dat crisp ass snap Posted 1 year ago 1 year
on just in case
@robert59: thanks! i appreciate it Posted 1 year ago 1 year
on radio conference
@petite-aurelie: thanks! Posted 1 year ago 1 year
on Tibe X Falcxne - Chea
@tibemtl: thanks Posted 1 year ago 1 year
on shagabond for all in
nice work Posted 1 year ago 1 year
on Real Old Cigar
great album! Posted 1 year ago 1 year
on Picky Eaters lolllll Posted 1 year ago 1 year
on Nyquil
this ish is maaad chill man Posted 1 year ago 1 year
on morning these beams of sunlight are tearing shit uppp Posted 1 year ago 1 year
on Tibe X Falcxne - Chea
light me up fam Posted 1 year ago 1 year
on No Breaks (Prod By.Harris Cole)
truuuu Posted 1 year ago 1 year on KOSIKK - Heaven Seems So Far Away [Premiere]
sick synths Posted 1 year ago 1 year
on Alizzz - Your Love (feat. Max Marshall) <3 : ) Posted 1 year ago 1 year
on Alizzz - Your Love (feat. Max Marshall)
super cool effects Posted 1 year ago 1 year
on wanna be feelin you
my fav from you this week hahah Posted 1 year ago 1 year
on wanna be feelin you
son!!! Posted 1 year ago 1 year
on bryson tiller~dont (steelix & falcxne remix)
i was actually pretty calmed by that Posted 1 year ago 1 year
on Ș.Ș.ί.Ȼ
@aisu-pikku: p a s t a < <3<3<3<333 v3,#, Posted 1 year ago 1 year
on Silk (feat. Senojnayr)
much love guys Posted 1 year ago 1 year
on jamvvis for all in
love Posted 1 year ago 1 year
on jamvvis for all in
this shit right hurr iz thiikk Posted 1 year ago 1 year on Lauren Truee - Touch the Sky Remix (Prod J.Robb)[OFFICIAL VIDEO IN DESCRIPTION]
amen Posted 1 year ago 1 year
on You Can Run But Ya Can't Hide
@a-wood: <3 Posted 1 year ago 1 year
on Just Me And You
@a-wood: for sure!! Posted 1 year ago 1 year
on Dr. Pepper Girl
r.i.p oylo - died of dr. pepper hips Posted 1 year ago 1 year
on Green Mountian Meadows
love it! Posted 1 year ago 1 year
on Bat Dark Paploviante
i love how the atmosphere is constantly changing Posted 1 year ago 1 year
on Paploviante - Crazy Trance
beautiful Posted 1 year ago 1 year
on Paploviante - Crazy Trance
these melodies are fiiiiree Posted 1 year ago 1 year
on The Singing Messenger
wonderful Posted 1 year ago 1 year
on The Singing Messenger this is one of the more delightful tracks i've listened to recently Posted 1 year ago 1 year
on Sometimes/Collab with Al Wood
damn this is metal Posted 1 year ago 1 year
on Sometimes/Collab with Al Wood
nice Posted 1 year ago 1 year
on Black Crow
mad groove my friend Posted 1 year ago 1 year
on Black Crow
that snare drives me crazy Posted 1 year ago 1 year
on Fairy tale Blue's Collab with Bob Warner
jerry killin' this guitar tho Posted 1 year ago 1 year
on Fairy tale Blue's Collab with Bob Warner this is unexpectedly wonderful. i'm so glad i stayed Posted 1 year ago 1 year on Fairy tale Blue's Collab with Bob Warner
<3 Posted 1 year ago 1 year
on Can A Dream Come True
such delicate notes Posted 1 year ago 1 year
on You Can Run But Ya Can't Hide
wow. you blew me away Posted 1 year ago 1 year
on You Can Run But Ya Can't Hide
what an insane lead Posted 1 year ago 1 year
on You Can Run But Ya Can't Hide
fuck!! Posted 1 year ago 1 year
on You Can Run But Ya Can't Hide
holy! Posted 1 year ago 1 year on You Can Run But Ya Can't Hide
darkness af. well done Posted 1 year ago 1 year
on Just Me And You
i want to learn the guitar Posted 1 year ago 1 year
on castle it would be cool if my mower was silent so i could do the lawn to your music Posted 1 year ago 1 year
on genesis
yes it is Posted 1 year ago 1 year
on Broderie
twisted Posted 1 year ago 1 year
on High Five Days
slayin' tho Posted 1 year ago 1 year on High Five Days
; ) Posted 1 year ago 1 year
on LADYZ ft. Eshar
i like you dude Posted 1 year ago 1 year on b y e v s x ft. Rafeeq Badee (Nova Powers)
serenity is peac Posted 1 year ago 1 year
on CRWN - Better Together
snazzy Posted 1 year ago 1 year
on Florian Bery - Passion
solid groovin Posted 1 year ago 1 year
on Ș.Ș.ί.Ȼ
disgustingly good Posted 1 year ago 1 year on Tʜᴇ Wᴏʀʟᴅ
killer! Posted 1 year ago 1 year on Heroic Sessions - #007 - Ark Patrol
:n Posted 1 year ago 1 year on Heroic Sessions - #007 - Ark Patrol
<3 Posted 1 year ago 1 year
on Release me from the two worlds
crazy shti Posted 1 year ago 1 year
on Rilla Force - Aii Papi
@kiswamusic: yeah it fucking do Posted 1 year ago 1 year
on Rilla Force - Aii Papi
@instupendo: handstandz Posted 1 year ago 1 year on Rilla Force - Aii Papi
jeez Posted 1 year ago 1 year
on Your Bed
lord Posted 1 year ago 1 year
on Your Bed
i'm done af with you kev Posted 1 year ago 1 year
on Dreams Vs Reality
@starrprophets: always good Posted 1 year ago 1 year
on stories
@verse-alex: dm me man Posted 1 year ago 1 year on idle hour ft. dawson & kolada
@thehollow: ~¨♥♥¨~ Posted 1 year ago 1 year on Cuban Arguments & American Cartoons Ft. Laz - [Prod. By: AYNT]
dumb good drums Posted 1 year ago 1 year on Cuban Arguments & American Cartoons Ft. Laz - [Prod. By: AYNT]
and good vibes too Posted 1 year ago 1 year
on KOLAJ - The Touch (k?d Remix)
:') :') :') Posted 1 year ago 1 year
on Voyage - Mix.03
oh buddy Posted 1 year ago 1 year
on Voyage - Mix.03
so cute ># Posted 1 year ago 1 year
on Afro House 4 cool, afro house is the perfect way to describe this. nice nice nice Posted 1 year ago 1 year on Carpe Diem | Ai.D The Genius, Jimmy Dean
dankkk Posted 1 year ago 1 year
on Killa Ft. Waddafuhkgang
hell nah bruh Posted 1 year ago 1 year
on Dreams Vs Reality
holy moly Posted 1 year ago 1 year
on N E B U L A
pant shitter Posted 1 year ago 1 year
on waterproof
@cherylchow: hey Posted 1 year ago 1 year on NativeKid - Construct | Free Download Series
you just inspired me. ty ty Posted 1 year ago 1 year
on UNDA - 24's Still Wet superb Posted 1 year ago 1 year
on UNDA - 24's Still Wet
mhm Posted 1 year ago 1 year
on Hold You (Unfinished)
i'm spooked Posted 1 year ago 1 year
on Ru AREYOU X Prof.Logik - The Purest Water
everything is damn groovy Posted 1 year ago 1 year
on DETAILS
legit Posted 1 year ago 1 year
on UGLYYYYYYYYYYYYYYYYYYYYYYY [free download]
please don't delete man Posted 1 year ago 1 year on Hudson East ~ Dark Knight [Snippet] (Prod. by NOVA) i'm diggin it Posted 1 year ago 1 year
on IMMINENCE you always have the scariest vocal samples Posted 1 year ago 1 year
on foreword/new recording
u shit talent Posted 1 year ago 1 year
on placeholder
i wish i could play an instrument Posted 1 year ago 1 year
on intro/decision tree
so deep wtf Posted 1 year ago 1 year
on chaos theory
idk Posted 1 year ago 1 year
on chaos theory
this is unreally good Posted 1 year ago 1 year
on the fourth wall is broken
fantastic work Posted 1 year ago 1 year
on the fourth wall is broken
:o Posted 1 year ago 1 year
on weak knees
loving this ep cehryl Posted 1 year ago 1 year
on waterproof
dumb good Posted 1 year ago 1 year
on waterproof
god damn Posted 1 year ago 1 year
on KNAME - Dynasty that machining synth or whatever is insane Posted 1 year ago 1 year
on End "War" - Edwin Starr_(D!FsounD Flip)
well dang Posted 1 year ago 1 year on Adamn Killa - Know What They Payin (Prod. Blank Body)
rock solid Posted 1 year ago 1 year
on twist the knife
this goes deep Posted 1 year ago 1 year
on shh038: DZZ - Build Me
i'm de-aging as this song plays Posted 1 year ago 1 year
on An Elderly Woman Named Jeff
drums are sexx Posted 1 year ago 1 year
on Back & Forth
: ) Posted 1 year ago 1 year on Back & Forth
supreme mix! Posted 1 year ago 1 year
on sex u back to sleep.
super smooth Posted 1 year ago 1 year
on My Grxxd / Your Bitch
killing it Posted 1 year ago 1 year
on Sept Spells
this is awesome Posted 1 year ago 1 year
on just in case
@wearegraves: i literally cannot believe you just said that Posted 1 year ago 1 year
on Words to Say (feat. Mulherin)
eerie but i like it Posted 1 year ago 1 year on Coubo - Island Lovers ("Selcouth")
<3<3<3<3<3<3<3<3<3 Posted 1 year ago 1 year
on Coubo - Island Lovers ("Selcouth")
i am grinning like a goof Posted 1 year ago 1 year
on Coubo - Island Lovers ("Selcouth")
madman Posted 1 year ago 1 year
on Coubo - Island Lovers ("Selcouth")
ahhhh!!! Posted 1 year ago 1 year
on Coubo - Island Lovers ("Selcouth") holy shit i have been waiting for the next track so hard Posted 1 year ago 1 year
on Autolaser & Kenny Queso - Zoo Story
speed Posted 1 year ago 1 year on Autolaser & Kenny Queso - Zoo Story
jesus christ. wild Posted 1 year ago 1 year
on Colors ft. Jackie Rain
pretty vocals Posted 1 year ago 1 year
on Lido - I <3 you (graves flip v2.0)
fire Posted 1 year ago 1 year on "Donkey Kong 64" (prod. by Ozhora Miyagi)
@sorrykhary: nah, thank you dude! Posted 1 year ago 1 year
on Sky Gazing
mesmerizing Posted 1 year ago 1 year
on Azryd - I Love
oohh me likey Posted 1 year ago 1 year
on Saen - Breathe mad chilled Posted 1 year ago 1 year
on Blytz - Grandtheft
yep Posted 1 year ago 1 year
on Blytz - Grandtheft
this is straight g Posted 1 year ago 1 year
on Cresce - Wavy
hats on fleeeek Posted 1 year ago 1 year
on Instupendo - The Distance i meant to put a winking face Posted 1 year ago 1 year
on Instupendo - The Distance
: ) Posted 1 year ago 1 year
on Kaydub - Youth sweet drums boi Posted 1 year ago 1 year
on Alphie - Cold Flow
alphie!! Posted 1 year ago 1 year
on Rilla Force - Aii Papi dude comes strolling through the zoo in an adidas tracksuit with a boombox on his shoulder bumping this track and tossing butterscotch hard candies at everyone: rilla force - aii papi Posted 1 year ago 1 year
on Jupe - Hurry
vox are to die for my friend Posted 1 year ago 1 year
on silo - Streams
incredibly chill fam Posted 1 year ago 1 year
on Creepa & Comodo - ChinaTown
dank as f u c k Posted 1 year ago 1 year on J.Robb & West1ne - Fates Offspring
i am happy Posted 1 year ago 1 year
on Otxhello - Alone
b i r d s Posted 1 year ago 1 year
on Otxhello - Alone
i love this otxhello!! Posted 1 year ago 1 year
on while you were here
@thatyoungboyv: ty ty <3 Posted 1 year ago 1 year
on while you were here
@dujhan: thanks man! Posted 1 year ago 1 year
on Be Crazy
throwback <3 Posted 1 year ago 1 year on Avec Avec - ͭ͠͞ͼ freeDL ⇒ http://maltinerecords.cs8.biz/ 107.html
how lovely n_n Posted 1 year ago 1 year
on Resting Bitch Face
@antonjayy: you're welcome? Posted 1 year ago 1 year
on Krs. ~ Faking It. w/ Mars Today, Khary, Maurice Moore & Kingbnjmn
still vibin hard on this Posted 1 year ago 1 year
on SRNO - Hotline Bling
good shit family! Posted 1 year ago 1 year
on "Donkey Kong 64" (prod. by Ozhora Miyagi)
oh snap Posted 1 year ago 1 year
on "Donkey Kong 64" (prod. by Ozhora Miyagi)
unexpectedly wonderful Posted 1 year ago 1 year on Concisely
<3 Posted 1 year ago 1 year
on ando - Snacks
refreshing melody] Posted 1 year ago 1 year
on Watercolour
breathinggg Posted 1 year ago 1 year
on ♡
right back at ya bud Posted 1 year ago 1 year
on ≧◡≦
come on! make me feel a l i v e ! ! ! Posted 1 year ago 1 year
on He burnt my shake take me out of the oven bc i'm done af Posted 1 year ago 1 year on A Drop So Massive That If Ariana Grande Sang Over It She'd Have To Change Her Name to Ariana Trenta
ded Posted 1 year ago 1 year
on Stems Radio 003 w/ Tiber
my man tiber doin' the most at all times Posted 1 year ago 1 year
on umru + jamesbryce―glory bowl
@umrumusic: haha yeah, i've heard some of his stuff before Posted 1 year ago 1 year
on umru + jamesbryce―glory bowl
rich in sound Posted 1 year ago 1 year
on umru + jamesbryce―glory bowl
mad track guys Posted 1 year ago 1 year
on On My Grind (Prod. Tunji Ige + Noah Breakfast)
this is what it's about Posted 1 year ago 1 year on i did a nang and now my face feels funny
hell nah this is great Posted 1 year ago 1 year
on Cresce - Lost & Found
not a threat in the world Posted 1 year ago 1 year
on Forever Is A Lie
this is gold Posted 1 year ago 1 year
on PORTAL (Produced by Misc Friend)
ill Posted 1 year ago 1 year
on herzeloyde- pants (geotheory edit)
; ) Posted 1 year ago 1 year
on Resting Bitch Face
fresh ideas Posted 1 year ago 1 year on Lost Control
of my body Posted 1 year ago 1 year
on Dory
watch out for this guy. holy crap Posted 1 year ago 1 year on Am I Wrong - Anderson .Paak feat. ScHoolboy Q prod. by POMO
fucking lit!! Posted 1 year ago 1 year on Am I Wrong - Anderson .Paak feat. ScHoolboy Q prod. by POMO oh my groove this vibes so damn hard like holy moly you guys Posted 1 year ago 1 year
on swindail - chao (goodbye) [Clay Sauter Remix]
boy is this emotions Posted 1 year ago 1 year
on One Way
@claysauter: thanks dawg Posted 1 year ago 1 year on Krs. ~ Faking It. w/ Mars Today, Khary, Maurice Moore & Kingbnjmn
@jamalwoon: for sure Posted 1 year ago 1 year
on Krs. ~ Faking It. w/ Mars Today, Khary, Maurice Moore & Kingbnjmn
@kristina-zita: you bet your sweet ass Posted 1 year ago 1 year
on Krs. ~ Faking It. w/ Mars Today, Khary, Maurice Moore & Kingbnjmn
@steeziakbeats: hell yeah it is Posted 1 year ago 1 year
on Krs. ~ Faking It. w/ Mars Today, Khary, Maurice Moore & Kingbnjmn
@chronicmusicsoft: t h e ~ s e x Posted 1 year ago 1 year
on The M Machine - Moon Song interesting. i haven't heard anything like this in a while Posted 1 year ago 1 year
on One Way
trippy man Posted 1 year ago 1 year
on G Jones & Bleep Bloop- Mind
yeeee nigggaaaa Posted 1 year ago 1 year
on G Jones & Bleep Bloop- Plastic Flower People
what teh snapp Posted 1 year ago 1 year on tyler, the creator - yonkers (sakuraburst remix)
yoink Posted 1 year ago 1 year
on Holocene
what a professional mix holy fuck Posted 1 year ago 1 year
on I wish skype wouldn't drop while we sleep
jfc Posted 1 year ago 1 year
on I wish skype wouldn't drop while we sleep
take me away fam Posted 1 year ago 1 year on Tamia - So Into You (Childish Gambino Cover)
mad love Posted 1 year ago 1 year
on Emerald Halls
yo them snares is tooooo tight Posted 1 year ago 1 year
on i can see far from here
piano is 2 die for Posted 1 year ago 1 year
on Elzie X Fzpz - 7 Questions
supreme composition skills Posted 1 year ago 1 year
on Elzie X Fzpz - 7 Questions
way cool homie Posted 1 year ago 1 year
on Working for a living
<3 Posted 1 year ago 1 year on GRRL - Go Up [Nest HQ Premiere]
slam!! Posted 1 year ago 1 year
on Tides
alexander lewis knows exactly what the fuck he is doing Posted 1 year ago 1 year
on Eddy Calvert ~ Nobody [Prod. By Zxphxllxs]
jfc Posted 1 year ago 1 year
on Eddy Calvert ~ Nobody [Prod. By Zxphxllxs]
i'm wet Posted 1 year ago 1 year
on Vigorous ft. Keith Ape & Denzel Curry
yaaaaaa Posted 1 year ago 1 year on children of gaia (plastician rinse fm rip, out now on terrorhythm)
i wanna kill somebody to this Posted 1 year ago 1 year on duppymotus. - shade::home
very very nice Posted 1 year ago 1 year
on Are My Memes Too Dank?
i wish i could dance like i want to when i'm in public Posted 1 year ago 1 year
on Are My Memes Too Dank?
we are moving now!! :D Posted 1 year ago 1 year
on waiting on you
@dominosmusic: <$ Posted 1 year ago 1 year
on waiting on you the restaurant atmosphere way in the back gets me every time Posted 1 year ago 1 year
on idle hour ft. dawson & kolada
@zebediahberg: *blushes af* Posted 1 year ago 1 year on idle hour ft. dawson & kolada
@intr3pico: <3 Posted 1 year ago 1 year
on idle hour ft. dawson & kolada
@james_bryce: same. they both killed it Posted 1 year ago 1 year
on ego death
riser on blasssst Posted 1 year ago 1 year
on Euphoria Ft. Fleece
hats a plenty boiiiii Posted 1 year ago 1 year
on Fuego
<3<3<# Posted 1 year ago 1 year
on Fuego
got what i wanted from this <# Posted 1 year ago 1 year on Rain
@iampail: @whoiskev <3 u guys Posted 1 year ago 1 year
on charged up rmx hahahahahahahahah it's a fucking joke how much i like your music Posted 1 year ago 1 year
on Krs. ~ Faking It. w/ Mars Today, Khary, Maurice Moore & Kingbnjmn
this makes me want to have the sex Posted 1 year ago 1 year
on Chance The Rapper 'Angels' f/ Saba
fresh af Posted 1 year ago 1 year
on Ben West - BLT
beautiful guitar Posted 1 year ago 1 year
on Ben West - BLT
love the feel of this track Posted 1 year ago 1 year on genesis.
nice!! :D Posted 1 year ago 1 year
on Outlit x Zero Tep - Thumpier
good job guys! Posted 1 year ago 1 year
on Rain
this is wonderful key Posted 1 year ago 1 year
on Tiber - Power
this is sooo good dude Posted 1 year ago 1 year
on little puss you are probably one of my favorite producers dude. you deliver a variety of music and it's always high quality af Posted 1 year ago 1 year
on Knave - All Those Times (Prod. Purp Echo)
we can <3 Posted 1 year ago 1 year on Feelin' Good Ft. Synead (Prod. Ivan Jackson)
love the vocals, and the production is damn solid Posted 1 year ago 1 year
on Green [demo] // Thanks guys!
ur drums are fire thooo Posted 1 year ago 1 year
on things that u do :)
:) Posted 1 year ago 1 year
on Bad Blood
help i'm pissing myself Posted 1 year ago 1 year
on Bad Blood
love love love love love love love Posted 1 year ago 1 year on DOJA CAT // DINDU NUFFIN (MPH Remix) #5K CELEBRATE
super slick Posted 1 year ago 1 year on DOJA CAT // DINDU NUFFIN (MPH Remix) #5K CELEBRATE
cool drum break Posted 1 year ago 1 year
on gets Her High.
beautiful track. tag is spot on Posted 1 year ago 1 year
on Mad Ting Ft. JME these tiny little whiny synths in the background are my s h i t Posted 1 year ago 1 year
on Hybernation
pussy's givin' in Posted 1 year ago 1 year
on Wiley | 'And Again' Ft. God's Gift (Zander Remix) [BUY FOR FREE DL]
g Posted 1 year ago 1 year
on TRU Concept - My Love *Bobby Brush Remix*
oh man. pack the fuckin' pool y'all Posted 1 year ago 1 year on Tiber - Power
tiberrrrr!!!!!! <3 Posted 1 year ago 1 year
on crème fraîche
u r destroyer of worlds Posted 1 year ago 1 year
on D R E A M S w/ Meraki thanks 4 the shoutout <3 haha Posted 1 year ago 1 year
on rang
where tf am i?? Posted 1 year ago 1 year
on you are
delicacy :D Posted 1 year ago 1 year
on Marriage Proposal (Gutta Remix)
stole on em' bruh Posted 1 year ago 1 year on Càbãnå - Done As Dinner
love me some pilerats Posted 1 year ago 1 year
on an explanation (TATFITB2015)
<3<3 Posted 1 year ago 1 year
on Contraband
classic Posted 1 year ago 1 year
on d h a r ā - s w e e t
ice cold Posted 1 year ago 1 year
on Thank you all for 1k <3
160 Posted 1 year ago 1 year
on Thank you all for 1k <3 i just spent four minutes trying to comment on this Posted 1 year ago 1 year
on Thank you all for 1k <3 congratulations man Posted 1 year ago 1 year
on graves & Yoshinobu - hotrine bring
just evil Posted 1 year ago 1 year
on Prace - Get Tight Four
<3 Posted 1 year ago 1 year
on Prace - Get Tight Four
good times Posted 1 year ago 1 year on Garrett Benally - Luv_Music (Remix)
ayeeee bass is mad clean Posted 1 year ago 1 year
on Koolade - Moon Thug
this new blvnt records ish is it Posted 1 year ago 1 year
on Toonorth - Midnight outstanding. this is some revolutionary shit Posted 1 year ago 1 year
on i even miss our bad times
one ticket to saturn please Posted 1 year ago 1 year
on unleVeled (Original)
<3 Posted 1 year ago 1 year
on Ark Patrol - At All (ft. Veronika Redd)
@heroicrecordings: doing my best Posted 1 year ago 1 year
on chocolate milk (feat. R.O.M)
tick tock Posted 1 year ago 1 year
on pure earth (prod. falls)
soft and also warm Posted 1 year ago 1 year
on G Jones & Bleep Bloop- Mind
my earssss Posted 1 year ago 1 year
on Watchu Won
very cool Posted 1 year ago 1 year
on mantis
wet n wonky Posted 1 year ago 1 year
on while u were away
very nice. love the continuous synth Posted 1 year ago 1 year
on TroyBoi - What We Do (feat. BYP)
yeeee Posted 1 year ago 1 year on Gavin Turek - Hemisphere (KRNE Remix)
oh man. this shit is so light! <33 Posted 1 year ago 1 year
on Ark Patrol - At All (ft. Veronika Redd)
100 100 100 Posted 1 year ago 1 year
on It's Just Different
bruh this intro is such fire you don't even understand Posted 1 year ago 1 year
on Lemon Eyes (StéLouse Remix)
my man stelouse killin' it once again Posted 1 year ago 1 year
on La Lune Blanche - James Sheppard
wow <3 Posted 1 year ago 1 year
on divinity
fuck i said Posted 1 year ago 1 year
on things are crazy rn inventive!! this paints a very different picture for me than the usual stuff Posted 1 year ago 1 year
on Twonk Di Nation Tour Mix Vol. 2
oh myyy Posted 1 year ago 1 year
on NEIGHBORHOODWATCH//021
this shit needs more plays tbh Posted 1 year ago 1 year
on The Way You Held Me
:,c Posted 1 year ago 1 year
on Zephyr & Cant Catch Clouds - Fly
too much for me to handle like Posted 1 year ago 1 year
on Zephyr & Cant Catch Clouds - Fly
hot damn these hops are literally death Posted 1 year ago 1 year
on Zephyr & Cant Catch Clouds - Fly
and i mother fucking do Posted 1 year ago 1 year
on Zephyr & Cant Catch Clouds - Fly mighty fine listening material if i do say so myself Posted 1 year ago 1 year on idle hour ft. dawson & kolada
@soulectiongems: ♥（ﾉ´∀`҂ Posted 1 year ago 1 year
on canukeepup
ok boiiii Posted 1 year ago 1 year
on Best Thing (feat. Gavrielle)
these percs make me mouth water Posted 1 year ago 1 year
on In the Dark been a sec since i heard this piece of gold Posted 1 year ago 1 year
on one day
oh dear