Whitewood Becomes a Hot Bed for COVID

• Business Cards • Coroplast Signs • Postcards CALL FOR Local. Professional. Printing. • Flyers • Vinyl Banners • Labels A FREE 1-844-GNG-NEWS (ext. 229) • Brochures • Greeting Cards • Envelopes QUOTE

$150 PER COPY (GST included) www.heraldsun.ca

Publications Mail Agreement No. 40006725

Friday, April 2, 2021 Serving Whitewood, Grenfell, Broadview and surrounding areas • Publishing since 1893 =VS࠮0ZZ\L

COVID-19 testing clinic ELAINE ASHFIELD | GRASSLANDS NEWS Vehicles were lined up for blocks around the Whitewood Community Centre on March 29 as people took part in a drive-up COVID testing clinic. The community has seen a jump in COVID cases which resulted in the Saskatchewan Health Authority issuing a statement urging people from the community to take precautions in preventing COVID. Whitewood becomes a hot bed for COVID Businesses close and nursing home shut to visitors as cases rise in adults and youth By Elaine Ashfield be calling to cancel/reschedule appoint- “Over the past year of COVID-19 in a.m. to 2 p.m. for drop-in testing. Previ- Grasslands News ments. Thank you for understanding.” our midst, we have been fortunate not ous clinics had been held prior to this Kathleen Francis, the local veterinar- to have a huge amount of illness in the date with very low numbers dropping ian, also posted, “As some of you may community and area but unfortunately, in for testing. Whitewood has seen a spike in the know, the vet clinic is closed as I have we are now hearing of a few more cases At this Monday’s testing clinic, vehi- number of positive COVID-19 cases over tested positive for COVID. If you were at that have crept into our area. cles lined up in front of the Whitewood the past week resulting in the Saskatch- the clinic between March 19 - 25 please “This past year, we have all seen the Community Centre from the curling ewan Health Authority (SHA) issuing contact public health for contact info, 14 effects of the pandemic, forcing some re- rink entrance and continued to cir- a public alert for the town on Monday day self isolation or testing. Please take strictions and hardships on businesses cle the whole block where the centre urging people to take precautions and this message seriously as I have never and not only the businesses, but fam- is located, resulting in the last vehicle announcing the closure of the nursing been so sick in my life. Stay safe.” ilies have made some major sacrifices that was parked in line waiting, being home, except for compassionate reasons. Archibald’s Diner have notified as well with not seeing their fami- parked where the first vehicle in line SHA would not confirm how many their customers that they lies or loved ones and living was situated. Reports are that the clinic positive cases there were in the com- will be closed until fur- through the restrictions. lasted more than two hours past the al- munity, instead providing only the ther notice and Lee’s “We just want ev- lotted time due to the large turnout. case numbers for the south east zone 2, Kitchen stated, “We eryone to be aware The statement presented by the SHA which includes Broadview, Cowessess will be closed for and pull together to on Monday about the COVID-19 num- First Nation, Fairlight, Fleming, Ken- dine-in until fur- make the best of a bers in Whitewood was released due to nedy, Kenossee Lake, Kipling, Mary- ther notice due poor situation at the spike of cases that is beyond what field, Moosomin, Rocanville, Wapella, to COVID-19 in present. We are has been usual or normal over the past Wawota, Welwyn and Whitewood, which town. Thanks for close to the end year in the community. The SHA stated has a combined population of 15,366. As understanding. and are starting that there is no set rule of hitting any of Wednesday, the south east zone 2 had Take care.” to see light at the set number before notifications to the 46 active cases with three new cases re- The Town of end of the tunnel public are sent out but it is done by a de- ported while the entire south east zone Whitewood has with vaccines now cision of the medical community when has 139 active cases. A total of 35,996 also notified the being available. there is concern of the rising numbers tests have been performed in the south- community that “This reminds in any set area or community. east zones. due to the increase of me of a hockey say- Saskatchewan Health Authority Phy- While the SHA would not provide COVID-19 virus in the ing – ‘you have to play sician Executive Dr. Kevin Wasko told specifics for Whitewood, there are area, the Whitewood handi the full 60 minutes.’ So the Moosomin World Spectator on Mon- more than a dozen unconfirmed cases van service is not accepting let’s give wholeheartedly, try day, “We don’t have rising numbers reported in the town, including both any bookings for the next two weeks. to contain the virus by wearing your of variants of concern in every single adults and youth. As a result, many The situation will be re-evaluated at masks, social distance, stay home if you community. We do have rising numbers businesses have been forced to close that time to see if services are safe to are feeling ill or observe any symptoms. across rural Southern Saskatchewan in and people went into isolation in their begin again. We don’t want this virus to get any multiple communities, and it is a con- homes. Several people were reportedly Prairie Valley School Division had worse; we don’t want to lose the battle. cern,” he said. also hospitalized. also cancelled all classes in the division Everyone has sacrificed so much in the Wasko leads the Saskatchewan Over the weekend, one local business, effective last week (Thursday) and will past so we don’t want to lose now. Be Health Authority’s Integrated Rural Mon Sherry’s Haircare, posted a notice re-assess opening for Monday, April 12 aware and do your due diligence as we Health team for the southern part of the on social media stating, “We are inform- due to the increased number of cases in are not quite at the finish line. province. ing you that someone who was present various schools. Whitewood School has “If we all give wholeheartedly at this Wasko confirmed that variants of at our location has recently tested posi- 2 cases confirmed by SHA at press time. time, together we can work to contain concern are on the rise in the Moosomin tive for COVID-19. Whitewood mayor Rhett Parks spoke the virus and keep everyone safe.” area, but not to the same extent as in “As a precaution we are temporarily with Grasslands News and shared some A clinic for Drive Up Testing for Whitewood and Moose Jaw, which also closing effective March 29, 2021. We are words of concern and encouragement COVID-19 was held on Mar. 29 at the had a warning from the SHA issued. hoping to reopen April 6, 2021. We will for the community. curling rink scheduled to run from 11 - SEE COVID, 13 2 April 2, 2021 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News Firefighting program gets back to class in July By Emily Jane Fulford be demolished and a new association with the Grasslands News facility was built in its Saskatchewan Public place.” Safety Agency, offers a It wasn’t long after thorough combination Over the past year, the that terrible bout of irony of theory and hands-on Parkland College Fire- that COVID-19 made its skills required for entry fighting Program held debut, throwing most of into a firefighting career. just outside of Melville, the globe into upheaval Part of this training re- Saskatchewan has had a and crisis. The pandemic quirement is set by the terrible run of luck. How- was also responsible for National Fire Protection ever, it looks like things the closure of many ed- Association (NFPA) and are back on track after ucational institutions incorporates practice what was a difficult year across the world, the runs and practical activ- for most of the world. country, and the prov- ities. NFPA 1001 training “On Easter weekend ince. While some pro- provides the basic train- 2019, a fire damaged an grams that focus mostly ing required for many in- under-construction class- on bookwork were able dustrial safety positions room building at Park- to be done online, pro- and is considered to be land College’s Emergency grams that required on- the starting program for Services Training Site, site training, vocational a full-time firefighter ca- east of Melville,” said training, lab work and reer. Class resumes 68%0,77('_*5$66/$1'61(:6 Brendan Wagner, Coor- group projects were not The results of both dinator, Corporate & In- able to continue as per blows to the program )LUHÀJKWLQJFODVVHVDUHVHWWRUHVXPHWKLV-XO\DW3DUNODQG&ROOHJHDIWHUWZR ternal Engagement for the normal routine. in such short succes- GHYDVWDWLQJEORZVOHIWWKHSURJUDPXQDEOHWRRSHUDWHIRUD\HDU Parkland College. “The The 14-week program, sion resulted in the col- charred structure had to which is conducted in lege having little choice but to postpone the last year’s scheduled course and wait out the storm. However, that time has now come and the new classroom is finally up and running again as the program is set to get un- derway in the summer of 2021. “There are 18 students from 10 different communities in Platoon #17,” said Wagner. “They’ll learn the theory and get hands-on training at 7UDLQLQJIDFLOLW\ 68%0,77('_*5$66/$1'61(:6 the Emergency Services Training Site until the 7KHÀUHÀJKWLQJFODVVURRPEXLOGLQJHDVWRI0HOYLOOH end of June. Platoon #18 ZDVUHEXLOWDIWHUDÀUHKDGGDPDJHGWKHÀUVWEXLOG- begins training in late LQJWKDWZDVEHLQJFRQVWUXFWHGLQ July.” If you’ve had an accident, CALL US FIRST!

FITNESS WITH HEATHER PRESENTS

THE BODY SHOP Pick one of FOUR class times! at Celebration Ford Or sign up for multiple classes!

-Tuesdays 10:00-10:40 am, April 13 - May 18 -Tuesdays 6:20-7:00 pm, April 13 - May 18 YOU CAN RELY -Thursdays 10:00-10:40 am, April 15 - May 20 -Thursdays 6:20-7:00 pm, April 15 - May 20 ON OUR SERVICE: One 6-week class for $30! SGI and Manitoba Public Insurance, Accredited! Free on-site estimates Monday thru Friday CLASSES WILL TAKE PLACE OVER ZOOM, AN ONLINE MEETING PLATFORM. ALL YOU NEED TO JOIN IS A Certiﬁ ed to repair ALL MAKES AND MODELS DEVICE WITH INTERNET CONNECTION! Windshield Repair and Replacements OLDER ADULT SCULPT IS A CHAIR-FRIENDLY Walk In Stone chip repair – NO APPOINTMENT NECESSARY! STRENGTH-BASED CLASS. Fleet of Courtesy Vehicles available NO GYM EQUIPMENT REQUIRED.

Spray In Boxliner installations SIGN UP Platinum Ceramic Paint Protection AT MELVILLE.CA OR Stone Shield Protective Film installation CALL 306-728-6860 OR EMAIL Accessory sales and install for all makes and models [email protected]

FOR MORE INFO FROM HEATHER EMAIL CALL OR TEXT: 1-306-435-3313 TOLL FREE: 1-800-880-4533 [email protected] OR Moosomin, SK FOLLOW FITNESS WITH HEATHER - www.celebrationford.com MELVILLE ON FACEBOOK www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 3 Auto body shops forced into new regulations

By Elaine Ashfield when making repairs; payment by SGI was not a difference where to get your money in town if communities). We also had Grasslands News • Engaging in a system of announced. a job. you can and help keep one a number of discussions continuous professional With the loss of the “Hopefully, people will more business operating with the Saskatchewan development through an level of accreditation to continue to use their local in your town at the same Association of Automotive Auto body repair shops internationally accepted some of the auto body auto body for repairs not time,” Wolfe commented. Repairers (SAAR) and the have until July 1, 2021 collision training pro- shops, peo- under SGI Grasslands News re- Saskatchewan Automo- to meet the new mini- gram. ple in those that don’t layed these concerns to bile Dealers Association mum accreditation re- “Tooling and equip- communi- require SGI. Ryan Smith of SGI’s (SADA), which represent quirements or lose their ment standards for ac- ties will high tech responded stating, “It’s auto repairers across the accreditation with Sas- creditation were updated also lose. training. important to remember province. katchewan Government “The current accreditation last in 1991. The current “There All repairs this is about safety. With “We recognize for some Insurance (SGI). accreditation require- will not requirements are no longer through so much new technology this is a significant invest- SGI states that the pri- ments are no longer suf- be any ap- sufficient to repair many of SGI after in vehicles today, we need ment. SGI has done more mary goal of the program ficient to repair many of praisals the July 1 to ensure vehicles are to financially support the changes is to ensure cus- today’s newer vehicles to today’s newer vehicles to done for deadline being repaired safely and auto repair industry than tomers’ vehicles are re- manufacturer standards,” SGI any- manufacturer standards.” will prob- properly to meet national any other insurer, to our paired properly so that Smith commented. where un- - SGI VP Ryan Smith ably go to industry standards. To knowledge. Significant they will provide the same “Simply put, with new, less there the accred- do this, we gave industry incentives were offered level of crash protection more sophisticated vehi- is an ac- ited shops.” plenty of advance notice to partners that made the in the event of a subse- cles and technology, re- credited shop in the com- Wolfe also stated that of these changes, extend- investment to meet new quent collision. pair shops need the right munity,” Wolfe explained. shop owners know enough ing the original deadline criteria.” Auto body shops are tools, equipment, and “This means that any what they can safely fix by a year (to March 1, Grasslands News con- saying they are being training to undertake safe vehicle will have to be and what needs to be writ- 2021) and now again by tacted Broadview Auto- forced into the new regu- and quality auto repairs taken to a community that ten off. It has always been an additional four months body regarding the new lations involving training to return vehicles to their has an accredited shop. that if the repairs are out (to July 1, 2021). We know accreditation regulations and the expense to update pre-collision condition.” Either the vehicle would of their scope, they refer some shops will have to but they preferred not to equipment or they lose While SGI did not pro- be driven there or would the repairs elsewhere to a invest in tools and equip- comment and Redline Col- customers and possibly vide incentives for the need to be towed else- qualified auto body. These ment to be able to con- lision at Grenfell did not their businesses. shops to upgrade to the where for assessment, an new regulations are a tinue to repair collision reply to the request by Grasslands News first requirements, they will expense that would have heavy hit to especially the claims, because they sim- press time. reported on these changes be paying for the software to be paid by SGI or the smaller rural auto body ply don’t have the tools It is not known if Broad- being developed in May system that shops must owner. The shop doing the shops as now they will not and equipment necessary view Autobody will work of 2019 and SGI extended use for estimates for SGI, estimate does not get paid see even the smallest of to fix an increasing por- towards accreditation the deadline to March 1, which previously was the for the estimate so un- repairs as only the shops tion of vehicles involved while it is unconfirmed by 2021 and recently to July responsibility of the busi- doubtedly would want to spending the funds to up- in claims. Redline Collision but be- 1, 2021 to give shops more ness. keep the vehicle there for date to the new accredi- “This is not just a Sas- lieved that they have been time to complete the re- Grasslands News con- repairs and the owner will tation levels will receive katchewan issue. Vehicles working towards the new quired training. tacted Ken Wolfe of Dorel probably not want to pay the majority of vehicle have changed significantly accreditation. “COVID-19 restrictions Auto Body at Whitewood, the expense to have the repairs. in 30 years. The status As for Dorel Auto Body impacted the availability and he stated that his cost vehicle towed or driven With the expectation quo is not an option. This in Whitewood, owner Ken of in-person training last for the program runs at elsewhere for repairs. there will be a loss of the change is essential in the Wolfe stated the pressure year, so SGI extended the over $700/month at pres- “SGI pays for the tow- auto body shops in the interest of safety; indus- of these new regulations deadline to give repair ent. ing of vehicles that are smaller communities due try, manufacturers and has led to some businesses shops the time they need “It would have helped towed and written off to the changes in the gov- customers demand it. giving up. to meet all requirements, to know this sooner (that during the assessment but ernment regulations for “SGI consulted exten- “We will probably con- which must be met by July SGI would be paying for if they are deemed repair- accreditation, it will be sively with the industry on tinue to operate at Dorel 1 to maintain their accred- the system after the new able, SGI does not pay for important after July 1st these changes. We gained until we find it is not via- itation,” Ryan Smith, SGI regulations are imple- the towing,” Wolfe also for people to speak with feedback from repair ble any more. We can still Vice President, SK Claims mented) as that was a explained. their local shops as they shops across the province do windshield repair or and Salvage Operations large factor in deciding “All of these new reg- may still be able to help at town hall meetings (14 other jobs not covered by confirmed with Grass- what would be affordable ulations will cut our do your repairs. “Keep town halls in 12 different SGI.” lands News. and what we would con- business down and our in- “Improvements in ve- sider as a viable business comes result in being cut hicle automation and fuel to continue investing in,” in half or more. Also, all efficiency have resulted in 21041PS0 Wolfe stated. Initially this this (training) will make significant advancements in vehicle construction and driver safety technologies, impacting the auto 21041SS1 repair industry worldwide. SGI is amending the requirements for SGI accreditation to match the minimum training, tools and equipment needed to safely and properly repair customers’ vehicles, as traditional repair tech- niques and tools are no longer sufficient to repair many of today’s newer vehicles to adequate safety standards.” The upgrade in equipment could be costly to some autobody shops as it would require things such as, for example, enhanced welding equipment that utilizes 3 phase power to be installed. SGI confirmed that in order to be accredited by SGI, repair shops must meet minimum equipment and training requirements, which includes: • Having the tools, training and equipment needed to repair a majority of cus- tomer vehicles safely and properly, including equip- ping themselves with welding equipment capa- ble of properly joining the high-strength steels used in the construction of today’s vehicles. • Follow the vehicle manufacturer repair procedures and recommendations 4 April 2, 2021 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News $6.1 million for local infrastructure and rec. projects Cowessess First Nation, Balcarres and Indian Head benefit

By Chris Ashfield owned by Cowessess First Nation south- to help build a new outdoor swimming McKenna, Minister of Infrastructure Grasslands News east of Regina is one of two solar energy pool with lap pool, leisure pool, water- and Communities. “The funding an- projects receiving $3.4 million in fund- slide feature and beach entry area. The nounced today will help communities ing, split evenly between the federal $1.762 million project will see $704,813 build back better, create jobs, and build Canadians everywhere have felt the and provincial governments. The money funded by the federal government, cleaner, more inclusive communities.” impact of COVID-19 on their families, will help supply clean energy directly to $587,285 funded by the provincial gov- “The Government of Saskatchewan their livelihoods, and their way of life. the Saskatchewan electrical grid. Sask- ernment and $469,94 by the municipal is investing more than $22.7 million to- Canada and Saskatchewan have worked Power is also set to implement a battery government. ward these important projects, which together to ensure health and safety, energy storage project that will help to “From swimming pools to solar will improve recreational facilities, support families and businesses, and balance the power system during power projects, the Government of Canada is upgrade water systems, support renew- sustain local economies. Investments in demand spikes and support intermittent taking actions to support families, busi- able energy and help protect the envi- Saskatchewan’s infrastructure during generation options such as wind and nesses, and the economy in Saskatch- ronment,” Saskatchewan’s Government this extraordinary time provide an op- solar. ewan and across the country now, so Relations Minister Don McMorris said. portunity to make communities more “Cowessess First Nation strives to that we can build resilient communities “It is infrastructure that will help build sustainable and resilient in the long be an economic self-sustaining part- for years to come,” said Jim Carr, the better communities, create jobs, and im- run, and to further develop our renew- ner in the growth of the province and Prime Minister’s Special Representative prove quality of life for those who call able energy resources. country,” Cowessess First Nation Chief for the Prairies, on behalf of Catherine this great province home.” On March 31 it was announced that Cadmus Delorme said. “This goal be- residents of several Saskatchewan com- comes a reality when the plan includes munities will benefit from recreational investment from the government. As the facility upgrades, improved water and Truth and Reconciliation calls to action wastewater infrastructure, and clean provide us all direction to bridge the energy projects. Funding through the gap, Cowessess First Nation will help Investing in Canada plan will support this province and country in renewable 24 infrastructure projects in Saskatche- energy to assure our seven generations wan, with the Government of Canada in- ahead may have a sustainable place to vesting more than $31.1 million in these call home.” Spring projects and the Government of Sas- Balcarres is one of 17 Saskatche- katchewan providing over $22.7 million. wan communities that is receiving an Contributions by municipal govern- investment in water and wastewater ments toward their respective projects infrastructure that will improve capac- are more than $7.2 million. In total, this ity to meet current and future demand represents a combined infrastructure while ensuring continued compliance investment of more than $61 million. with provincial and federal regulations. Funding recipients are responsible for The town will construct two new wells any additional project costs. and replace the raw water pipeline. at Included in the projects announced Estimated to cost $980,000, the federal are investments in a recreational proj- government will provide $392,000, the ect in Indian Head and water and clean provincial government $326,634 and the energy projects in Balcarres and Cow- municipal government $261,366 for the AVALON ACRES essess First Nation worth a combined project. Fresh wildflower honey. Available in various sizes. Sports and arthritis pain relief. $6.1 million. Indian Head will also benefit from the AVON Avon products of all kinds: bubble bath, The Awasis Solar Project on land Investing in Canada plan with funding Water colour paintings. perfume, creams, all your favourites. BACKWOOD TRANSFERS ROOKIES FOOD SERVICE Assorted Bison meat products: burger, sausage DESIGN CO. and jerky. A selection of handcrafted earrings. ROSIE’S CRAFTS Manitoba Hydro set to market BERESINA BEES Handmade Tree of Life Hangers and necklaces., Natural, minimally processed honey. night lights and home decor. Available in various sizes. RUBY JAE BOUTIQUE BR HONEY Bath bombs, home decor. Flavoured honey and honey sticks. power to SaskPower by 2022 SANITY BY STITCHES Һ Headbands, touques. By Elaine Ashfield green hydroelectric power to Saskatche- Vacuum bags andfilters. wan is hopefully the start of many more Grasslands News CALEIGHS CRYSTALS Local producer of eggs, flax & wheat for baking or sales of electricity by Manitoba Hydro. Crystal jewelery. cooking, wheat bags for muscle discomfort. The section of the new transmission A new $70-million transmission line CHICKADEE WOODWORKS SUSAN HARRIS line that travels into Saskatchewan is Live edge wood sign decor. Carved and has been completed from the Birtle Local author who lives in the Melville area. Adult and supported by SaskPower and has been handpainted. Custom orders available. children’s books including: “Touched by Eternity”. South Hydro Station to the Manito- connected to the ba-Saskatchewan station in Tanta- Custom made mats. SWAGG CLOTHING border so that en- Men’s and women’s sports wear. llon, SK. Made for home or commercial use. ergy surplus can a Action to start CR TRENZ SWEET SAYINGS be sold to Sask- the transmission Stamped jewerly. Ladies, men’s and children clothing lines. Power from Man- line will take itoba. DAVE’S WOODWORKING place after needed Handcrafted jewelery. The 230-kilo- site cleanup and Handcrafted wooden vehicles, jewelry boxes. volt connection minor construc- Toys and more, mini figurines. was constructed tion oversights Variety of handmade goat soaps. from October to are resolved. En- Z mid-March and ergy supply is Homemade jellies available in small jars or gift packs. Assorted handcrafted driftwood decor, gift ware and as Greg Nesbitt, set to flow into furniture. Great for the cabin, office or home. MLA for Riding Saskatchewan by Wreaths, wall hangings, purses, scarves. TIBER RIVER Mountain in Manitoba stated in South 2022. FAY’S FROSTY FASHION Personal care products. Eco friendly home, bath, body Mountain Press’ weekly edition, “This Following a $180 billion plan ‘Invest- and spa products, just for you. Hats and mittens. line will provide Manitoba Hydro with ing in Canada’, Manitoba has been able TWISTED SISTER DESIGNS another revenue stream for years to to initiate projects throughout the prov- HANNAHRAE KEY CHAINS Elastic silicon key chains. 2-Ply face masks, ear savers, wallets come.” ince to modernize and develop infra- and dream catchers. Nesbitt added that this sale of clean, structure for a greener tomorrow. Author of “An Exodus to a Land of Promise”. UNIQUE IN BEADS Beaded Swarovski jewelery. LIPSENSE / SENEGENCE Assorted lip, cosmetics and body care products. UP CYCLE IT JANES If you can think it... we can print it! Large variety of wears. Clothing, mittens, neck warmers, masks, handbags and more. From business cards and flyers to banners to coloplast signs, Grasslands News Group Hand designed decor and clothing. is your one-stop commercial printing centre. Give us a call today for a FREE quote! Һ Large selection of your favourite Watkins products. Toll Free: 1-844-GNG-NEWS Giftware and outdoor decor for any season. YOUR TWISTER SISTER’S (Press ext. 229) Z Email: [email protected] Premium scented natural wax candles. Assorted scents. Handcrafted chainmaille jewlery. NORWEX Enviro-friendly products for home cleaning Unique Items and personal care. For Everyone! Located in the Melville Advance OPEN: Monday to Friday 9 a.m. to Noon and 1 to 4:30 p.m. 218 - 3rd Ave. W., Melville, SK www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 5 Essential travel recommended to Regina area

By Alan Hustak variants in all of Canada is gradually in- Grasslands News creasing, with the exception of the Mari- times, we are going to see an increase in transmissibility and presumably going People who have friends and rela- to see an increased number of people tives in Regina are being asked to stay being admitted to hospital because these away from the city during the long hol- variants do tend to cause a more severe iday weekend and to avoid Easter and illness as well. Passover family gatherings this week and Ramadan gatherings next week. “We didn’t see this proportion of The capital has been inexplicably hit young, otherwise healthy individuals with a marked rise in cases of COVID- back in the first and second waves. 19 and by a wave of new variants of the Virually all the cases we see now are virus which are causing more serious caused by variants. There is a lot of infections. angst among health care workers.” Ten people died last week of COVID, Electronic signs posted along high- eight of them in Regina. As of Wednes- ways leading into Regina advise mo- day, March 31 Saskatchewan has re- torists to avoid driving into the Regina Travel restrictions urged $/$1+867$._*5$66/$1'61(:6 corded 1,955 active cases, the highest zone which includes communities such People are being asked to only travel to and from the Regina area as nec- as Belle Plaine, Pense, Grand Coulee, since last February. More than half of essary with the current increase of COVID-19. Currently Regina and area is Lumsden Beach, Regina Beach, Craven, those cases are in the Regina area. reporting over half of the total active cases in Saskatchewan. “It is a different demographic. We are Lumsden, Edenwold, Pilot Butte, Emer- now seeing otherwise young, healthy in- ald Park, White City, Balgonie, Kronau, dividuals with COVID. All of the cases Davin, Gray and Riceton. we’ve seen in Regina this month are An exception has been made for pa- APAS annual meeting held virtually caused by variants. Cases are up among tients who have medical appointments people anywhere from their mid to late in Regina. In a media release the Health 20’s up essentially through their ‘30s Authority says travel for compassionate By Chris Ashfield year term. They are Steven Donald of and ‘40s, with no pre-existing medical reasons is necessary. “It is safe to at- Grasslands News the RM of Martin #122 (District 1), Todd conditions and they are crazy sick,” tend medical appointments, but advises Lewis of the RM of Lajord #128 and Bev said Regina infectious disease specialist against making other stops or visits in Pirio of RM of Laurier #38 (District 2), A farmer from the RM of Martin has Dr. Alex Wong. “As the proportion of the city.” Don Connick of the RM of Carmichael been elected to the board of directors for #109 (District 3), Ian Boxall of the RM the Agricultural Producers Association of Connaught #457 (District 4) and Scott LANDFILL of Saskatchewan (APAS). Owens of the RM of Eldon #471 (Dis- APAS held its 2021 Annual General trict 6). There is also one position to be )25748·$33(//( Meeting virtually on March 30 during elected in District 5. That election will :,17(5+2856 which the APAS Board of Directors re- take place in April. • November 1 to April 30 • elected Todd Lewis, representative for Six resolutions were considered Monday to Friday RM of Lajord #128, as President for 2021. and passed during the virtual Annual 9:00 a.m. - 4:00 p.m. A farmer from Grey, Lewis was first General Meeting. Delegates approved a Saturday 9:00 a.m. - 1:00 p.m. elected to the position at the end of 2016. motion calling for the rejection of the Closed Sunday and Statutory Holidays Ian Boxall of Tisdale and Bill Prybylski Grains code of practice and adopted Minimum Load Charge is $10 of Willowbrook were re-elected as Vice We now Accept: 43 recommendations developed by the Presidents. APAS Rural Connectivity Task Force APAS representatives also elected six on internet and cell service. directors to the APAS board for a two- Town of Fort Qu’Appelle 136 Boundary Ave. S. - P.O. Box 309 S0G 1S0 Phone: 306-332-5266 Email: [email protected] Website: www.fortquappelle.com Council Comment Council Meeting With the province’s COVID-19 vaccination program now under The next Town of Fort Qu’Appelle Council meetings will be held way, please consider getting vaccinated as soon as possible. Help on: Thursday, April 8, and Thursday, April 22 at 7:00 p.m. protect yourself and members of our community. Stay safe and look forward to spring and a brighter future! Assessment Roll Notice The Assessment Roll for the Town of Fort Qu’Appelle for 2021 has Elm Tree Trimming EHHQSUHSDUHGDQGLVRSHQWRLQVSHFWLRQLQWKHRI¿FHRIWKHDVVHVVRU From April 1 to August 31, pruning elm trees is prohibited as the from 8 a.m. to 4 p.m., Monday to Friday by appointment only. fresh cuts can attract the Elm Bark Beetle increasing the chance of a Dutch Elm Disease infection. The insects spread the disease and Gopher Baiting are most active during the spring and summer. The Town will be placing gopher bait out in the hope of reducing the number of gophers in Town this year. The product being used is Transit Van Operating called Rozol Pocket Gopher Bait. For full details about this product, The Transit Van began operating again on Monday, Feb. 1, 2021. please go to the Town’s website, www.fortquappelle.com . Please see the Fort Qu’Appelle website or Facebook page for Rules and Procedures. New Transit Van Fares Upcoming Recycling Dates In Town One Way $5.00 Upcoming recycling dates are slated for April 27 and 28. Second Stops (per stop) $2.00 Out of Town Less than 25 kms $10.00 from Fort Qu’Appelle, Plus 75¢ per km Out of Town More than 25 kms $20.00 Contact Information from Fort Qu’Appelle, Plus 75¢ per km To ensure you receive all Town correspondence, please make Plus $30.00 per hour sure you provide your correct contact information (phone, email, and Minimum 150 km charge wait time PDLOLQJDGGUHVV WRWKH0XQLFLSDO2I¿FH 6 April 2, 2021 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News

“For the cause that needs assistance; for the wrong that needs resistance; the future in the distance and the good that we can do.” O’Toole is losing ground; where is Scheer?

Political conventions normally give a boost to a According to the most recent opinion polls, the Even some members of his caucus are now grum- party’s popularity, but following the recent Conser- Conservatives could lose as many as eight of their 48 bling about his leadership. Climate change is real, vative convention, it is hard to tell where opposition seats in their prairie stronghold – four in Saskatche- but delegates to the convention don’t want it included leader Erin O’Toole is leading his party or whether wan (three to the NDP - in Regina Saskatoon and the in the party’s election platform or acknowledge that anyone apart from die-hard, right wing conservatives far north - and one in Regina to the Liberals,) and the transition away from fossil fuel dependency has are prepared to follow him. four in Alberta ( two to the Liberals in Calgary and begun. O’Toole called for change. two to the NDP in Edmonton.) Even worse, only 20 Being in opposition requires constructive opposi- He told the convention that he wants to address per cent of Canadians have a favourable impression tion, something that the Bloc Quebecois leader Gilles policies in a new way, and communicate conserva- of O’Toole compared to a 37 per cent approval rating Duceppe understood when he was leader of Her tive principles in a new way, and wants to make sure for Justin Trudeau and 34 per cent for Jagmet Singh. Majesty’s Opposition in 1997. There has been plenty he communicates those conservative principles in No one expects the Conservative party to adopt of opportunity for O’Toole to exploit the governing new ways to new people. Liberal policies. But it won’t be a contender if it con- party’s shortcomings, especially its fiscal and ethi- Which conservative principles does he wish to tinues to spout Regressive-Conservative ideas. At the cal failings, income inequality, its equalization and change, and in what ways? He didn’t say. It is far moment the party appears to be a rural, right wing, health care policies, especially the confusion that has from certain that the membership wants change. movement made up of dyed-in-the-wool social conser- resulted from vaccine delays. In spite of Trudeau’s There has been no uptick for O’Toole or the Con- vatives, libertarians, and dogmatic Christians with failings, critics acknowledge that the pandemic has servatives in the polls following the virtual conven- an agenda supported with meaningless buzz phrases. forced the prime minister to mature. He is no longer tion. The more O’Toole attempts to accomodate the hard the featherbrain he was during his first term in of- They now trail the Liberals by 7 to 10 points; 28 to core, the more he scares the voters in urban centres fice. 30 per cent does not win elections. away. Every poll since he became leader has shown Andrew Scheer was often compared to being some- While Trudeau would be foolish to call a threatend the Tories in a worsening position, worse than they thing of a Howdy Doody character because of his al- snap election, the Conservatives would have the most have been for decades. Brian Mulroney was able to ways cheerful good nature. O’Toole is shaping up to to lose. O’Toole would do much worse than former build a governing party with his steely charm; Ste- be another character from the same television show: leader Andrew Scheer who collected more votes than phen Harper was respected as a cold-blooded strate- Flub a Dub. the Liberals in the last election and reduced Trudeau gist who survived two minority governments before He will have to raise his game or his national pro- to a minority government. One has to wonder why winning his majority. O’Toole remains an enigma to file, or the conservatives will be looking for another the party didn’t allow Scheer enough time to build on most voters, especially to those in the conservative leader sooner than they expected. his strengths but dumped him as opposition leader heart land. Can anyone remember the last time he’s Is Andrew Scheer still available? after only three years. been in Saskatchewan to court voters? - Alan Hustak Sask. Party gov’t must rise to challenges Murray Mandryk Rather than change and evolve, Political columnist the NDP has maintained its philosophies. In fact, under the leadership of current leader Ryan Meili, they If you are continually losing bat- seem even more firmly entrenched tles in politics, maybe you are pick- in a left-wing perspective rural and ing the wrong fights. much of what the rest of Saskatche- Or at least, maybe you are pick- wan has long-ago abandoned. ing the wrong approach. This is a cautionary tale for any Those of you who follow Sas- political movement … perhaps even katchewan politics will recognize the Saskatchewan Party. how this has done in the NDP. Let us be clear that it’s unlikely For decades, the NDP (and its the same fate awaits the Sask. Party forerunner, the Co-operative Com- juggernaut … at least, not any time monwealth Federation) was the soon. natural governing party in this However, there was a time not so province for three basic reasons. very long ago when many assumed First, coming out of the Great this could never happen to the NDP, Depression and the Second World either. War, a destitute rural-based Sas- But the NDP slowly began losing katchewan was more inclined to some battles, even when it seemed to follow the law and do something. It seems 19 — especially, the spread of new variants accept its social-democratic philos- to be on the right side of some is- ill-prepared to do so. from Regina to other parts of the province. ophy bolstered by the co-operative sues like the fight over the National What Moe offered as an alternative — at- This, too, may not be an issue of the Sask. movement. Energy Program. the-pump rebates similar modeled after what Party government’s own making. But all gov- Second, NDP governments did That scenario might sound a New Brunswick — was something the Sask. ernments are judged on how they do handle find ways to, in later years, ad- bit familiar today as Premier Scott Party said was unworkable when it was in- a crisis and that usually means having to be just philosophies just enough to Moe’s government is also now los- troduced in that province more than a year smart and nimble. maintain a big tent that could ac- ing battles with the federal govern- ago. Being popular isn’t enough in the long commodate the more free-enter- ment. What shouldn’t be lost in this conversation run. prise-minded. Of course, losing the carbon tax is that the reason Saskatchewan lost in the When the Grant Devine PCs came to power And, third, Liberals and the Pro- fight before the Supreme Court of courts (it also lost at the local federal Court in 1982 with the biggest majority in the prov- gressive Conservatives in this prov- Canada isn’t exactly hurting the of Appeal level) is the courts’ recognition ince’s history, many thought it would last ince usually split the right-of-centre Sask. Party government’s popular- that man-made global warning is a reality. forever. vote at election time. ity. The tax is rightly seen for what To not offer something — to not compro- But then it began losing fight … Then along came the merger of it is — something unlikely to re- mise at least a little until legally forced to do In less than a decade, the PC government the provincial Liberals and PCs duce greenhouse gas (GHG) emis- — is to be too rigid. became massively unpopular because of its in the late 1990s into the new Sas- sions. It just hasn’t proven to be And being too rigid in its beliefs and ap- daily handling of issues and its rigid ap- katchewan Party – a home for busi- effective policy. proach is becoming a familiar Sask. Party proach to things like privatization. ness and rural people that long felt That said, the provincial govern- government pattern. Governments can only afford to lose so abandoned by the NDP. ment is now burdened with having Consider its slowness to react to COVID- many fights.

SUBSCRIPTION RATES: All subscription expire Dec. 31. Pick-Up Boxes: Prices shown are based on one full year. $37.80 per year Subsciptions will be pro-rated. Mailed in Saskatchewan: Melville Advance, Whitewood Grenfell Herald Sun, Fort Qu’Appelle Times Chris Ashﬁ eld Tammy Oryschak Michelle Walz Lloyd Schmidt Pat Gattinger Prices include GST. Publisher Accounts Advertising Production Classiﬁ eds $50.40 per year Issued Fridays by Grasslands News Group from the office Make cheques payable to Grasslands News Group at 218 - 3rd Ave. West, P.O. Box 1420 Melville, SK., S0A 2P0 Send e-transfers to [email protected] Mailed in Canada: Ph: 306-728-5448 • Fax 306-728-4004 • Whitewood: 306-735-2230 $70.00 per year

Toll Free: 1-844-GNG-NEWS Electronic Edition: www.grasslandsnews.ca • [email protected] $37.80 per year

Wendy Krobath Emily Fulford Elaine Ashﬁ eld Sarah Pacio Alan Hustak © Copyright (c) News and advertising content of this newspaper are protected by copyright. Ofﬁ ce Assistant Melville Whitewood Grenfell Fort Qu’Appelle 2020 There may be no reproduction of content without permission of the publisher. www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 7 Survey illustrates the effect of today’s social media

By Sarah Pacio could be harmful and youth emotions as a result of using Grasslands News should exercise particular social media. caution. Decreased physical activ- A Canadian Internet Use ity and feelings of frustration Interacting with social Survey was conducted from or anger did not vary signifi- media platforms has become November 2018 to March 2019 cantly across the different a normal part of life for many and gathered information age groups. However, youth people in today’s society. It from nearly 14,000 Canadians. seemed to be particularly at enables companies to reach It served as the basis for a risk for other harmful im- a broader clientele and keeps study titled, “Canadians’ as- pacts, which could be linked families connected across sessment of social media in vast geographical distances. to their higher usage rate of their lives,” that was released social networking accounts. However, certain impacts of on March 24, 2021. Social social media use have become According to the Stats Can- media was defined as “digital ada study, more than 90 per a topic of concern over the platforms that allow users to last few years. cent of Canadians age 15 to create and share content (e.g., 34 regularly use social media, A documentary released text-based posts, photos and by Netflix in 2020 called, “The and over 50 per cent of partic- videos) and online profiles, ipants age 15 to 24 used three Social Dilemma” featured tes- and to interact with other or more platforms. This was timonials from key figures users.” It includes platforms compared to only 68 per cent in the technology industry such as Facebook, Instagram, of people in the age 50 to 64 who highlighted dangers as- YouTube, and others. range who regularly use so- sociated with various online The report focused solely cial media. platforms. A similar study on the negative effects of so- Nearly half of youth age 15 conducted in 2018 by Insigh- cial media usage, assessing trix, a Saskatchewan-based its impact on individual’s to 19 reported lost sleep asso- research firm, revealed that sleep, physical activity and ciated with social media use. one third of the people sur- emotions. Feelings of anxiety, Another common problem veyed felt that other peoples’ depression, and envy were was negative emotions relat- behaviour on social media particularly noted. Similar ing to social media use; this had negatively impacted research has previously been was particularly true among their lives. Fifty-five per cent done regarding social media individuals age 15 to 24. of them had seen other peo- impact on youth, but this “Overall, age and inten- ple harassed and 21 per cent study included participants sity of social media use are had personally experienced age 15 to 64. strong themes,” the report harassment on social media, Nineteen percent of all concluded. “The relatively leading 34 per cent to con- those surveyed reported they high incidence of lost sleep sider discontinuing social had lost sleep, 22 per cent had and trouble concentrating media use. exercised less, and 18 per cent among individuals under Data released by Statistics had difficulty concentrating age 25 stands out, as do re- Canada last week supports because of social media use. ports of anxiety or depression these indications that wide- Twelve to fourteen percent re- and envy among individuals spread social media usage ported that they felt negative under age 35.”

R We make it f¥f f PRINTING 8!99£!2&9'>9 83<6 '1!0'-;EASY;368-2;!££@3<8683/'$;9W $32;!$;|+8!99£!2&92'>9W$!

Directory

Fisher & Schmidt Miller Moar Grodecki Kreklewich & Chorney CHARTERED PROFESSIONAL ACCOUNTANTS – www.millerandco.ca /DZ2IÀFH MELVILLE OFFICE – 306-728-4525 FORT QU’APPELLE OFFICE – 306-332-6651 128 - 4th Ave. East, Melville, SK 32&!@;3 8-&!@¥V!W1W;3V6W1WTf8&='W W '&2'9&!@V!W1W;3332T316!2@='WW !=-&W 83&'$0-TT-2!ħ'2&!2$' &0LFKDHO)LVKHU4٘ ESTERHAZY OFFICE – 306-745-6611 INDIAN HEAD OFFICE – 306-695-2303 8!2&='W '&2'9&!@V6W1W;3V6W1W, 8-&!@¥V!W1W;3V6W1WT!-2;W +RQV 32&!@;3 DUQHW)LVKHU%$* ٘ //%&ROODERUDWLYH/DZ\HU GRENFELL OFFICE – 306-697-3558 !=-&W 83&'$0-TT-2!ħ'2&!2$' 32&!@;3 8-&!@¥V!W1W;3V6W1WT¤'9132&;W BALCARRES OFFICE – 306-334-2923

'$'&2'9&!@V!W1W;3V6W1WT!£$!88'93>2ă -2!ħ'2&!2$' UDQW6FKPLGW//% !88@W-££'8TTT* ٘ Wednesday and Thursday £!-8W!2!'9''£'TTT-2!ħ'2&!2$' Michael Fisher & Garnet Fisher Grant Schmidt 306-728-4581 306-728-5481 WHITEWOOD OFFICE – 306-735-2385 ITUNA OFFICE – 306-795-3190 <'9&!@;3 8-&!@V!W1W;3V6W1WT!£32&';W Melville and Esterhazy Melville <'9&!@V!W1W;3V6W1WT3( ;<2!ă$' !8@W8'0£'>-$,TTT-2!ħ'2&!2$' )9,'8£!>|9!90;'£W2'; 93£!>|9!90;'£W2'; !=-&W,382'@TT-2!ħ'2&!2$',<89&!@ ;!8ধ2+!; GARY MOORE LL.B. Balcarres $10*/week Barrister, Solicitor, Notary Public Agencies Ltd. Box 610, 616 Main St., Phone 306-332-4666 1-800-563-4608 Broadview, SK S0G 0K0 Off ering a wide selection of products and expertise 122 Company Ave. S., Fort Qu’Appelle, SK *Must be prepaid, plus 0RQGD\)ULGD\DIWHUKRXUVE\DSSRLQWPHQW • Personal Insurance • Commercial Insurance For all your Insurance needs! • Specialty Products • Agri-Business GST, based on 12 SUB-OFFICE: Representing: • SGI Canada • Wawanesa • SMI • Wynward Insurance Company :KLWHZRRG7KXUVGD\DIWHUQRRQ 216 Main St. Balcarres, SK • Germania Mutual • Aviva • Oasis • Intact 132;,9!&='8ধ9-2+W )ODWODQG3OXPELQJ%XLOGLQJ Phone: 306-334-2401 Fax: 306-334-2705 • HUB Life and Financial Services $480 plus GST Email: [email protected] • Portage Mutual • Group Medical Services CALL FOR APPOINTMENTS: • Red River Mutual and Many More. www.balcarresagencies.saskbrokers.com • Saskatchewan Blue Cross 306-696-2454 or 306-696-6704 • SGI Motor License Issuer GRASSLANDS BOCK & COMPANY NEWS GROUP DIRECTORY LAW OFFICE PATTY WELCH LYNNETTE BOCK, B.A., J.D. Publishers of the Melville Advance, &RQVXOWDQW ADVERTISING Fort Qu’Appelle Times and the Phone: (306) 728-4998 0DSOH6WUHHW32%R[ $ ,-;'>33& 8'2('££ '8!£&<2 WK$YH(DVW0HOYLOOH for only 10* / week (VWHUKD]\6.6$; EDFNGRRUHQWUDQFH 0XVWEHSUHSDLGSOXV*67 3DWW\:HOFK#,*FD PHONE: (306) 745-3952 5HJXODUUDWHLVSOXV*67SHU\HDU Time... to think about keeping the family dream home, FAX: (306) 745-6119 1-844-464-6397 no matter what 7UDGLWLRQDOPRUWJDJHOLIHLQVXUDQFHLVGHVLJQHGVSHFLÀFDOO\WRUHWLUHRQO\WKHEDODQFH Grasslands News Group (PDLOERFNODZ#VDVNWHOQHW Ext. 230 RZLQJWRWKHPRUWJDJHOHQGHULIVRPHWKLQJKDSSHQVWR\RX,QYHVWRUV*URXSFDQVKRZ \RXKRZDQLQGLYLGXDOSODQWKDWSXWV\RXLQFRQWUROFDQKHOSHQVXUHWKDWLQWKHHYHQW %UDQFK2IÀFH GHDWKGLVDELOLW\RUFULWLFDOLOOQHVV\RXUIDPLO\FDQVWLOOOLYHLQWKHLUKRPH 1-844-464-6397 /HWXVVKRZ\RXKRZEXLOGLQJLQVXUDQFHLQWR\RXUSODQFDQSUHVHUYHÀQDQFLDOVHFXULW\ Rocanvile, Friday Afternoons !&9|+8!99£!2&92'>9W$! 7UDGHPDUNVRZQHGE\,*0)LQDQFLDO,QFDQGOLFHQVHGWRLWVVXEVLGLDU\FRUSRUDWLRQV ext 230 Phone: (306) 645-4552 8 April 2, 2021 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News Canadian Taxpayers Federation calls for MP salary increase freeze

By Elaine Ashfield circulated a petition stating “Millions Grasslands News of Canadians have lost their jobs and By Patricia Hanbidge lost income as a result of the corona- virus crisis. All Canadians are making Members of Parliament were to re- sacrifices as we go through this crisis Snow Mold ceive their yearly wage increase on together. Government must do its part. April 1st, a move that is being highly When we go into winter with a heavy The greatest damage will be in the And elected officials need to lead the criticized as an unpopular move that snowfall before the ground is fully frozen, more shaded damp areas where the snow way. we expect to see more snow mold in the ;!0'9!£-ħ£'£32+'8;31'£;!>!@W,-9 should have been stopped during the “Accordingly, we the undersigned '!8£@968-2+W23>13£&-9!(<2+!£$32&-f year, due to the heavy snow cover the COVID-19 struggles that many are suf- call on you to reduce the salary of Mem- ধ32;,!;!ø'$;9£!>238;<8(!8'!9-2'!8£@ snow mold will likely be especially bad. fering. spring and appears in the early spring bers of Parliament.” ,'(<2+-!8'!#£';3+83>!;;'16'8!f Legislation was passed in 2005 mak- >,-£';,'923>-91'£ধ2+!2&;,'9<8(!$' tures right around the freezing point but “MPs should know that a pandemic ing it that salaries paid to MPs and sen- temperature of the ground approaches 0 the spores will survive over the summer and severe economic downturn is the C. This fungal issue is tough on the lawn and are easily spread through mowing or ators would automatically increase on worst possible time to be padding their #<;!£93#!&2'>9(38!££'8+@9<ø'8'89W (33;;8!ă$W ;>-££23;<9!@9!&-8;@ধ1'g '2ধ8';<8(!8'!9#<;-;1!@;!0'139;3( made to depoliticize the parliamentary Terrazzano, the CTF’s Alberta Director >-;,£3;93(&<9;#£3>-2+!83<2&!2&'9f ;,'9<11'8(38!ø'$;'&;<8(;38'$3='8W pay debated each year. pecially this year we expect to also enjoy You can reduce the amount of snow (quote from the Post Millenial). The increase is based on the average lots of mold spores. Itchy watery eyes and mold that occurs by ensuring you do not “Millions of Canadians have been respiratory symptoms in early spring are increase negotiated by major bargain- 3='8('8ধ£-A'@3<8£!>2£!;'8-2;,'9<1f struggling with COVID-19 for more than 3đ'2-28'96329';3923>13£&323<8 mer. High levels of nitrogen make plant ing units in the private sector and MPs a year now, so it’s long past time for our £!>2!8'!9W (@3<,!='9'29-ধ=-;@;3 ধ99<'93đ!2&9<$$<£'2;!2&138'9<9f could see raises up to $6,400. MPs to get off their butts and put an end 9638'9T;,'2!93<8$3££'$ধ323(923>-9 $'6ধ#£';3-2/<8@W9-2+!9£3>8'£'!9' A MP makes a basic salary of $182,600 disappearing and all you want to do is go ('8ধ£-A'8-9+'2'8!££@!#'ħ'8-&'!;,!2! to their automatic pay increases. and Ministers receive $269,800. The 3<;9-&'T@3<1!@2''&;3;!0'931'68'f 7<-$0f8'£'!9'('8ধ£-A'8£!;'-2;,'9'!932W “This shouldn’t be rocket science: prime minister receives $365,200 annu- $!<ধ329W,'9638'9>,-$,!8';,'ধ2@ ;-9!£93-1638;!2;;3$32ধ2<';313> our MPs should be able to figure out 8'683&<$ধ='6!8ধ$£'93((<2+-c13£&9$!2 ;,'£!>2<2ধ£!££+83>;,,!99;366'&!2& ally according to the Canadian Taxpay- a way to stop the automatic pay hikes cause more problems than pollen as they to clean up leaves that have dropped on ers Federation (CTF). Members may during a severe economic downturn,” !8'91!££'86!8ধ$£'9!2&$!2+';&''6 lawn areas. Reduce excess thatch by also receive additional salaries in right into the lungs. said Terrazzano. “This second MP pay 13>-2+$388'$;£@T!'8!ধ2+!2&63>'8 of other offices they hold (for instance, Not only does snow mold make allergy 8!0-2+-(2'$'99!8@W=3-&$316!$ধ32#@ raise during COVID-19 is a slap in the Speakership). 9<ø'8'891-9'8!#£'T-;$!2!£93$!<9' !=3-&-2+>!£0-2+32£!>2!8'!9g'='232 face to the many taxpayers who have some quite severe damage on lawn areas. top of the snow. The last wage freeze for Parliament taken a pay cut, lost their job or their There are a number of fungi that can be 23>13£&-2/<8@-93đ'29<6'8)$-!£ took place in 2010 and 2013 in response business.” -2=3£='&-2$£<&-2+V@6,<£!966WT-$83&3f !2&32£@!ø'$;9£'!(#£!&'ধ99<'W 3>f to the 2008 financial crisis in what was According to Statistics Canada, Can- $,-<12-=!£'T$£'83ধ2-!#38'!£-9T '='8T>,'2-2('9;!ধ32-99'='8'T;,''2f called the Expenditure Restraint Act. 232f9$£'83ধ!££3>;'16'8!;<8'#!9-&-3f ধ8'6£!2;1!@&-'W2!8'!9;,!;,!=' ada lost over 700,000 private-sector jobs The Canadian Taxpayers Federation 1@$';'lmT!2&9$£'83ধ!££3>;'16'8!f #''2!ø'$;'&T£-+,;£@8!0';3'2$3<8!+' over the last year. ture basidiomycete (SLTB). While the drying. Try not to breathe in the spores or 923>-91'£ধ2+@3<1!@9''6!;$,'93( the dust that will be present even if you 96-&'8>'#£-0'1!;'8-!£32;,';<8(9<8f &323;+'2'8!££@+';!££'8+-$8'!$ধ329W9 face. This is the mycelium which is the the season progresses you may want to Do your part to ='+';!ধ='6!8;3(!(<2+<9;,!;,<+9;,' overseed larger areas to help hasten the lawn as the snow recedes. Damage shows recovery. prevent crime. up on the turf as circular dead patches that are anywhere from a few inches to a !2#-&+'-9;,''!& 38ধ$<£;<8-9;>-;,8$,-& foot in diameter. When damage is severe 38ধ$<£;<8'W -2&<9!;>>>W38$,-&,38;W$31U Contact: -;3đ'2!66'!89£-0';,'>,3£'£!>2!8'! #@'1!-£!;-2(3|38$,-&,38;W$31U32(!$'#330 7,36 -9!ø'$;'&W @orchidhort and on instagram at #orchidhort Contractors and Home BOOK YOUR RENTAL Directory

EQUIPMENT J&V ELECTRIC

TODAY! Jamie Sebastian Owner/Journeyman TREE SERVICE Box 2388, Fort Qu’Appelle, SK S0G 1S0 •329;8<$ধ32 [email protected] •'9-&'2ধ!£ 306-331-8742 - 306-331-8732 3062I¿FH 306-331-8827 Cell • !81 Fort Qu’Appelle, SK Serving Fort Qu’Appelle and area for over 25 years • DIY projects www.whitingtreeservice.ca 316£';'-2='2;38@!;V )8'*@f8'2;!£9W$!c-2='2;38@ FlatLand Plumbing & Heating 117 - 3rd Ave. West, Melville, SK Call or email us for equipment 306-728-5493 pricing and availability. ,'#8!2&9@3<023>W Whitewood, SK. ,'9'8=-$'@3<;8<9;W Phone: 306-735-4328 ,'=!£<'@3<&'9'8='W ¤f¤f [email protected] Mon., Tues., Wed. & Fri. 9:00 a.m. to 5:30 p.m. >!88'2|)8'*@f8'2;!£9W$! Thurs. 9:00 a.m. to 6:00 p.m., Sat. 9:00 a.m. to 3:00 p.m. 2&-!2 '!&T!90!;$,'>!2 >>>W)8'*@f8'2;!£9W$!

Whitewood, SK

ADVERTISING DEADLINE Tuesdays 12 noon – 306-728-5448 – Toll Free 1-844-GNG-NEWS www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 9 Gene Hauta Plans for new funeral home in Grenfell It’s A Strange World The pandemic may still be issue No. 1, but an- die following zoning bylaw concerns other topic — the border — is fast becoming a major issue for both American political parties. By Sarah Pacio They presented their business that they could proceed with the re- Republicans say looser immigration policies under Grasslands News proposal to Grenfell town council zoning process or select a property President Biden have created a crisis, while Dem- in Oct. 2020. They described plans that was already in a commercial ocrats blame Donald Trump for leaving behind a for minor renovations, along with zone. However, the commercial broken system. GOP critics spew comments like, A new business that was pro- their intention to provide compas- properties did not suit their pur- “There’s no other way to claim it than a Biden posed last fall will not be opening sionate services to families in the pose. “We want to preserve the border crisis.” The Democratic pushback: Dem- in Grenfell. community and surrounding area. dignity and privacy of the deceased ocrats dispute any Republican allegations about Gail Kuhn and her daughter- A public hearing was subse- and their family, and you can’t do terrorists sneaking across the border. While the in-law Jenelle Blancher desired to quently held as part of the regular that in a commercial area,” Kuhn Biden honeymoon is over, this is strategy by the establish a family-owned and oper- process. At the hearing, several explained. Republicans to turn immigration into a hot topic. ated funeral home in the town. neighbors strongly objected to a Although there was some sup- Biden is getting generally high marks for his han- “I grew up in Grenfell so the funeral home being established in port for the business as initially dling of the pandemic better than “the Former community seemed like something a residential area, citing concerns proposed, Kuhn felt there was little Guy.” According to Mexican President Andres that we were looking for, and the about increased traffic and the hope of successfully completing the Manuel Lopez Obrador, Central Americans “see location provincially was quite at- embalming processes. Others felt rezoning process due to significant Biden as the migrant president.” Illegal crossings tractive,” Kuhn told to Grasslands the funeral home would be an un- objections from local residents. are apparently way up since Biden became presi- News. pleasant and conspicuous reminder Under the circumstances, Kuhn dent. They had purchased the old Ellis about the end of life. and Blancher have relisted Ellis A Florida woman was arrested Hall at 723 Anderson Street with Following the public hearing, Hall for sale. They have not aban- after she shot her estranged this in mind. The town’s zoning by- council discussed the matter. “The doned their plan to open a fam- husband in the testicles for laws required Kuhn and Blancher funeral home’s motion for change ily-owned and operated funeral trying to take an air condi- to obtain a discretionary use per- of use was tabled for more informa- home, but are now looking at other tioner she was trying to sell mit in order to operate a funeral tion from the owners to see if they options for a location. on Facebook. The victim and home at the selected location. This wanted to continue with the zoning “It was disappointing that his brother showed up at Kim- applies specifically to their pro- amendment changes,” CAO Brenna it didn’t get the support that it berly Dunn’s home in Lake posed business and would allow Ackerman stated. “Town council needed (in Grenfell),” Kuhn com- City. She sat on the AC them to operate a funeral home was enthusiastic to see this type of mented. “It’s really unfortunate; to keep him from taking there, but it would not change the business come to Grenfell because we would have brought some new it, and when he tried to property’s residential zoning desig- it is needed in the community.” families into the community, but move her, that’s when nation. Kuhn and Blancher were told that’s how it went.” things got violent. Dunn first used a stun gun, and then she picked it up a notch by switching to a handgun. After she shot the victim, his brother then choked her out. The brother got the victim to the hospital, Elm tree pruning ban now in effect and he will live. Although she argued that she was just trying to scare him, Dunn was arrested and The annual ban on pruning elm types of disease, including DED. logs. Dispose of all elm wood made things worse when she failed to show up for trees in Saskatchewan to help curb • Remove unhealthy and dead promptly and properly, at the loca- court. the spread of Dutch elm disease elm wood cuts, reducing places for tion designated by your municipal- In Richmond, Virginia, a woman who caught (DED) began on April 1 and will beetles to breed and the risk of in- ity. Often, this is the local landfill, her husband having sex with her grandmother continue until August 31. During fection. but confirm this with your local had a violent reaction, running over him with this period, it is illegal to prune • If you see an elm showing municipality. her vehicle multiple times. Police arrested Sa- elm trees. signs of DED - wilting, yellowing Improper pruning can damage mantha Warrens, 28, who was infuriated and The ban occurs at the time of leaves on one or several branches your trees and spread diseases. If kept screaming obscenities. That was when her year when the elm bark beetles near the top of the tree, usually be- you hire someone to prune your grandmother came out of the house in her best lin- that spread DED are most active. ginning in late June - report it to trees, check their qualifications. gerie to explain. The police stated that it was the Fresh cuts from trimming your your local municipality. In Saskatchewan, those who prune “sickest adultery” they had ever experienced, but trees can attract the tiny insects, • Remove and dispose of DED-in- elm trees commercially must have what Warrens did was illegal. Unbelievably, Eric increasing the chance of an infec- fected elms promptly, including completed a recognized training Leonard, 30, was in critical, but in stable condition. during the ban period. program or be under the supervi- tion with 57 or more bone fractures, including There are more things you can Transporting wood can spread sion of someone who has. a fractured skull. Warrens is facing a total of do to help protect your communi- DED, as well as other insects and For more information, contact 57 criminal charges, including assault and bat- ty’s elm trees: diseases. It is illegal to use, trans- your local municipality or the tery, aggravated assault, and attempted murder. • Prune your elms before or port, store or sell elm firewood. Ministry of Environment Inquiry If found guilty on all charges, she could face the after the ban period to keep them Regulations also restrict the use, Centre at 1-800-567-4224, or visit death penalty or a sentence of 215 years in prison. healthy and better able to resist all transport, storage and sale of elm www.saskatchewan.ca/forestry. Reacting to the news that Pepe Lepew is now a cartoon non grata, due to the way he treated females, somebody quipped, “I’m glad he’s cancelled and my children are safe. Now my son can get back to playing Grand Theft Auto where he just set a hooker on fire so he didn’t have to pay her.” Now, I don’t know the game, but I know the cancel Store culture is out of control. This next one, I find absolutely unbelievable. For some people, men opening doors for women is a symbol of aggressive patriarchy. It’s like men For everything OUTDOOR! saying to the women, “You may enter or leave this place but only on my say so.” There are those who actually believe that feel a man opening and holding a door open for a woman is him subcon- See our store today! sciously reminding her that men are in control of a woman’s choices. The way I was raised, that is Start you next outdoor adventure simple courtesy that earned praise. That new explanation is ridiculous. >-;,<9R';T$!16-2+T)9,-2+T Cops in Schwelm, Germany, said the DNA found on a half-eaten piece of sausage matched ,<2ধ2+9<66£-'9!2& W that of a man who was arrested in France for an unrelated crime. The piece of meat belonged to the £939''<9(38!££3(@3<89'!932!£ victim of the burglary, and allegedly the 30-year- old suspect chomped a piece out of it during the >'!8!2&>380>'!82''&9W March 2012 break-in. The suspect may escape punishment in the burglary case as the statute of limitations has expired. A man from Texas really wanted to buy a special BMW. He used a loaner car from a dealership to drive to a bank and rob it, then returned to the dealership to buy a car with the newly (illegally) acquired cash. While he was finalizing the paper- work, the dealership learned of the bank robbery. An employee realized the company’s loaner vehicle matched the description of the robber’s car. Dion Warren, 50, was arrested and has since been sentenced to 20 years in prison after pleading 702 Lalonde St., Whitewood, SK guilty to bank robbery. April Fool’s Day has been cancelled this year. No prank could possibly top what 2020 has thrown 306-735-2560 at us. Ain’t that the truth? Keep reading between the lines… 10 April 2, 2021 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News

WEEK OF APRIL 4 TO 10, 2021

THE LUCKIEST SIGNS THIS WEEK: ARIES, TAURUS AND GEMINI ARIES You’ll face a lot of pressure at work, and you’ll need to spend time with friends to get your mind off the stress. Much to your de- PUZZLE NO. 068 Copyright © 2018, Penny Press light, you’ll be in charge of plan- CROSSWORDS ning an event with your loved ones. ACROSS 51. Legal decree 21. Totally confused 52. Graceful waterfowl 23. Leek’s relative TAURUS 55. Certain woodwind 1. Hearty meal 24. Related You’ll come to a realization that 5. Pens’ fluids 56. Connecting link guides you toward a new ca- 9. Flow back 57. Vatican City resident 25. Rearward, nautically reer path that’s more in line 12. Belief in future 58. Small lump 26. On the ____ with your ambitions. A training success 59. Dated (secretly) course will help you achieve, or 13. Post 60. Plant 27. ____-hop at least identity, a new goal. 14. Court 61. Had delivered 30. Move quickly GEMINI 15. Spends 16. Mimicking bird 31. Grabbed lunch You’ll start considering summer 17. Long timespan 32. Miss Piggy is one vacation options with your part- 18. Not harsh ner or family. It’s important to 34. Colts or Mets 20. Foul DOWN plan ahead if you want to have 39. Road bend a wonderful experience with your 22. Takes on 1. Train sound 42. Scrapes loved ones. 25. Speck of residue 28. Yearn for intensely 2. Firefighter’s need 43. Choir voice CANCER 29. Divisions of time 3. Unzip 44. Fence part You’ll feel extra sensitive, so 33. Dart 4. “____ Side Story” 45. Felt obligated 35. Into thin ____ be sure to rest before you start 5. Instant 47. Tosses taking things personally. You 36. Vehicle 6. Anti’s answer 37. Classify 48. Ready, willing might want to consider going 7. Family 38. Carry and ____ on vacation so you can take a 8. Angle load off. 40. ____ Haven, 49. Midnight’s opposite Connecticut 9. Fleecy females LEO 41. Sports palaces 10. Cowboy’s gear 50. Bankruptcy cause It’s always easier to negotiate 43. Fragrance 11. Skinny 53. Misery with people when you don’t have 46. “Treasure ____” 19. Lick at 54. Tarzan’s friend an emotional connection. You’ll get along well with anyone you meet, but you’ll bicker with your children, for example. VIRGO There’s plenty of room to grow in your professional life, so take full advantage of these opportunities. Use your instincts and organizational skills to carve a place for yourself at the top of your field. LIBRA You’ll be warmly applauded for an achievement, even if you see it as trivial. Your actions will be considered heroic, even if all you did was listen to someone who needed help. SCORPIO Your focus will be on family and anything that concerns your day- to-day life. In terms of your career, you may start a family business from home. SAGITTARIUS You’ll be feeling excited about the various trips you have plan- ned for the summer. Your curi- osity is in overdrive, and there’s no stopping you from quenching your thirst for knowledge. CAPRICORN You might take the initiative to broaden your experiences, which could take you to the other side of the world. At work, a position you’ve long had your eye on will finally open up. AQUARIUS You’ll constantly be on the move. You’ll improve your mental well- being by expanding your spiri- tual practice You might also invest in a cause that brings you answers. PISCES You’ll be overwhelmed by a variety of unique ideas. You’ll work to create a masterpiece or do something incredibly generous for someone else. Һ {

712 Lalonde St., Whitwood, SK – 306-735-4328 OR 515 Main Street, Kipling, SK – 306-736-5328 !&1-2|*!;£!2&6£<1#-2+W$! www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 11

Staying connected with loved CALEB VILLAGE ones in assisted living facilities Melville’s finest !££f-2$£<9-='8'ধ8'1'2;$311<2-;@ 680-7th Avenue East, Melville, SK niors are sometimes hesitant to utilize technology. Having spent much of their lives without smart- INDEPENDANT LIVING phones and Zoom calls, it may seem like adjusting to a world where such things are now widely utilized SPECIAL PROMOTION ON NOW! will be incredibly difﬁ cult. However, modern technology is user-friendly, meaning seniors won’t need much, if any, technical expertise or experience to SAVE $900 utilize an assortment of devices that can help them #'&83319<-;'9T97WđWTW£3$0'&-2 stay in touch. Ask a relative to show you the ropes (38@3<8)89;132;,9W8-$'-9W!đ'868313ধ32W of a new device or request that staff at the facility teach residents the basics of using devices to stay connected with family. Staff may help set up Zoom calls or help residents learn the ropes of texting. • Make a weekly communication commitment. Work with family members to set up a time each week when you can communicate directly with them. If family lives nearby, this might take the form of a General Manager: Tracey Schuman Decisions surrounding assisted living facilities are weekly family meal at a loved one’s home. If family not always easy. Men and women may be reluctant to lives too far away for routine in-person meals, set up 306-728-2035 leave their homes while family members may be wor- a time each week for a family Zoom call. ried about how their aging loved ones will adjust to Call for your personal tourR • Continue to engage with your interests and fel- life in an assisted living facility. Though modern as- low hobbyists. If you were an avid reader who loved Check out our Facebook page Caleb Village in Saskatchewan sisted living facilities cater to residents with an array to discuss and recommend books to your loved ones, of needs and interests, the hesitation about whether then continue to do so after moving into an assisted or not to move into such a facility is understandable. living facility. Sports fans who bonded with their One of the concerns seniors and their families may have about assisted living facilities is how to loved ones over a shared passion for a favorite team remain in touch with loved ones. Thankfully, stay- can keep following their team and discussing the lat- ing connected is easier than ever before. That ease of est big game with their friends and family via email, connection has been on full display throughout the texts or video calls. Various studies have discovered www.calebgroup.ca COVID-19 pandemic, during which aging men and the positive effects that hobbies can have on long- women have been urged to limit contact with people term physical and mental health. Staying engaged outside their households in an effort to reduce their with your passions can keep lines of communication risk of contracting the virus. When the pandemic is open with friends and family and beneﬁ t your overall in the rearview mirror, seniors can continue to em- health. Mature Living ploy various strategies to stay connected with their Keeping the lines of communication with loved families after moving into an assisted living facility. ones open can help aging men and women as they Watch for our next feature, May 7 • Embrace technology. It’s understandable that se- transition to life in assisted living facilities. PICK YOUR LIFESTYLE

&KRRVHWKHOLIHVW\OHWKDWʹVWKHULJKWοWIRU\RX RU\RXUIDPLO\PHPEHU9LEUDQWLQGHSHQGHQW and assisted living at Yorkton Crossing, or HQJDJLQJPHPRU\FDUHDW5LYHUEHQG&URVVLQJ

We’ve got what you’re looking for. Call or visit our website to book a virtual tour.

Riverbend Crossing Yorkton Crossing Memory Care Community Retirement Community 2235 Heseltine Rd, Regina 348 Morrison Dr, Yorkton 306-347-7773 306-782-0005

EspritLifestyle.com Independent Living Assisted Living | Memory Care

Photo taken prior to COVID-19. 12 April 2, 2021 Whitewood Grenfell Herald Sun Grasslands News Oncology program can expand service for Moosomin and area By Spencer Kemp chemotherapy. And we were getting to Local Journalism Initiative Reporter the point where we didn’t have space because of the number of chemotherapy patients we have. As well, one of the med- The Community Oncology program ications we have needs to be in a freezer in Moosomin currently serves about that is purposed as a hospital freezer. We 70 chemotherapy patients in southeast initially had a household freezer, but we Saskatchewan and southwest Manitoba, were told we couldn’t use that anymore,” but now is able to accommodate a wider McDermaid said. range of chemotherapy options and serve Because pharmacy standards do not a wider range of patients.. permit the use of household freezers or Thanks to donations made to the Moo- fridges, they had to purchase a new one somin and District Health Care Founda- that has its temperature monitored 24 tion, the Community Oncology Program hours a day with an alarm to alert staff in of Saskatchewan (COPS) in Moosomin the event the freezers temperature goes now has the equipment to to expand its outside its required range. services. She says that the new freezer has al- PHOTO BY SPENCER KEMP The COPS program was designed to lowed them to provide a new type of treat- Oncology service expanded help patients who need chemotherapy ment that could only be administered in From left: Southeast Integrated Care Centre Manager of Pharmacy Services Karen Mc- get it closer to home by providing it in Regina before the purchase. Dermaid, pharmacy staff Janelle Schenn, Kate Chegwin, Tracy Buckland Fawcett, and smaller communities. “The treatment that is tied with this Todd Miskiman, and Moosomin Mayor Larry Tomlinson of the Moosomin and District Moosomin is the smallest community one is a seven-day a week, every day Health Care Foundation pose with a new fridge and freezer that will allow the oncology in Saskatchewan to be part of the Com- treatment and the injection takes about program at SEICC to provide a wider range of chemotherapy. munity Oncology Program, originally ten minutes. We had patients who were conceived to expand chemotherapy from driving to Regina every day for seven Canada Highway 11 times. criteria that go into that decision, but the the main centres into rural Saskatche- days just because we didn’t have the Thanks to the purchase of the freezer, one drug that needed the freezer was an wan to bring the treatment closer to the freezer. So it’s an addition to our little they are now able to carry one more drug approved drug and we could now add that patients. space.” that saves local patients trips to Regina. and offer it to patients locally.” Manager of Pharmacy Services at the She explains that one thing the COPS “The Outreach program is set up so McDermaid says that it’s not just Moo- Southeast Integrated Care Centre in Moo- program does is helps minimize the that certain medications can be given at somin residents who utilize the program, somin, Karen McDermaid, says the Foun- amount of driving patients need to do to outreach centers and there are different - SEE ONCOLOGY, 13 dation purchased the fridge and freezer receive treatment. because the COPS program needed addi- “What the Saskatchewan Cancer tional space to store chemotherapy treat- Agency looks at is the number of kilo- ments. meters you save if you had to drive to The fridge was purchased to meet stor- Regina and back. Even if you’re driving age standards as other drugs cannot be from Redvers to Moosomin, it’s a huge You could get stored alongside chemotherapy agents. difference. Even for the patients as well, The freezer was purchased as well to depending on the chemotherapy you’re help provide a speciﬁc treatment that getting, you may not feel that great after, a bigger refund requires medication to be frozen once and knowing you have a two-hour drive mixed. ahead of you to get home as opposed to The fridge and freezer were purchased ten minutes. with the Climate Action at a cost of $7,500. “There are also better support systems “They purchased a fridge about a year here as well with family and friends. So Incentive credit. ago and then purchased the freezer. Ulti- it’s just more manageable.” mately that was in association with the From April to December 2020 alone, Chemotherapy Outreach Program be- patients were saved 84,490 km of driving. cause we can’t store things like insulin To put that into perspective, that would and other injectable fridge drugs with be like driving the full length of the Trans

For more info, contact: 21041MM3 306-745-6450 | 400 Main Street Esterhazy 306-728-4358 | 148 3rd. Ave. E. Melville hrblock.ca

Not everyone receives a refund from claiming any tax credit. Amount cannot be guaranteed and varies based on each individual tax situation.

Canada is borrowing $27.50 per citizen per day* GUESS WHO PAYS? Can you afford a $1 TRILLION DOLLAR DEFICIT? *

DR. Robert Kitchen MP Souris-Moose Mountain 1-866-249-4697 • www.drrobertkitchen.ca www.grasslandsnews.ca Whitewood Grenfell Herald Sun April 2, 2021 13 COVID cases on the rise in Whitewood area - continued from front page

He said the variants The Saskatchewan Health these limitations will re- ily members and support are the main drivers of Authority is asking the main in place until it is people will be required COVID numbers in south- public for their support safe to return to the pre- to wear a medical grade ern Saskatchewan at this and cooperation in order vious level of family pres- mask while inside the fa- point. to contain the spread of ence. cility or home and poten- The SHA also an- the virus. Family members and tially additional personal nounced that in order to Level 3 family pres- support people who are protective equipment if keep everyone in SHA ence restrictions are for permitted must undergo a required. Family mem- facilities and care homes end-of-life with the pro- health screening prior to bers and support people safe during this time, vision that care teams entering the facility. This are not permitted to wait that family presence/vis- can support one essential includes a temperature in waiting rooms or other itation has been limited family/support person to check and questionnaire. common areas. to family presence level safely assist with care if The family member or Detailed information 3 only in the Whitewood needed (i.e. for self-care, support person will be about family presence Community Health Cen- mobility, nutrition and required to perform hand during COVID-19 can be tre. behavioural needs). This hygiene (hand washing found at saskatchewan. The decision to restrict must be approved by the and/or use of hand sani- ca/covid19. family presence is not care team and includes tizer) when entering and Wasko also stated, “... taken lightly. These mea- outbreak situations. leaving the facility or a couple of weeks ago sures are in place to keep No other visitors are home and when entering it was thought this was you, your loved ones, and allowed into the speciﬁed and leaving the patient’s a Regina problem and health care workers safe. facility at this time and or resident’s room. Fam- it is most certainly not a Regina problem. It is popping up in multiple communities across the Oncology in Moosomin expanded for area patients rural southern part of - continued from page 12 our province and it’s Easter egg hunt SUBMITTED | GRASSLANDS NEWS spreading fast.” Mylo (left) and Tashunka joined their class- but also individuals from nearby com- “The numbers go up and down. We The Government of mates for an Easter Egg Hunt at Broadview munities. are one of the quieter programs in the Saskatchewan has put “We have people from Broadview, province, busier than some but when new restrictions in place School on March 25. Redvers, Kipling, Moosomin, Esterhazy, compared to places like Yorkton, we’re for the city of Regina and and Rocanville. And we even have people pretty quiet. Our volume fluctuates area and is also strongly from Manitoba because they see physi- based on the need within the area. There advising any travel to or tians in Moosomin. The next closest are times where we could do more, there from the city in hopes of centre that does the COPS program is are times when we do less. We could al- lowering the spread of Melville and Estevan and Weyburn.” ways expand and do more but it’s based the virus. She says that since the program began on what the need is in the local area.” SHA is urging resi- in June of 1999 they have been able to The COPS program in Moosomin has dents to follow public provide full services to patients in the a team of physicians, nurses, pharma- health measures and per- area. cists, pharmacy technicians with a con- sonal safety precautions “Our involvement is having the phar- sultation to social workers, dietitians, to prevent the spread Help keep your community’s history alive. macists review the orders when they home care, and additional supports of the virus, including come in from the cancer clinic and our where needed as well as a treatment maintaining a physical SUBSCRIBE TO YOUR LOCAL NEWSPAPER! technicians do the chemotherapy prepa- room with two chairs and a room with distance of two metres rations and then we have nurses that are a stretcher. from others and masking trained for the administration and docu- The COPS program is available in Es- when that’s not possi- Call Toll Free: mentation involved.” tevan, Humbolt, Kindersley, Lloydmin- ble and in public indoor She says that the program has around ster, Meadow Lake, Melfort, Melville, spaces, frequent hand 70 patients from southeast Saskatchewan Moose Jaw, Moosomin, Nipawin, North hygiene and self-isolating 1-844-GNG-NEWS and southwest Manitoba, but the number Battleford, Prince Albert, Swift Current, if you develop any symp- ﬂuctuates. Tisdale, Weyburn, and Yorkton. toms of COVID-19. [email protected]

21041MM1 21041MM2 21041AA2 21041AA3 14 April 2, 2021 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News

Standing ‘On the Rail’ as a Rodeo Cowboy Turnin’ and burnin’ in Birtle back in the summer of 2005 The Canadian Pro Rodeo Hall of Fame is honouring the history of the legends in the sport

Editor’s Note - Cross- homa City, OK which (MHSRA), it was submit- and bullsh*t is common. roads This Week Staff collects, preserves and ex- ted to Manitoba Lotteries, With the use of electric Writer and Photographer, hibits an internationally in lieu of sponsorship. prods being eliminated, Darrell Nesbitt, has stood renowned collection of The representative com- the ‘8’ second performer ‘On the Rail’ telling sto- western art and artifacts. mented on how barrel is still an explosive com- ries of the life of a cow- Closer to home the Ca- racer, Jennifer Pugh’s petitor for all the right boy, from little britches to nadian Rodeo Historical eyes, made the photo reasons. True, horses, professional. This article Association, also known so much more appeal- bulls, steers, and calves is the second in his “On as the Canadian Pro ing than simply a rider found in the sport may the Rail” series, touching Rodeo Hall of Fame, hon- and a horse turnin’ and have to be put down hu- on various aspects of the ours the history of rodeo; burnin’. At the time, she manely from time to time, sport, action, and people. by paying recognition to was among the dedicated but in reality accidents Grasslands News thought the cowboys, animals and high school athletes, to take more human lives it would be a series of in- builders of the sport who uplift the sport of rodeo than animals living the terest to our many readers. achieved excellence in from a timed or rough rodeo dream. their field. stock event perspective. Over the years, the By DARRELL NESBITT But in reality, if it Today, there are more names of Lee Bar N from Crossroads This Week wasn’t for the men and girls than guys competing Rodeo, Prime Time women deeply interested and earning scholarships Rodeo, Top Line Rodeo, for future schooling. Seven Cross Ranch, Mid- Rodeo… the uniquely in the sport, sitting on Rodeo is more than just night Rodeo Co. and Wh- western tradition has committees, operating a sport… a sport that is iteline Rodeo brought seen the rise of renegades stock contracting busi- not without controversy. their show, their passion, refusing to be tamed and nesses, or lending hours Rodeo events encompass and their outstanding ageless wonders provid- of mindful blessings and core skills that those stock to many communi- ing it’s never too late. back staking labour as a 7XUQLQ·DQGEXUQLQ· working with livestock ties. A number of owners, From the pasture to committee member, no Jennifer Pugh competing at the Birtle High School traditionally require in themselves, competed be- the arena, rodeo has museums or halls would Rodeo in 2005, has a look of determination in her order to safely and effec- fore carrying on a passion grown into one of the be required. H\HVDVVKHURXQGVRQHRIWKHEDUUHOV tively manage their an- for the western lifestyle most popular sports in Throughout history, imals day to day. Each from a different perspec- North America, but be- dating back to 1981, plenty 2017. is Morris. Other jurisdic- passing year, naysayers tive. Four of those names fore the gold buckles or of contestant names have Among the females in- tions are still held in a in terms of those who are still vivid in the trophy saddles, cowboys been inducted into the ducted in the “Builder” number of communities, frown on how an animal rodeo kingdom, sharing rode solely for bragging Canadian Pro Rodeo Hall category in 2015 was Pearl but within the immedi- including bucking horses, a passion for the sport, rights. of Fame including Glen Mandeville, a Manitoba ate area that number has and bulls are treated in on their terms and condi- Today, bragging rights Keeley, one of Canada’s cowgirl, who along with dwindled. The towns of the rigors of going and tions including standing are kick-started at Lit- top bull riding talents, winning a number of bar- Birtle, Hamiota, Keesee- up down the road to com- behind high school rodeo tle Britches events, on- who passed away tragi- rel racing titles out west, koowenin, Miniota, Onan- pete, voice their displea- athletes. ward to Junior High and cally in Albequerque, NM her passion for rodeo also ole, Rossburn, Shoal Lake, sure. Studies have shown The open road for- High School, amateur in March of 2000, at the saw her as a flag bearer, Solsgirth and Strathclair stock contractors take ex- gives and forgets, but the associations, semi-profes- Ty Murray Invitational timer, Miss Rodeo Can- from a high school, ama- ceptional care of the an- bond between travelling sional, and professional. PBR. Keeley qualified for ada judge, introduced the teur or semi-professional imals, which provide in partners or family, is up- Websites can be tracked numerous CFR, NFR and Canadian Rodeo News, viewpoint, have vanished part a critical component lifting sharing wisdom down, however, in terms Professional Bull Riders and served as the pro- from the rodeo trail. Why of a business plan. versus worry. Competi- of professional more than (PBR) World Finals and motional director for the not today? Volunteers and To understand that tors are here for a good 10 million visitors from was inside the top five in first year that Alberta costs, is the mere answer! viewpoint, one must time, not a long time, so around the world have the PBR World Standings had a High School Rodeo The photo accompa- truly enrich the sport sit back and enjoy, where sought out the National when he passed. For his Association. She passed nying this column was by coming in close con- the opportunity presents Cowboy and Western Her- excellence in his field, away in January 2016 at taken at the one and only tact with stock and stock itself, as rodeo can be- itage Museum in Okla- Keeley was inducted in the age of 84. Birtle high school rodeo, contractors. You know, come addictive with each The sole Manitoba held back in 2005. On be- smack dab in the middle nod of the head, fling of Tammy Wandy community to host and half of the Manitoba High of excitement behind the the rope, and an apprecia- LOCAL AGENT promote pro rodeo action School Rodeo Association chutes, where bullropes tive fan base. [email protected] REGINA REALTY 306-501-9828

Vacant Lots $57,000 $81,500 $89,000 $89,900 $116,500 105 Piller Rd, Melville $44,900 MLS® # SK834819

251 Agripark Rd, Melville $49,900 MLS® # SK837675 249 Agripark Rd, Melville 214 Louis St, Neudorf 278-2nd Ave, Goodeve 211 May St, Neudorf 318-5th Ave W, Melville 156-6th Ave E, Melville $49,900 MLS® #SK837676 MLS® # SK836001 MLS® # SK836001 MLS® # SK840126 MLS® # SK844466 MLS® # SK837605 House | 4 bds, 2 bths House | 2 bds, 1 bths House | 4 bds, 2 bths House | 2 bds, 1 bths House | 2 bds, 2 bths

$139,500 $179,000 NEW $184,900 $187,000 $215,000 $225,000 LISTING

228-8th Ave W, Melville 707 Railway Ave, Neudorf 520-6th Ave W, Melville 214-8th Ave W, Melville 620 Main Street, Melville 227-680 7th Ave E, Melville MLS® # SK841331 MLS® # SK840127 MLS® # SK846419 MLS® # SK841501 MLS® # SK841525 MLS® # SK834787 House 2 bds , 1 bths House | 4 bds, 3 bths House | 4 bds, 2 bths House 3 bds , 2 bths House | 5 bds, 2 bths Condo | 2 bds, 1 bths

NEW $229,000 $239,900 $269,900 $275,000 $449,000 $749,900 LISTING

397 Manitoba St, Melville 375-10th Ave W, Melville 13-2nd Ave N, Yorkton 60 Indian Point, Crooked Lake 109 Piller Rd, Melville ¥$3ধ!;T'£=-££' MLS® # SK842356 MLS® # SK846583 MLS® # SK834795 MLS® # SK834817 MLS® # SK843080 MLS® # SK834738 House | 4 bds, 2 bths House | 4 bds, 2 bths House | 4 bds, 2 bths Commercial House | 5 bds, 4 bths House | 4 bds, 3 bths www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 15 Sports Column – Darcy Gross Youthful Bedard living up to hockey hype Gross Misconduct Hey, hockey fans, there’s another Connor Superstar nor McDavid, won’t be the league’s only Connor Super- lacing up his skates, ready to show up on your Hockey star for long. Night in Canada TV screens in oh, about four years. • Comedian Argus Hamilton, via Facebook, on the This will be no shock to those who have more than Rover’s search for water on Mars: “They should’ve sent Penalizing the referee a passing interest in hockey, but the occasional fan me there with my golf clubs. I’d have found water by The National Hockey League will often penalize may have not yet heard of Connor Bedard, a 15-year- my third tee shot.” players – put them in the penalty box to sit and old from North Vancouver who is playing major junior • Colour commentator Ray Hudson of beIN Sports feel shame or suspend them so they have to sit in this year with the Regina Pats. TV, after Barcelona’s Lionel Messi put on a one-man the press box and feel that same shame – but they Bedard is the first Western Hockey Leaguer given show to score against SD Huesca: “He needs help like a rarely do anything that would adversely affect an ‘exceptional player’ status, allowing him to play before shark needs a dentist.” official. the age of 16. And how is he doing so far? Well, in • Jack Finarelli, from sportscurmudgeon.com, on one The last time an NHL referee lost his job was in his first eight games, in which the Pats of five new sports at the Olympics in scored 26 goals, Bedard had a team-lead- Japan this summer: “Sport Climbing: 2009, and while we, as fans, think the job they’re Sports Column doing should be fairly cut and dried, and should ing 13 points, six goals and seven assists. Athletes here will scale a vertical wall. result in more refs losing their employment, for NHL scouts, who were drooling before, By Bruce Penton I guess this is like the hundred-metre whatever reason, the league usually stands behind now carry a bucket whenever they ob- dash staged at right angles to one an- its officials no matter what. serve Bedard in action. other.” That is until last week, when veteran referee Is he ready for the big time? Last • RJ Currie of sportsdeke.com: “A Tim Peel was sat down for the rest of what would season, as a 14-year-old playing in the New Yorker is selling an ultra-strong have been his final campaign as an NHL official. under-20 Canadian Sports School Hockey coffee called Death Wish, which car- The reason for Peel’s dismissal wasn’t that he League, Bedard was dominant, scoring ries the warning ‘many sleepless was a terrible official, although some members of 43 goals and 41 assists in 36 games to nights’. Hey, it’s cheaper than Jets more than one team thought he was indeed terrible lead the league. One of his summer on- tickets.” at his occupation. ice workout partners of late has been • Currie again: “A brawl reportedly Peel was effectively fired as an NHL official for Matt Barzal of the New York Islanders. broke out at a New Hampshire re- remarks caught on an open microphone, and the John Paddock, the general manager and vice-presi- tirement centre during a bingo game. It looked like a remarks were more about Peel’s own version of dent of the Pats, says Bedard, who won’t turn 16 until hockey fight, except with more teeth.” gamesmanship than it was about the game itself. this July, “can do a little bit of everything” — unable • Greg Cote of the Miami Herald: “New Zealand After calling a penalty against Nashville in a to isolate one aspect of Bedard’s game as his most out- defeated Italy in the final of America’s Cup sailing in game against Detroit, Peel said, loud enough for standing. Paddock, who played parts of five seasons in Auckland. Home-water advantage?” the video to pick up, that he wanted to give the the NHL and was head- or assistant coach for three • Posted on the Lethbridge Hurricanes’ scoreboard Predators a penalty early in the game and even ad- NHL teams during another eight campaigns, has seen during a fan-less hockey game: “Free beer for all in mitted the call was weak. a lot of hockey players in his day and says, if he has to attendance.” “It wasn’t much, but I wanted to get a (expletive) pick a comparative player, Tampa Bay’s Steven Stam- • Dwight Perry of the Seattle Times: “Ohio State call against Nashville early,” were Peel’s words on kos comes to mind, considering how he gets the one- safety Marcus Hooker was arrested on DUI charges the video replay. timer blast away from the left circle. after he passed out behind the wheel while waiting in Now, there are two schools of thought on how Is Bedard your best player? A 15-year-old? Paddock a McDonald’s drive-thru line. Defence lawyers can’t de- an NHL official should govern himself when it demurs. “Well, we have a 19-year-old defenceman who cide whether to enter a plea of guilty, not guilty or ‘I comes to calling penalties. Some folks believe that would probably be our best player, but it’s close,” he deserve a break today.’” the game should be called by the rules – no excep- said. • Another one from RJ Currie, on marine biologists’ tions. Others think that there’s some room to set Paddock says he knows he’ll have Bedard for only claim that many sharks take a break each spring to up some ground rules for every game and that it’s two seasons beyond the current COVID-19-truncated focus on eating, mating and swimming in warm water: okay to work outside the traditional framework of season before the NHL comes calling, and hopes he can “If we’re talking San Jose Sharks, add golf.” the laws of the ice. build a winner around his young superstar during that • Another one from Perry: “Evander Holyfield, 58, Peel was well known as the kind of referee who period. “We’re going to try,” he said. and Mike Tyson, 54, are scheduled to meet once again would make a call to keep the game under control All the attention the 5-foot-9, 179-pound Bedard has in the ring on May 29. Winner becomes the first boxer – he’d make a few phantom calls to ensure that the garnered since being identified as a hockey prodigy in history to boast all four belts — WBA, WBC, IBF game didn’t get out of hand and escalate into vio- around the age of 12 has not gone to his head, said and AARP.” lence. Paddock. “He was really brought up the right way,” he • Troubled ex-big-leaguer Lenny Dykstra, via Twitter, Those types of referees are often known as said. “He’s one of those rare players who’s been prepar- not making anyone forget Cal Ripken Jr.: “Guess who ‘scoreboard refs’, guys who like to dictate the pace ing for this his whole life. He’s ready mentally.” hasn’t been arrested in now 34 consecutive months.” of the game to ensure both teams play good, clean Meanwhile, the NHL’s best player, the Oilers’ Con- Care to comment? Email [email protected] hockey. Maybe a call, or lack of one, could temper the emotion of one team or the other and diffuse what could be an awful situation. Weightlifting, breaking records is way of life Referees have been doing this sort of thing since the beginning of the sport, I would assume, so why By Travis Longman was dominating the Mr. gest man who ever lived. visit his parents, Grace is it such a crime now? Grasslands News Olympia competition. An- These three men inspired and Willie Topinka. Is this another example of the cancel culture other person who inspires Topinka and made him Topinka is proof that no bandwagon that everyone has been jumping on and him is Canadian Lewis want to do his best. matter where you come When it comes to feats off of for the last few years? Cyr, the Canadian strong- Topinka lives in Re- from, you can accomplish of strength, there isn’t For whatever reason, the powers that be man from the 1800’s who gina but he frequently anything you set your much Mel Topinka hasn’t couldn’t wait until the end of the season to suspend is known as the stron- returns to Whitewood to mind to. Peel, when he was set to retire anyway. accomplished. The White- Perhaps the league needs to set new standards wood native has been for its officials, or, better yet, take the mics off the lifting weights since1974 officials altogether. when he was 12 years old. When we’ve already got two people in the broad- The 59-year-old construction worker continues to Automotive and Service cast booth and another between the benches, did we really require Tim Peel to be responsible for impress and practice his announcing penalties? craft daily. He also continues to set records. Directory It wasn’t three days after Peel was canned that another referee was seen covering his clip-on mic Most recently back in during the heat of an NHL game. November 2020, he set a It’s interesting that this transgression didn’t world record in the class 5 OW TOWING SERVICES (50 and over) 87 kilogram draw more attention than it did, with everyone 24 Hour Service looking harder than ever to find something to be class (190 lbs.) bench press Cell: 306-331-8833 outraged about than at any other time, at least competition. Topinka bench pressed 440 lbs. In during this scribe’s lifetime. :UHFNPDVWHU&HUWLÀHG I guess players are allowed to live up to ‘the addition to this world re- 6*,6WRUDJH&RPSRXQG Ervin Wolfe cord, Topinka still holds a )UHH8QZDQWHG&DU5HPRYDO code’ that’s been talked about in hockey circles for Product Advisor decades, but referees aren’t allowed to have any- record for doing 92 push- /RFNRXWVERRVWLQJDQGZLQFKLQJ [email protected] thing in their arsenal to diffuse situations on the ups in one minute. ice other than a rule book and a whistle. Topinka has a daily Cell 306-533-5945 It doesn’t really seem fair, does it? routine that he does four- five times a week. He gets 306-331-8833 655 Broad Street, Regina, Sask up at 5 a.m., then does 1-800-667-9976 – taylorautogroup.ca push-ups. After that he has a protein or two, then Help keep your a workout. This helps Wholesale Transmission keep Topinka in shape. SHANNON community’s He encourages everyone & Differential to live a healthy lifestyle Wholesale Prices history alive. and to quote Hulk Hogan TRANSPORT ,PSRUWV 'RPHVWLFV2YHUKDXOV)UHH5RDG7HVWV “take your vitamins, say All Makes & Models Rebuilt in Our Own Shop your prayers.” + Differential +CVA Joints + Clutches + SUBSCRIBE TO YOUR LOCAL NEWSPAPER! When Topinka began #1 in the bin, since 1982 + Universal Joints + Drive Shafts + 4X4 Transfer Cases + weightlifting in 1974, ´7KH3ULFH:H4XRWH··LVWKH3ULFH

Whitewood gymnastics 68%0,77('_*5$66/$1'61(:6 7KH:KLWHZRRG*\PQDVWLFV&OXEÀQLVKHGWKHLUVHDVRQZKLFKUDQWKLV\HDUIURP1RYHPEHUWR0DUFKDWWKH:KLWHZRRG/HJLRQ+DOO7KHJ\PQDVWVZRUN RQDOOOHYHOVDQGVNLOOVXQGHUWKHVXSHUYLVLRQRIFRDFKHV-ROHQH3DLFH0DUWLQD0RQDQGKHOSHU.DFL-RQHV7KHSDUWLFLSDQWVZHUH FORFNZLVHIURPWRS OHIW *URXS-RYL*LURX[.HQGUL[0DYLQ0LLD$OGRXV$VKHU:HVWEHUJ*URXS*HPPD:HVWEHUJ&-'H-DJHU-XGG0DNL*URXS.HOEUHH3DJH 6RÀ$OGRXV%UD\OHLJK0DYLQ0HLND%HDU6DUDK

By Travis Longman nate Patrick Janssen will Thiessen says. “”Every every time. If we play day, April 2 at 11 a.m. Denmark, Italy, Korea, Grasslands News stay with the team in a team here is really good. our A game, I’m expect- (EST) against Scotland. Netherlands, Norway, supporting role. There are no free spots ing to make playoffs and Other countries at the Switzerland and the 2019 “We know World’s will on the bingo card. We’ll then we’ll see what hap- event are the United Champions from Sweden. After three consecu- be tough,” second Brad have to bring our A game pens from there.” States of America, the The top six countries at tive losses in the Brier Team Canada begins Russian Curling Fed- the world championships Championship game, its quest for gold on Fri- eration, China, Japan, qualify for the Olympics. team Brendan Bottcher proved that the fourth Planning on Selling time is the charm. The tandem recently won Some Equipment or the Tim Hortons’ Brier having a Farm Auction? Wellness, Beauty and Holistic and will be representing team Canada at the Men’s World Curling Champion- Need an apprasial Directory ships in Calgary. Team Bottcher has on assets? a new member for the Give our world championships. Marc Kennedy joins the Sales Manager, Yorkton Hearing Services group as an alternate. Trent Guenther, #18 First Avenue North, Yorkton, Sask. S3N 1J4 With Darren Mouldings Your ears deserve an audiologist! status up in the air due a call today to a back injury suffered PERSONAL CARE HOME • Hearing Tests • Hearing Aids 1-306-621-4739 • Repairs • Batteries at the Mixed Doubles Private bedrooms/bathrooms for National Championship, Singles and Couples. • Custom Molds Kennedy could play a Corinne Pauliuk - Owner/Operator pivotal role for the team. Phone: 306-782-1793 The team’s regular alter- Lic 325025 306.699.2548 www.yorktonhearing.com website: carehomes.ca/homes/sunrise-country-haven/ Jacquie Mvula M.S., R. Aud. www.yacauctions.com 9-26c - Odd Located on acreage between McLean & Qu’Appelle Simply Divine

Tammy Oryschak 306-730-5748 306-720-0789 508-7th Ave. West, Melville, SK Online: PERSONAL CARE HOME mytiber.com/tammyoryschak Facebook: Tiber River with Tammy Oryschak Private bedrooms/bathrooms for Singles and Couples. For all your denture needs: Virtual tours provided during COVID-19. Corinne Pauliuk - Owner/Operator Tru-Fit Denture Clinic

'R\RXUSDUWWR 2130B Broad Street, Regina, Saskatchewan S4P 1Y5 SUHYHQWFULPH 306.699.2548 Contact: Located on 28 groomed acres between 306-352-2552 7,36 McLean & Qu’Appelle CALL COLLECT website: carehomes.ca/homes/sunrise-country-haven/ “Doing a smiling business for over a decade and a half” www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 17 Unknown three-year tale for cat named Spooky

By Elaine Ashfield shelters the strays and he recognized Spooky. Grasslands News The cat was described to Deb and she was sure it sounded like her Spooky but the cat by now had been transferred to Angels of Hope Animal Rescue at Some may recognize the line “The Cat Came Back” Esterhazy. The cat was spayed, treated for ear mites as a popular children’s song from over the years but and received medical care at Twin Valley Veterinary to a woman in Whitewood, it is a true story of her cat Services so he could be adopted through the Angels Spooky who has returned to live with her after being of Hope. missing for three years. “I couldn’t afford to pay for the adoption and the The story of their adventures together makes one fees involved for the veterinary services, and espe- believe that they were destined to be together. It was cially when I wasn’t completely sure it was Spooky,” in April 2009 when Deb Karol-Croteau was outside her Deb told the Grasslands News, “but miraculously, a home that is located on the edge of town when she big, white fluffy puppy with the same name as the pup heard a distressing cry from what sounded like a small of my friends’ Michelle and Scott, had apparently paid animal. Upon investigating, she found a 4 to 6-week-old for the cat’s release and last Saturday, he came home!” kitten that probably was abandoned near their home Well, Spooky is happy and so is Deb. She is sure it 68%0,77('_*5$66/$1'61(:6 and had sought refuge in the trees. She tried to cap- Storybook ending is her Spooky as he has the same distinctive marks ture the kitten but it was very untamed and skiddish. A cat named Spooky was reunited with his owner and her Spooky, when he wagged his tail, only wagged Always spooked whenever Deb came near, he soon Deb Karol-Croteau in Whitewood after being gone the end section, not his whole tail and this cat does became known as Spooky and the relationship began. for three years. exactly the same. A cardboard box became a fortress for Spooky and “He hasn’t asked to go out of the house yet and food was faithfully carried to him daily. The fortress is very content to lay looking out the window as if possibly find his remains.” and food were slowly moved closer and closer towards he knows the area of the surroundings outside. He Deb says she prayed many nights that he would the house as efforts were made to tame him but for eventually went upstairs and when I reached my hand come home and her mother, who passed away in Oct. years, Spooky preferred to stay outside in the shelter under the railing from on the stairs to play ‘patty of a house built for him and being fed by the kind peo- 2019, told her “Keep praying, he’ll come home.” paws’ like we used to, he became enthused and playful ple he became to know. Well, as of last Saturday, March 27, Spooky is back right away. “It was the winter of 2017-18 that was so cold that home with Deb. “Our Shitzu dog knew him right away when he Spooky finally came in for the nights to sleep,” Cro- It appears that somehow Spooky had made his way came home and was ready to play. I am sure it is teau told Grasslands News. “It was February 18, 2018 to Broadview. He was captured as a stray cat and was Spooky and I am so blessed to have him back,” Cro- that he wanted out and that was the last time I saw taken to stay at a house in Percival where a White- teau said. him. wood woman shelters stray animals until they can by Spooky is almost 12 years old now and since ‘the cat “He usually always came back every night and taken to a group who will put them up for adoption. came back,’ the reunion has shown that sometimes it when he didn’t return, I kept calling and calling. Liv- A friend of Croteau’s also lives in Percival, near this is fate when things happen in this world and the result ing so close to the highway, I thought possibly he had house and one day was visiting with the woman who often is a very happy ending. been hit by a vehicle, so when spring came, I walked the ditches and the open fields nearby searching to Unidentified Husky remanded by RCMP Sgt. Travis Adams to investigate. Melville / Ituna Detachment RCMP responded to a call that reported a fire at a residence in Melville. No injuries as a result of the fire. RCMP continue to investigate. Reporting period: RCMP were informed that a man found a large 5 March 24 to March 31 h.p. General Electric induction motor and other items Melville and Ituna detachment area had 85 occur- Transform your storefront windows on his property near Neudorf. RCMP continue to in- rences over the past week. vestigate. Traffic A report from a woman to RCMP that two of her During this time, Melville and Ituna detachment 8-foot gates were stolen from her property in Lemberg. # "$!$$!$ responded to 46 reported traffic occurrences or traffic RCMP continue to investigate. stops that resulted in 22 Charges and 22 Warnings. A man contacted the RCMP to report that two radi- # RCMP responded to a report that a train had backed ators and a battery were stolen from his trucks parked into a semi while it was crossing. The train had passed on his land near Grayson. RCMP continue to investi- # through the crossing, and as the tractor-trailer went gate. through, the train backed into his trailer. No injuries A woman contacted the RCMP reporting that she # resulting from this accident. found a Husky dog in her yard unknown to whose it is, posted it on Facebook but received no response. Mischief/Theft/Fraud Members attended and arrested Husky for Cause Dis- A report to local RCMP that there was an attempt turbance. The vet checked Husky and determined no to break into a storage unit near Melville. RCMP con- tag or chip. Husky was booked into Paws and Claws. Serving Melville, Fort Qu’Appelle, Broadview, Grenfell, Whitewood and areas tinue to investigate. If you have information related to these mischiefs, Toll Free: 1-844-GNG-NEWS (ext. 2*9) A person contacted the RCMP to report a break and thefts, or frauds please contact your local RCMP De- Email: [email protected] enter to an ATCO trailer near Ituna. Medication in- tachment, call 310-RCMP for immediate response, or side the trailer was reported stolen. RCMP continue you can call Crime Stoppers at 1-800-222-TIPS (8477). Join Grasslands News 12,000 weekly readers

SUBSCRIBE TO THE FOLLOWING: ❑ Melville Advance ❑ Fort Qu’Appelle Times ❑ Whitewood/Grenfell Herald Sun

Name:

Address:

Town/City: Prov: ✁ ✁ Help to build a stronger community! Postal Code: Phone:

Email Address: WHY SUBSCRIBE? • Stay informed about your community. Payment by: ❑ Visa ❑ Mastercard Expiry • You support local businesses who support you back. ❑ Cheque or Money Order (enclosed) Signature • The newspaper is the community’s only historical record. Please make cheques out to Grasslands News Group Telephone Orders: 306-728-5448 (ext. 227) • A viable newspaper shows a strong community. • It’s less than buying one cup of coffee per week Forms should be mailed to Grasslands News Group, Box 1420, Melville, SK., S0A 2P0

-$0f<6<#9$8-6ধ32 !90W<#9$8-6ধ32 !2!&!<#9$8-6ধ32 Subscribe TODAY! ¥W W¥ W

CALL US TOLL FREE AT 1-844-464-6397 (EXT. 222) 838!;'&8!;'9(389<#9$8-6ধ3299;!8ধ2+-268-£;,3<+,;3'$WTW 2$£<&'&W 18 $SULO 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV *UDVVODQGV1HZV Neighbourly Advice According to ED - Ray Maher You can have any color, as long as it’s black

Ed, my old neighbor, beginning with the San- bas and had Jesus flogged and again with his staff. hands and feet to a cross. crosses. in Saskatchewan fa- hedrin. - that is whipped 39 times. After they grew tired of They gazed at the soldiers Not all the spectators vors black for the color The high priest asked The whipping was in- their cruelty, they led executing their torturous there had hardened unbe- of his truck. He likes to Jesus if He was the tended to weaken a crim- Jesus away to crucify tasks. lieving hearts. Like Mary, quote Henry Ford and his Christ, the Son of God. inal and hasten death him. Lifted up before them, his mother, we came to Model T cars coming off When Jesus answered, during the agonizing tor- On Good Friday, Chris- many mocked the black his cross to gasp, flinch, the assembly line in 1908. “Yes, it is as you say.” ture of crucifixion. After tians remember Jesus and blue Jesus linger- and weep at the mys- Ford said, “You can (Matt. 26:4) 39 lases of the whip, Pi- at the cross. Spectators ing in pains torment be- tery of God’s love for us have any color as long as The high priest pro- late handed a bruised and waited to see him nailed tween two other men on there. it’s black.” claimed that Jesus had bleeding Jesus over to his The first mass-pro- spoken blasphemy, and soldiers to be crucified. duced Model Ts in their the council agreed that The soldiers decided black color were myste- Jesus should die for His to humiliate and abuse Melville’s Churches rious, a drastic change offense. They spat in Jesus as one unworthy of from travel by horses. Jesus’ face, and struck any respect. The soldiers Welcome You Many could not wait him with their fists, and gathered around Jesus, to see one, a Tin Lizzie, slapped him. mocking him by dressing or Leaping Lena as the In the morning, Jesus him in a scarlet robe and 0HOYLOOH$QJOLFDQ/XWKHUDQ(FXPHQLFDO %(7+$1<(9$1*(/,&$/ Model T was called. Peo- was taken to the Roman placing a crown of thorns &RPPXQLW\0$/(& 0,66,21$5<&+85&+ * * * WK$YH: 4XHHQ6W²&KXUFK2IÀFH3K ple would wait and watch Governor, Pilate, so that on his head. They ridi- $//6$,176·$1*/,&$1&+85&+ $SULO 10:30 a.m. Easter Sunday Service if they saw a Model T the Romans would put culed him, saying, “Hail, Corner 6th Ave. E. & Main St. coming down the street. It Jesus to death by cruci- king of the Jews!” They &KXUFK2IÀFH 0(/9,//(3(17(&267$/&+85&+ was worth a good gaze or fixion. spat on Jesus and struck 673$8/·6/87+(5$1&+85&+ 115 - 11th Ave. W. gasp, a flinch at its speed Not convinced that him on his head again UG$YH(2IÀFH3K 3DVWRU'RXJ%UDXQ²2IÀFH3K 2IÀFH+RXUV0RQ7KXUVDPQRRQ HPDLOPSF#VDVNWHOQHW and sound. Jesus deserved the death 3DVWRU.LP6KHUZLQZZZVWSDXOVPHOYLOOHFD www.facebook.com/melvillepentchurchsk The color black has penalty, Pilate tried to $SULO,Q3HUVRQ6HUYLFH been a sign of modest suggest Jesus could be set VALLEY ALLIANCE 7KXUVGD\$SULO 7:00 p.m. Worship with Holy Communion 3OHDVHMRLQXVRQ)DFHERRNDW0HOYLOOH3HQWHFRVWDO&KXUFK DW6W3DXO·V dress in clothing or cloth- free at the Feast by him- CHURCH Fort Qu’Appelle )ULGD\$SULO 11:00 a.m. Worship at First United ing that denotes power or self as the governor. The 6XQGD\$SULODP:RUVKLSDW$OO6DLQWV· *22'6+(3+(5'/87+(5$1&+85&+ WK$YH:²3K authority as in a business crowd demanded Barab- Sunday service 10:30 a.m. DP:RUVKLSZLWK+RO\&RPPXQLRQDW6W3DXO·V Service is also available on YouTube and will be $OOVHUYLFHVDW6W3DXO·VFDQEHVWUHDPHGOLYHRQ 3DVWRU'RXJ6FKPLUOHU suit. Black is often associ- bas, another prisoner, facebook.com/gslcmelville livestreamed. Please call the church at 306-900-0600 )DFHERRN6XQGD\PRUQLQJOLYHVWUHDPVVWDUWDWDP ated with death, sin, evil, be pardoned instead of for information regarding COVID-19 regulations $SULO 10:30 a.m. Good Friday Worship Service, suffering and sorrow. If Jesus. ,Q3HUVRQDQG2QOLQH or check our website: valleyalliance.ca ),56781,7('&+85&+ $SULODP(DVWHU:RUVKLS6HUYLFH,Q3HUVRQDQG2QOLQH someone is beaten, they Pilate released Barab- 5th Ave. E. & King St. are described as hav- 2IÀFH+RXUV ing bruises of black and Mon., Tues., Thurs., 9 a.m. - 12 noon 67*(25*(·68.5$,1,$1 3K &$7+2/,&&+85&+ blue. A black eye results 5HY%ULDQ0HH3K Corner of 3rd Ave. E. & Manitoba St. in everyone asking what ZHEVLWHÀUVWXQLWHGPHOYLOOHRUJ Fr. Basil Malowany or who caused it. People 7KXUVGD\$SULO 7:00 p.m. Maundy Thursday Service EDVLOPDORZDQ\#JPDLOFRP² will wait, gaze, gasp, per- DW6W3DXO·V )ULGD\$SULOSP6HUYLFHDWWKH7RPE )ULGD\$SULO 11:00 a.m. Good Friday Service 6DWXUGD\$SULOSP5HVXUUHFWLRQ0DWLQV'LYLQH/LWXUJ\ haps flinch at a black eye with Rev. Brian Mee and Blessing of Baskets because it calls for atten- WHITEWOOD AND AREA 6XQGD\$SULO 11:00 a.m. Easter Worship Service 7XHVGD\$SULO 6:30 p.m. Bright Tuesday Divine Liturgy with Rev. Brian Mee Please 1RWH3DULVKLRQHUV0867UHJLVWHUKRXUVLQDGYDQFHIRU tion. KNOX WAPELLA CHURCH each service. Contact 306-728-3813. Black is the color PRESBYTERIAN CHURCH OF THE NAZARENE associated with Good Services - 10:00 a.m. Service – 11:00 a.m. 7+(5,9(5&+5,67,$1&(17(5 Rev. Seon Ok Lee Sunday School – 10:00 a.m. Friday, which is the re- (A Church with a Caring Heart) 67+(15<·6520$1 NEW LIFE 3rince Edward St. (Melville Comm. Works) &$7+2/,&&+85&+ membrance of the death COMMUNITY CHURCH ST. JOSEPH’S ROMAN 3K3DVWRU7LP2HKOHU 0DLQ6W²2IÀFH3K CATHOLIC CHURCH 5HV3K²WK$YH: of Jesus by crucifixion. 6XQGD\ 10:00 a.m. Doors Open – 10:30 a.m. Worship Service Worship Service ~ 10:30 a.m. )DWKHU$QGU]HM6RZDOMI After his arrest, Jesus Wed. ~ Kids Club ~ 3:30 - 5:00 p.m. *April 1 - Holy Thursday, 5:00 p.m. 3UHUHJLVWUDWLRQLVZHOFRPHGEXWQRWUHTXLUHG 6DWXUGD\0DVV: 7:00 p.m. 6XQGD\0DVV 10:00 a.m. received black treatment, Held at New Life Church *April 2 - Good Friday, 3:00 p.m. 0RUHLQIRUPDWLRQDYDLODEOHRQOLQHDW (Ages 5 - 10) *April 3 - Easter Vigil, 6:00 p.m. Website: www.melvilleriverchurch.org Fri. ~ Youth Group ~ 7:00 p.m. )DFHERRN3DJH#PHOYLOOHULYHUFKXUFK =,21/87+(5$1&+85&+ (Ages 11 & Up) 5HFRUGHGVHUYLFHVZLOOFRQWLQXHWREHSRVWHGRQOLQH (Lutheran Church - Canada) ST. JOHN’S LUTHERAN Pastor Doug Lancaster CHURCH, WAPELLA WK$YH:²&KXUFK2IÀFH3K 3XEOLVKHG (PDLO]OFSDVWRU#P\DFFHVVFD EVANGELICAL MISSIONARY *No Services until futher notice 0(/9,//(%$37,67&+85&+ th Ave. W. Website: www.zionlutheranmelville.com )ULGD\V Sunday School – 10:30 a.m. Sunday Service – 10:30 a.m. ST. MARY’S ANGLICAN 2IÀFH3K3DVWRU-RQ3HWWLQJHU )ULGD\$SULO 11:00 a.m. Good Friday Worship Service Visit us at Friday Youth Bible Study – CHURCH 6XQGD\6HUYLFH7LPHV 9:30 and 11:15 a.m. 6XQGD\$SULO 11:00 a.m. Easter Worship Service grasslandsnews.ca 6:00 p.m. *Services CANCELLED 3UHUHJLVWUDWLRQLVUHTXLUHG Church of the Lutheran Hour heard Sundays at 9:00 a.m. Pastor Samuel Jung until further notice 2QOLQHVHUYLFHVFDQEHIRXQGDWwww.melvillebaptist.com RQ&-*;5DGLR

TYMIAK’S MONUMENTS & GRAVE SURFACING CO. Granite, Bronze, Marble Monuments, Grave Covers, Vases, $UWLÀFLDO)ORZHUV&HPHWHU\,QVFULSWLRQVDQG&UHPDWLRQ8UQV GRANITE, MARBLE, • Monument Sales )8//<*8$5$17(('²/,&(16('$1'%21'(' BRONZE MONUMENTS 6HH2XU Second Inscriptions • Lettering on /DUJH'LVSOD\ Vases, Cremation Urns Monuments & Markers 529 Main St. South, /LFHQVHGDQG%RQGHG Box 476, Ituna, Sask. S0A 1N0 CAROLE ARMSTRONG Directory Ph. (306) 795-2428 'HQQLV7HPSOH 306-332-1335 Serving Surrounding Areas Since 1960 or 306-728-8197

Tubman Funeral Home Check our pricing – You will be Cremation and Funeral Services glad you did! Family Owned and Operated Located at 5th Ave. W and Main St., Melville, SK Denton Keating 210 Claude Street “Treating Your Family like a part of P.O. Box 351, Wolseley, SK S0G 5H0 Did You Y Know? K ? If you have h a prearranged funeral plan with another funeral Ours for 4 Generations” Tel.: 1-306-698-2557 home you have the right, by law, to transfer that plan to any other funeral 1-800-667-8962 home in the province, often at no charge to you. Fax: 1-306-698-2559 Raymond and Crystal Bailey, Honoured Provider Dignity Memorial® Call us for details! Don Klus and Len Varga [email protected] Authorized agent for Canada Purple Shield / Familyside. Elden Conley LFD / LE / CCT - Owner / Manager

Authorized Agents for www.tubmanfh .com ZZZEDLOH\VIXQHUDOKRPHFRP Summit Memorials Ltd. FORT QU’APPELLE – 306-332-0555 WOLSELEY – 306-698-5000 266 Boundary Ave. N. 900 Front Street Matthews Funeral Home Melville’s only locally-owned funeral home. %UDQFKRI¿FHLQ:KLWHZRRG %XULDODQGFUHPDWLRQVHUYLFHVJULHIVXSSRUW FHPHWHU\PHPRULDOVQRWDU\SXEOLF 0HOYLOOH²:KLWHZRRG Mark and Gaylene Matthews and staff www.conleyfuneralhome.ca RAYMORE – 306-746-1000 116 Main Street PDWWKHZVIXQHUDOKRPH.ca Like and follow us on facebook for the latest obituary updates. www.grasslandsnews.caCLASSIFIEDS0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 19 ONE AD, THREE NEWSPAPERS: All classified ads appear in the Melville Advance, Fort Qu’Appelle Times and Whitewood/Grenfell Herald Sun

Alfred John Timmerman Memorium Card of Thanks Real Estate Happy 65th Anniversary Obituary Nov. 25, 1938 – March 24, 2021 ISSEL – In loving memory of A heartfelt thank you to LAKE LOTS FOR SALE: Chorney Beach, Fishing Lake. 55 x 135 fully It is with heavy hearts our dear father, grandfather and all who sent cards, phone calls, great-grandfather, Louie, who and condolences after the pass- serviced with electrical, natural gas that we announce the pass- passed away April 2, 1989. LQJ RI *UD\·V PRWKHU DQG P\ and water. For more information ing of Alfred Timmerman on 7KRVHZHORYHGRQ·WJRDZD\ partner, Elvira. contact Peter at 306-229-0251. Wednesday, March 24, 2021 They walk beside us every day, We give special thanks to Dr. Unseen, unheard, but always near Eshawesh for his personal care at the age of 82. Still loved, still missed and very over the years. A tip of the hat For Rent Alfred was born on Nov. dear. WR WKH VWDII RI 6W 3HWHU·V +RVSLWDO 25, 1938 in Lake Lenore Sask. –Forever loved and remembered by for the loving care they supplied FOR RENT – 1- and 2-bedroom He married Joan Puetz on Arnold and Jane, Gladys and Don, the times when Elvira was in and DSDUWPHQWV LQ 6TXLUH·V &RXUW Carol and Art and families. 9-1p out of the hospital and to Kim Melville. Appliances included. Phone July 2, 1962 and they settled Rutzki and the health nurses that 306-728-3652, 306-728-3539 or in Englefeld, Sask. Alfred be- did so much. 306-607-9071. 5-8tfp gan his career on the CNR in To Rev. Mee who stopped into her room at the hospital and offici- $%(51(7+< +286,1* $XWKRULW\ July 1955. His railroad career ated at the graveside service. Thank has one 2 bedroom seniors suite took him to Watson, Weyburn you again to the pallbearers. To and two 1 bedroom duplex apts and eventually Melville where &DUPHQIURP&DUPHQ·V(OHJDQFHLQ available for rent. For more informa- Flowers – the roses were beautiful. tion contact Anne Marie Moulding, he retired in May 1993. He be- housing manager, at 306-335-7638. %DLOH\·V)XQHUDO+RPHZKRKDQGOHG Happy 65th Anniversary 2-12tfc JDQD³VHFRQGFDUHHU´ZRUNLQJIRU6W+HQU\¶V&KXUFK¿QDOO\ everything – very professional and John and Mary Williams with compassionate guidance. retiring for good in 2003. )25 5(17 ² %DOFDUUHV +RXVLQJ /RYHIURP Alfred was very involved in the community. He was a To each of you, your thought- Authority has a 1 bedroom seniors Debbie, Donna, Sandra, Joni fulness will remain in our hearts member of The Knights of Columbus, active within St. suite available for rent. For more Family and Friends forever. information contact Anne Marie Henry’s Church and was on the Senior’s Board. Alfred was –Gray and Bev Lysechko and family; Moulding at 306-335-7638. an avid golfer and a member of the Melville Golf Club. He Bob Martin and family. 9-1p 52-12tfc also participated in seniors curling and bowling. He was Happy 75th Birthday a passionate Saskatchewan Roughriders fan and a sea- For Sale Help Wanted son-ticket holder with the Melville Millionaires. Alfred will be lovingly remembered by his wife Joan; )25 6$/( ² +XEFDSV DQG XS MANAGEMENT POSITION at children: Stan (Michelle) Timmerman, David (Marivic) dog dishes, beauty rings, bumpers, %URDGYLHZ +RXVLQJ $XWKRULW\ $ Timmerman, Jackie (Mike) Hickie, Colleen (Lyle Zimmer) 60s, 70s, 80s, like new; center contract manager is required for KOLODZIEJAK – Adeline, April 2, pieces. Big YARD SALE in April. Timmerman and Brian (Stacy) Timmerman. He will be deep- the management of the Broadview 2015. Goodeve, 306-876-2106. 9-2p +RXVLQJ $XWKRULW\ 7KH VXFFHVVIXO O\PLVVHGE\KLVJUDQGFKLOGUHQDQG¿YHJUHDWJUDQGFKLO Six years have passed since we candidate will report to the board of dren; as well as his siblings, Jack (Judy), Sylvia (Burt), Pat, said goodbye to a special woman Farmland directors and be responsible for the Edna, Linda (Larry) and Judy (Ken). He was predeceased ZKR·V VPLOH OLWH XS WKH URRP ZKLOH day to day operations of the housing her laugh filled it. authority. The housing portfolio con- by his parents; his son Kevin; his great-grandson Spencer; We find comfort in the memo- LOOKING FOR 1 or 2 quarters of sists of 26 senior housing units and his sister Rita; and his brothers, Ron, Ed and Leo. ries – the milestones, helping each cultivated grainland within a 30-mile 3 family housing units. Prayer service were held on Sunday, March 28, 2021 at other through tough times, proud radus of Whitewood. Will pay going Required Knowledge, Skills moments and the laughter that we 7 p.m. from St. Henry’s Roman Catholic Church in Melville. UDWH IRU WKH DUHD ,I LQWHUHVWHG and Abilities: Financial analysis, shared. email me at: [email protected] accounting and budgeting; good Funeral mass was celebrated on Monday, March 29, 2021 Even though she is no longer 38-4c computer skills (Word, Excel, Email); at 10 a.m. from St. Henry’s Roman Catholic Church with here, she continues to be part of property management experience; Rev. Fr. Andrew Sowa, OMI, as the Celebrant. each new memory as we always good oral and written communication think about what she would have For Sale by Tender skills; good interpersonal skills; well Arrangements were by Bailey’s Funeral and Cremation said or done and how much shop- organized; ability to maintain confi- If you see this guy around, Care, Melville. ping she would have been able to dentiality. wish him a pull off with social distancing. FOR SALE BY TENDER Required Duties: Application +DSS\WK%LUWKGD\ We miss her dearly and cherish RM 216 management; rent collections, +DSS\%LUWKGD\*UDQGSD each memory we share. We know PT NE 33-23-11 W2, approx. 109 including arrears and other charges; she is that bright light that shines DFUHV +LJKHVW RU DQ\ WHQGHU QRW income verification and rent calcula- www.baileysfuneralhome.com down on us. necessarily accepted. Tenders close tion; supervising and co-ordinating “Perhaps they are not stars, but March 29, 2021. For more informa- caretaking and maintenance ser- Province Wide rather openings where our loved tion call 306-807-7472 or submit vices; preparing scopes of work, ones shine down to let us know tender to: farmlands.sask@gmail. obtaining quotes for work and FORAGE SEED FOR SALE: they are happy.” -Inuit Proverb com 6-4c administering contracts; preparing Organic & conventional: Sweet –Love, all your family. budgets and monitoring financial Ottillia (Tillie) Wiwchar Clover, Alfalfa, Red Clover, Smooth 9-1p results; preparing reports and rec- Obituary Brome, Meadow Brome, Crested April 24, 1928 – March 9, 2021 Auctions ommendations to the board of direc- POPIUK – Gerry, June 1, 1958 - Wheatgrass, Timothy, etc. Star City, tors; attending board meetings and April 4, 2018. SK. Birch Rose Acres Ltd. 306-921- QUICK SOLD AUCTION training sessions. 9942. It is with great sadness that Serving Southeast Saskatchewan. As a contract manager the suc- we announce the passing of Let us help you sell your items, get- cessful candidate will be responsible ADVERTISEMENTS and state- Ottillia (Tillie) Phyllis Wiwchar ting you the best possible price in for operational costs and have use ments contained herein are the sole the least amount of time. Items will of their own vehicle, computer and responsibility of the persons or enti- (née Hahn). She is survived by get Canada-wide coverage with our software equipment. ties that post the advertisement, her three children, Rosema- Online auction. Closing Date: April 23, 2021 and the Saskatchewan Weekly rie Thompson, Ron (Sherry) Specializing in antiques, vintage Please provide a cover letter Newspaper Association and mem- Wiwchar, and Margaret (Ralph) and collectible items of all kinds. with your resume outlining how your bership do not make any warranty Certified personal property ap- knowledge, skills and abilities match as to the accuracy, completeness, Woloschuk; her six grand- SUDLVHU'RQ·WWKURZDQ\WKLQJDZD\ those we are seeking and forward in truthfulness or reliability of such children, Heather (Eli) Buzila, until you talk to us. confidence to: Myles Norbeck, chair- advertisements. For greater infor- Adam (Lacey) Thompson, Blair Free consultations call person, Box 747, Broadview SK, mation on advertising conditions, 306-728-5552 or 306-730-7310 S0G 0K0; email: cilo1613@sasktel. SOHDVH FRQVXOW WKH $VVRFLDWLRQ·V (Kaye) Wiwchar, Keith (Tracy) quicksoldauctions.com net 41-2c Blanket Advertising Conditions on Wiwchar, Tara Woloschuk, PL#508277 our website at www.swna.com 7-tfc and Brandon Woloschuk; and PROVINCE-WIDE CLASSIFIEDS. her three great-grandchildren, Reach over 550,000 readers weekly. Alys Buzila, Dawn Wiwchar, and Emma Wiwchar. Call this newspaper NOW or 306- Now hiring 649.1405 for details. Tillie was predeceased by her parents, George and ,·P6WLOO+HUH Eleanor (née Geib) Hahn; her husband, William (Bill); and ,PD\EHJRQHEXWSOHDVHGRQ·WFU\ CROP HAIL numerous family members. Death is not the last goodbye. ADJUSTERS Death releases me of my pain for the 2021 hail season Tillie was born in Lestock, SK, on April 24, 1928. Her There will come a day we will (Jul-Oct). IDPLO\ OLYHG RQ VHYHUDO IDUPV DQG ¿QDOO\ VHWWOHG LQ WKH meet again. CERTIFIED SEED 'RQ·WEHEOXHDQGGRQ·WEHVDG Competitive salary, Melville, SK, area. WHEAT Think back to the fun we had. expenses & mileage GO EARLY, PINTAIL. Tillie and Bill married on Feb. 5, 1949. Tillie loved cook- I am always here, I hear you paid, health spending OATS ing, baking, gardening and sewing; she also loved visiting speak account and pension ,QWLPHRIWURXEOHLW·VPH\RXVHHN AC JUNIPER, AC MORGAN, with family at get-togethers. While their children were young, AC MUSTANG, DERBY, plan. Continuous MAVERICK, employment? Retired or Hawaii. Tillie and Bill enjoyed doing many things together: 6HH\RXDJDLQLW·VQRWJRRGE\H CERVEZA, SUNDRE. semi-retired - this job is for you! Join our team watching current affairs and sports on TV and playing crib- –Love Always, Rhonda and Spike. PEAS 9-1p and start your new bage, dominoes, beanbag toss and golf. AAC PEACE RIVER (VERY EARLY YELLOW), career. Tillie was taken wonderful care of by the staff at Foyer Visit us online at CDC HORIZON (FORAGE), Email: Lacombe in St. Albert, AB, for the last four months of her POLISH CANOLA, [email protected] life. She passed away very peacefully with Rosemarie and grasslandsnews.ca SPRING TRITICALE for more details and Margaret by her side. mastinseeds.com application form. Memorial donations may be made to the Heart and 306-728-5448 403-556-2609 306-569-1852 ext 170. Stroke Foundation in your province. There will be no funeral, by request of the family. The viewing and cremation were entrusted to Connelly-McKinley CLASSIFIED RATES 1 week: $12.00 • 2 weeks: $18.00 • 3 weeks: $24.00 • 4 weeks: $28.00 Funeral Home in St. Albert. Tillie’s cremains will share the Additional weeks: $2.50 • Deadline: Tuesdays at 12 noon niche with Bill’s cremains at St. John’s Cathedral in Saska- (based on 25 words or less) toon, SK. Obituary Deadline Tuesdays 12 Noon 1-844-GNG-NEWS 20 April 2, 2021 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News City of Melville combines two committees

By Emily Jane Fulford Development and Events Tourism the opportunity Committee and the Rec- to allow for tourism con- sory Committee meets at Grasslands News Manager. to operate without the reation, Culture and Lei- cerns to be discussed the Horizon Credit Union “We have recognized whole board. The man- sure Services Advisory without the need for a Centre; but due to COVID the challenge and have ager of Recreation and Committee, due to lack of separate board. There is the meetings are being The City of Melville decided to move forward Programming and the interest in the Tourism no change of offices, as held online.” will be combining the in a new direction. I did manager for Communica- Committee as of late,” the boards do not have Because the commit- Recreation, Culture and not want to lose the tour- tions, Community Devel- says Amber Orr, execu- tees are volunteer-run, Leisure Services Advi- their own dedicated of- ism representation in our opment and Events were tive assistant, office of the there are no financial im- sory Committee and the fices. community. I approached notified about the bylaw. City Manager. plications to the merger. Tourism Advisory Com- The Recreation, Cul- the Recreation Manager, “Recreation, culture “Merging the two mittee into one commit- ture and Tourism Advi- indicating the challenge and tourism go hand in boards into the “Rec- tee. of attaining board mem- hand. Some of the main reation, Culture and The reason behind the bers and proposed merg- reasons people visit Mel- merger is that the Tour- Tourism Advisory Com- ing a tourism member ville are because of rec- mittee”, adds a Tourism ism Advisory Committee into the Recreation, Cul- reational and cultural had not had enough vol- position to the existing ture and Leisure Services activities so it really is Recreation Committee unteers in the last few Advisory Committee. a natural fit,” says Stein. 'R\RXUSDUWWR years. The City plans to After some discussion, “Therefore, we have SUHYHQWFULPH add a tourism position to it was agreed this merge drafted an updated bylaw the Recreation, Culture would be a good fit due for the Recreation, Cul- and Leisure Services Ad- to the fact that the Rec- ture and Tourism Advi- &RQWDFW visory Committee. reation, Culture and Lei- sory Committee.” 7,36 They are also doing sure Services Advisory It is often the case that away with the term “lei- Committee consists of when a new bylaw is cre- sure services” and a re- members representing ated which combines two vised committee is now youths, seniors, parks, previous bylaws, then HEAVY DUTY MECHANICS & named “The Recreation, community organiza- the previous two bylaws Culture and Tourism Ad- 1A TRUCK DRIVERS tions, surrounding rural are no longer in effect REQUIRED: visory Committee.” areas, school councils/ because the new one re- Class 1 Owner Operators “Over the past few boards and heritage.” Late model, clean CAT, places them both. HIP/KNEE JD equip; winch, dump, needed to haul bulk liquid years, we have had According to the City “Essentially, this Replacement? gravel trucks, and products throughout MB, trailers. Both camp and challenges filling board of Melville, the Tourism merger was done between Other medical SK, AB and the Northern shop locations; R & B member positions on the Advisory Committee has conditions causing United States. the Tourism Advisory provided Tourism Board,” says been, for a time, inactive. TROUBLE WALKING tĞŽīĞƌĚĞĚŝĐĂƚĞĚ Jeniffer Stein, Commu- Combining the two com- or DRESSING? Wage negotiable. dispatch, well maintained Clean drivers abstract equipment serviced at nications, Community mittees into one will give Dale’s Painting The Disability Tax a must. Credit allows for our own facility, modern technology, pension and $2,500 yearly tax Send resume and 306-728-4392 ŚĞĂůƚŚĐĂƌĞďĞŶĞĮƚƐ͘ credit and up to work references to: LANE REALTY 602 - 8th Ave. W. Bryden Construction Loaded & empty miles paid! $50,000 Lump sum )V_(YIVYÄLSK:R Phone: 204.571.0187 ESTERHAZY - DFUHV%XQJDORZZVKHOWHUHG\DUGOLYHVWRFN Melville tfn/2nd refund. :,(" IDFLOLWLHVYDOOH\WRSRJUDSK\ Apply NOW; quickest Fax: 306-769-8844 RESUMES: JEDBURGH -DFUHVFXOWDVVHVV\DUGVLWHSOLD refund Nationwide! ,THPS! Email: ƌĞĐƌƵŝƟŶŐΛ ZZHOO FDWWOHVKHOWHU1:RI-HGEXUJK Providing assistance brydenconstruct@ renaissancetrans.ca KIPLING -DFUHV·V%XQJDORZZDGGLWLRQDQGDWWDFKHG xplornet.ca during Covid. Fax: 204.727.6651 JDUDJHRQ+Z\*RRGHQ6KHG www. MELVILLE DFUHVFRPPHUFLDOO\]RQHG·[·VKHGOR Expert Help: brydenconstruction KŶůŝŶĞƉƉůŝĐĂƟŽŶ͗ cated adjacent to Melville! 1-844-453-5372 andtransport.ca www.renaissancetrans.ca MOOSOMIN - DFUHVôVWRUH\ZVKHOWHUHG\DUGFRPPHUFLDOSOLD EXLOGLQJRQ+Z\ WHITEWOODDFUHVô6WRUH\OLYHVWRFNIDFLOLWLHVZEDUQVSOLD TXRQVHWVKHG WHITEWOOD -DFUHV DFUHSDUFHOVRQHZLWKYDFDQW KRPHZHOOSRZHU WHITEWOOD -DFUHVDFUHSDUFHOORFDWHG:HVWRI:KLWHSOLD ZRRG Available Immediately Whitewood Housing For all of your buying or selling needs.... Contact: Authority has DOUG JENSEN: 306-621-9955 onebedroom senior suites JASON BEUTLER: 306-735-7811 for rent. Units supplied with heat, appliances, ! !$"$ "#!$#"$!$ private parking and sewer/water. Personal response system available upon request. Damage $ deposit required. Rent subsidy available. WITH OVER 39 YEARS IN THE BUSINESS PH: 306-569-3380 EMAIL: [email protected] Ph: 306-735-2517 $$$ $ www.lanerealty.com $ $ $ $ $ $ TAX ENFORCEMENT LIST VILLAGE OF ABERNETHY PROVINCE OF SASKATCHEWAN 1RWLFHLVKHUHE\JLYHQXQGHUThe Tax Enforcement ActWKDWXQOHVVWKHDUUHDUVDQG FRVWVDSSHDULQJRSSRVLWHWKHODQGDQGWLWOHQXPEHUGHVFULEHGLQWKHIROORZLQJOLVWDUHIXOO\ SDLGEHIRUHWKHWKGD\RI-XQHDQLQWHUHVWEDVHGRQDWD[OLHQZLOOEHUHJLVWHUHG DJDLQVWWKHODQG 1RWH$VXPIRUFRVWVLQDQDPRXQWUHTXLUHGE\VXEVHFWLRQ RIThe Tax Enforcement ActLVLQFOXGHGLQWKHDPRXQWVKRZQDJDLQVWHDFKSDUFHO DESCRIPTION OF PROPERTY K &RVWV 7RWDO Part of 7RWDO Lot Lot %ON Plan 7LWOH1R Advert- $UUHDUV $UUHDUV LVLQJ DQG&RVWV Part of Sec Sec 7ZS 5DQJH 22-24 2 9-10 3 22 3 3 101244990 13-14 4 4 9-10 13 19 11 & 12 & 11-13 12 & 12 & 11-12 %'K+!(!)K%*'K,(!)K)KHHH >62E@1D /A=K Dated this 2nd day of April, 2021. Sheree Emmerson, Treasurer www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 21 Three youth damage vehicle with water balloon

By Sabrina Bailey agreed to replace a wind- before the court. 310-rcmp instead in the Authority in issuing a report of insurance fraud Fort Qu’Appelle Detachment shield after smashing it Other Incidents future. COVID non-compliance involving a damaged with a water balloon. The A company was ad- Police were quick to ticket to an individual for truck reported stolen. The Reporting period: youth were warned about vised to not cash a cheque $2,800. matter is under investiga- stunting and abiding by respond to the report they had received as it March 23 to March 29 Police have received a tion. licence restrictions. of a missing youth. The came with suspicious cir- Fort Qu’Appelle de- youth was located walk- tachment dealt with 109 Crimes Against the cumstances. The cheque ing along the highway came with a request to occurrences over the past trying to make his way to ASSESSMENT ROLL NOTICE week. Person/Property clean a property, but to A female reported a friend’s house. While on also use the extra cash to 50RI6WDQOH\1R Traffic being assaulted, pre- route to his house mem- pay movers. The cheque 1RWLFHLVKHUHE\JLYHQWKDWWKH$VVHVVPHQW5ROORIWKH5XUDO A speedster was issued vented from leaving a bers crossed paths with came from BC and the 0XQLFLSDOLW\RI6WDQOH\1RIRUWKH\HDUKDVEHHQSUH SDUHGDQGLVQRZRSHQWRLQVSHFWLRQDWWKHRIILFHRIWKH$VVHVVRU a $843 fine for driving residence and prevented the youth’s grandfather envelope was stamped who was also out search- IURP DP WR 1RRQ DQG IURP WR SP RQ WKH IRO more than 50km/h over from calling the police. in France. A male was ORZLQJGD\VGXULQJQRUPDORIILFHKRXUV)ULGD\0DUFK the speed limit. He also Investigations deter- ing. The youth was re- arrested for breaching ²)ULGD\0D\ received a $150 fine for mined that the female was turned to his family. his conditions after con- $ %\ODZ SXUVXDQW WR 6HFWLRQ RI The Municipalities Act using the shoulder as a highly intoxicated and An individual phoned tacting an individual on KDVEHHQSDVVHGDQGWKHDVVHVVPHQWQRWLFHVKDYHEHHQVHQWDV passing lane. told to leave. She started 911 to find out informa- snapchat. UHTXLUHG tion about his charges. The RCMP assisted $Q\SHUVRQZKRZLVKHVWRDSSHDODJDLQVWKLVRUKHUDVVHVV Members located an in- hitting and scratching PHQWLVUHTXLUHGWRILOHKLVRUKHUQRWLFHRIDSSHDODORQJZLWKD toxicated driver after re- an individual so she was They were advised to call the Saskatchewan Health DSSHDOIHHZKLFKZLOOEHUHWXUQHGLIWKHDSSHDOLVVXFFHVV ceiving a tip. The driver kicked out. The person IXOZLWK was arrested and charged. she reported stopped her 7KH6HFUHWDU\RIWKH%RDUGRI5HYLVLRQ The vehicle has been im- from calling the police 506WDQOH\1R was not at the residence 32%R[0HOYLOOH6DVN6$3 pounded for 60 days. E\WKHVWGD\RI0D\ Tickets issued: Drive at the time. 'DWHGDW0HOYLOOH6DVNWKLVWKGD\RI0DUFK without a licence, speed- The investigation of an 'DZQ2HKOHU$VVHVVRU ing, disobey stop sign, assault complaint has led licence plate on wrong to charges of sexual as- vehicle, fail to wear seat- sault, assault, and resist belt, excessive damage arrest being laid. The ac- to windshield and drive cused will also be charged 72:1)25(0$1 while using cellphone. with breaching condi- 7RZQRI%URDGYLHZ tions on another file. Mischief A male called 911 after 7KH7RZQRI%URDGYLHZLVDFFHSWLQJDSSOLFDWLRQVIRU Police are investigat- an intoxicated female WKHSRVLWLRQRI7RZQ)RUHPDQ7KLVLVDSHUPDQHQWIXOO NOTICE WLPHSRVLWLRQZKLFKLVGLUHFWO\UHVSRQVLEOHWRWKH7RZQ·V ing a report of a vehicle damaged some of his be- 3XEOLF :RUNV &RPPLWWHH DQG LV UHVSRQVLEOH WR GLUHFW damaged while parked longings. He locked her ASSESSMENT ROLL 2021 FRQWURODQGDGPLQLVWHUDOORSHUDWLRQDODVSHFWVRI3XEOLF at the ski hill during the out of the house and she :RUNV day. left. Members patrolled Village of Killaly $SSOLFDQWVPXVWSRVVHVVDPLQLPXP*UDGH*(' Police used discretion looking for the female; 1RWLFHLVKHUHE\JLYHQWKDWWKHDVVHVVPHQWUROOIRUWKH YDOLG &ODVV 'ULYHU·V /LFHQVH DQG KDYH RU EH ZLOOLQJ and are applying alterna- she was located and ar- 9LOODJH RI .LOODO\ IRU WKH \HDU KDV EHHQ SUHSDUHG DQGDEOHWRREWDLQWKHLU:DWHU7UHDWPHQWDQG'LVWULEX tive measures instead of rested. She was released DQG LV RSHQ WR LQVSHFWLRQ LQ WKH RIILFH RI WKH DVVHVVRU WLRQ/HYHO,,&HUWLILFDWLRQDQG:DVWHZDWHU&ROOHFWLRQDQG involving the courts for on conditions once sober IURPSPWRSP:HGQHVGD\·VIURP0DUFK 7UHDWPHQW/HYHO,&HUWLILFDWLRQ three youth. The youth and will need to appear WKURXJK0D\ ,QGLYLGXDOVWKDWDUHVHOIPRWLYDWHGZLWKRUJDQL]DWLRQ $E\ODZSXUVXDQWWR6HFWLRQRIThe Municipalities DOVXSHUYLVRU\FRPPXQLFDWLRQDQGPDQDJHPHQWVNLOOV ActKDVEHHQSDVVHGDQGWKHDVVHVVPHQWQRWLFHVKDYH DUHHQFRXUDJHGWRDSSO\3UHYLRXVH[SHULHQFHLQRSHUDW EHHQVHQWDVUHTXLUHG LQJDQGPDLQWDLQLQJODUJHHTXLSPHQWDOVRSUHIHUUHG $Q\SHUVRQZKRZLVKHVWRDSSHDODJDLQVWKLVRUKHU 6XEPLW UHVXPHV VWDWLQJ H[SHULHQFH FHUWLILFDWLRQV VDODU\H[SHFWHGDQGUHIHUHQFHVE\)ULGD\$SULO DVVHVVPHQWLVUHTXLUHGWRILOHKLVRUKHUQRWLFHRIDSSHDO DWSPWR DORQJ ZLWK WKH UHTXLUHG DSSHDO IHH E\ WKH WK GD\ RI 7RZQRI%URDGYLHZ [email protected] 0D\WR 32%R[%URDGYLHZ6DVN6*. 7KH6HFUHWDU\RIWKH%RDUGRI5HYLVLRQV 3KRQH 1-844-GNG-NEWS P.O. Box 69 )D[ .LOODO\6.6$; HPDLOWRZQRIEURDGYLHZ#VDVNWHOQHW 1-844- 464-6397 'DWHGWKLVWKGD\RI0DUFK The Town of Broadview would like to thank all who &U\VWDO&DPSEHOO apply, however, only those selected for an interview will www.grasslandsnews.ca $VVHVVRU9LOODJHRI.LOODO\ be contacted.

STILL OPEN FOR BUSINESS We are still here to serve you, at a social distance of course! RENOVATIONS & BOBCAT WORK • Concrete driveways, walks & garage pads installed Contractors and Home • Paving stone driveways & walks installed • Paving stones releveled Free estimates, 24 hour emergency service • Yard clean-up Danny Currie, Journeyman Electrician Directory [email protected] Brian Gordon Fort Qu’Appelle, SK 306-331-6588 echoelectric.ca Locally owned and operated serving fort qu’appelle and 1-306-530-4550 surrounding area call or email today!

-LP·V5RRÀQJ Pole Buildings Home - Kitchen - Bath +RW5RRÀQJ6KLQJOLQJ Everything for your home under one roof. 6QRZ5HPRYDOIURP5RRIV 7UDFNKRH'R]HU/RDGHU • HARDWOOD • CARPET • LAMINATE • LUXURY VINYL )5(((VWLPDWHV *UDGHU6NLG6WHHU • TILE • AREA RUGS & MORE +\GUR9DF7UXFN%DFNKRH Jim Anderson 7UXFNV *UDYHO /RZ%R\ 6SHFLDOL]LQJLQEDVHPHQWVVHZHUDQGZDVWH &RPPHUFLDO UHVLGHQWLDOIDUPVGXJRXWVHWF 110 - 3rd Ave. W., Melville, SK | 306.725-5432 | 1.877.728.5432 Cell: 1-306-621-6372 carpet1melville.com 12 Livingstone St., Yorkton, SK | 306.782.6556 | 1.888.782.6556 MLPVURRÀQJ#OLYHFD 306-740-7805 or 306-745-7226 carpet1yorkton.com Melville, Sk Whitewood, SK Photos for illustrative purposes only. ©2017 Carpet One Floor & Home. All Rights Reserved.

BUY-RITE VACUUM SERVICE “We specialize in all your building needs” Mr T’s Plumbing and Heating Has moved to 197 Victoria Ave. We’re here to HELP! Fort Qu’Appelle Your Success is Our Success. Todd Th rossell Mobile Service in Journeyman Plumber Licensed Gas Fitter Melville and Area HOURS Your support makes our community Mon. - Fri. 7 a.m. - 5 p.m. 813 Desmond St., stronger by shopping locally! P.O. Box 296, Call 306-728-2927 Sat. - 8 a.m. - 4 p.m. Grenfell, SK to make arrangements for We take pride in servicing S0G 2B0 vacuum repairs, parts and bags. 1-306-332-2833 and serving our community! Ph.: 1-306-697-2727 Bags and Filters can also be purchased Cell: 1-306-697-7749 at The Melville Advance - 218 - 3rd Ave. W. www.friestallman.com [email protected] 22 April 2, 2021 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News

*307(5+:(=,;/0:*644<50;@*(3,5+(9¶796<+3@)96<./;;6@6<)@

• Melville • Fort Qu’Appelle • Lipton Prairie Co-op Ltd. • Cupar • Strasbourg Ag. • Ituna • Kelliher Administration - 751 - 7th Ave. W., Melville, SK 1-306-728-5497 www.prairiecoop.com Fun things to do and keep active! APRIL 2021

Sunday Monday Tuesday Wednesday Th ursday Friday Saturday During this month we offer suggestions and 123 a few event activities for you and your family to do. Some of the dates are actual observances, while others are just ideas you can use. Feel free to add your own to the list. 2 2 Have fun and enjoy April! 45678910 All Month 2 2 22

Melville Legion Chase the Ace - Fridays 11 12 13 14 15 16 17 Draw made at 6:15 p.m. 136 - 3rd Ave. W, Melville, SK April 1 2 2 2 2 April Fools Day 18 19 20 21 22 23 24 April Fool’s Day is an opportunity for playing jokes or tricks on one another. The challenge is to carry out a trick that 2 2 2 is believable, if only for a little while. Tricks are most successful if played ear- 25 26 27 28 29 30 lier in the day before a person is wise to what is going on. (holidayinsights.com) 2 2 April 2 Good Friday April 10 April 16 On Good Friday, Jesus Christ died on National Eggs Benedict Day National Sibling Day the cross. He died for us. But he only A day to enjoy eggs with Celebrate National Sibling died in human form. He then arose from the dead on Easter hollandaise sauce, Canadian Day in a variety of ways. It’s a great time to be thankful for Sunday morning to show us that there is life after death in bacon and English muffins. heaven. (holidayinsights.com) your sibling. But, most importantly get in touch with your Make some and enjoy! (holidayinsights.com) siblings. Visit them if they live nearby. Call them, if they live April 4 far away. (holidayinsights.com) April 18 Easter Sunday Husband Appreciation Day The real meaning of Easter, is April 11 The objective of this special day is for wives to show appre- the Resurrection of Jesus Christ National Pet Day ciation to husbands. It should be very easy to show appreci- from the dead. To Christians, it is Today is a day about the both of you. Undoubtedly, there ation o your husband, for who he is, and for the many great the most special day of the year. is a special bond between humans and pets. We’re talking things he does. (holidayinsights.com) Easter also is celebrated with about any and all pets. Celebrate today by spending time and the Easter Bunny, colored eggs, playing with your pet. Give your pet a special treat or a toy. jelly beans, and lot’s of chocolate. April 20 (holidayinsights.com) There is a famous Easter game called the Easter Egg Hunt. Look Alike Day Early morning kids go outside to find the many colored Easter Today’s a day to find someone you really look up to, and try eggs that the Easter bunny has hidden the night before. (holi- to look like them. Its a way you can have fun with the kids, dayinsights.com) April 12 or vice-versa, by dressing and acting like the other person. Grilled Cheese Sandwich Day (holidayinsights.com) April 6 What do you need to celebrate Grilled Cheese Sandwich Day? National Tartan Day April 22 The ingredients are cheese, National Tartan Day celebrates Scottish heritage and the Earth Day sliced bread, a little butter, and distinct pattern “tartan”, which is commonly seen in clothing A day to show your support for your appetite. Any cheese will and many other items. When we see this tartan pattern, we the environment and the harmful do. If you are looking to be a little daring, add a couple slices think of Scotland, bagpipes, kilts and other things “Scottish”. environmental practices we do to (holidayinsights.com) of tomato or tuna fish to it, then grill it in a frying pan. (holi- our favourite planet. A day to bring dayinsights.com) greater awareness that our planet has limited resources, and our fragile eco-system needs to be April 8 taken care of. (holidayinsights.com) Draw a Picture of a Bird Day April 14 Draw a Picture of a Bird Day is a special day for young bird lovers International Moment of Laughter Day April 26 who like to draw. It doesn’t mat- The objective of this day is to get people to laugh, and to National Pretzel Day ter whether you are young, or not laugh more often. After all, “laughter is the best medicine”. How do you like your pretzel? Thick or thin? Straight or so young. If you like to draw, then Simply tell jokes or do funny things that cause people to twisted? Crisp and crunchy, or soft? Salted, unsalted, mustard today is a day to draw pictures of a bird. (holidayinsights.com) laugh. (holidayinsights.com) flavored, perhaps? There’s no shortage of types of pretzels. Why not get some and give them a try. (holidayinsights.com) RE-OPENED Melville Community Works TO THE PUBLIC! April 28 • Thrift Shop open - Tuesday and Thursday 12 - 4 p.m. Kiss Your Mate Day • Gift Shop open - Tuesday and Thursday 1 - 3 p.m. Kiss Your Mate Day is a • Kidsville opening to be determined perfect chance to smooch • Canadian Mental Health Association - Melville Branch with your partner, as if - Meeting 1st Wednesday of every month 7 p.m. you need an opportunity to share a kiss or two • Magic Moments Playschool is currently full and accepting names for www.prairiecoop.com the 2020 - 2021 school year wait list. Please contact Chantel Fahlman www.facebook.com/prairiecoopretail with the one you love. for more info at 306-730-6272 or via Facebook messenger. With spring in the air, April is an appropriate time for Kiss Sponsored by Prairie Co-op Your Mate Day. (holidayinsights.com) www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV April 2, 2021 23 Eagle Women Tribunal ﬁrst of its kind in Canada Launched March 22 - Cowessess First Nation

By Sarah Pacio linked to the Chief Red work together to ensure tutions,” Pelletier said resolve issues. Grasslands News Bear Children’s Lodge the children of Cowessess during the launch. “For far too long our (CRBCL) established by continue to know who The tribunal will be human relations have the Miyo Pimatisiwin they are as Indigenous accessible, respectful and been somewhat broken March 22 was a his- Act, which will launch on people.” helpful, collaborating because of a justice sys- toric day for Cowessess April 1. The Act provides After a year and a with concerned parties tem that has been en- First Nation as lead- guidelines for the First half of diligent work, to make decisions. It pro- forced upon us for almost ers launched the Eagle Nation to exercise juris- Cowessess assembled the vides a group within the four generations,” Chief Women Tribunal, the ﬁrst diction over its children nine-member group com- First Nation to deal with Delorme noted. “We have of its kind in Canada. in the welfare system. prised of people from on disputes rather than turn- been somewhat colonized “Eagle Women Tribu- The tribunal will review and off the reserve, as ing to an external judicial and this is a part of our nal is a step forward to cases and make decisions well as non-Cowessess’ system. They will use journey and an import- self-government,” Chief relating to child welfare citizens. The board con- Cadmus Delorme wrote and other concerns raised sists of a panel of qual- talking circles, healing ant role in helping us to in a statement. “Eagle by Cowessess citizens. It ified individuals with circles, and mediators to achieve self-government. Women Tribunal will be was established because was always rightfully experience in a variety of both the Truth & Recon- ﬁelds. our own justice system, ours,” FSIN Vice Chief ciliation Calls to Action Councillor Denise Pel- one which will reflect Dutch Lerat affirmed and the MMIWG Calls to letier is the chairperson our laws, our values, and when he addressed the Act direct the First Na- for the tribunal and has what is important to the others during the on- tion to create a judicial been extremely instru- citizens.” line session. “We always The tribunal is closely system founded on tra- mental in its founding. ditional Indigenous laws wanted to ensure that our “It establishes that our and healing practices. children retained their Cowessess constitution • Business Cards & Forms The tribunal’s launch culture, retained their is recognized and states • Posters & Flyers • Envelopes & Letterheads was celebrated during language and retained every Cowessess First • Coroplast Signs a special zoom meeting their kinship values and Nation citizen has a right • Vinyl & Pull-Up Banners with the chief, councilors, lines, and most impor- to a process to appeal or • Labels, Decals & Pens • Much, much more... 218 - 3rd Ave. W. • Box 1420 • Melville, SK. • S0A 2P0 and other dignitaries. tantly their ties to our review administrative “Today is a new day; home communities. The decisions of the Cowes- Toll Free: 1-844-GNG-NEWS Help keep your we are taking back what tribunal and CRBCL will sess First Nation insti- community’s history alive. Hon. Warren Kaeding PAg. MLA for Melville-Saltcoats Minister of Environment SUBSCRIBE TO YOUR LOCAL NEWSPAPER! Phone: 306-728-3881 [email protected] your new OFFICE HOURS Call Toll Free: Monday to Thursday 9 a.m. to 4 p.m. 2021 is here 1-844-GNG-NEWS [email protected]

KRAUSECARE PHARMACY over 50 brand new 2021’s in-stock 2021 Hyundai $21,499 Kona Essential MSRP* + Freight and PDI

$ Finance 138 0% OAC for 72 months with $0 down payment + Freight and PDI $ Lease 115 2.99% OAC for 36 months with $0 down payment with a cost of borrowing of $1,554.45 + Freight and PDI

2021 Hyundai $23,599 Elantra Preferred MSRP* + Freight and PDI

$ Finance 158 IDA KrauseCare Pharmacy is family owned and 1.49% OAC for 72 months with $0 down payment operated by Nicole and Steve Krause of with a cost of borrowing of $1,085.48 + Freight and PDI $ Fort Qu’Appelle SK. Lease 153 1.99% OAC for 36 months Services include prescription dispensing, compliance with $0 down payment with a cost of borrowing of $1,085.91 packaging, medication counseling and reviews, chronic + Freight and PDI disease management, injections and compression stocking îWWLQJVDQGQRQVWHULOHFRPSRXQGLQJ plus 28 previously pre-owned vehicles CALL OR STOP BY TODAY ! 1-306-332-1222 310 Broadway St. W. Fort Qu’Appelle PH: 306-783-8080 TF:1-800-565-0002 Business Hours: Monday to Friday 9 a.m. to 5 p.m. 115 Palliser Way, Yorkton, SK and Saturday 9 a.m. to 1 pm. www.yorktonhyundai.com Dealer License # 323917 *See Dealer for details 24 April 2, 2021 Whitewood Grenfell Herald Sun Grasslands News

Blue Chip Realty Lisa SERVING MELVILLE AND AREA Shawn Kirkwood Pryhitka Residential www.remax-bluechip-yorkton-sk.ca Agriculture Specialist 269A Hamilton Road, Yorkton, SK Specialist 306-728-6789 Phone: 306-783-6666 306-621-9798 [email protected] Each Offi ce is Independently Owned & Operated [email protected] $47,000 $54,900, $60,000 $7272,500,500 Includes Empty Lots on JUST LISTED Both Sides of House

327/333 - 6th Ave. E. 358 - 5th Ave. W. 368 Manitoba St. 115 - 10th Ave. W. MLS®SK804573 MLS®SK836017 MLS®SK826083 MLS®SK846135

$79,900 $87,000 $96,900 $117,0117,00000 $119,900 JUST LISTED

256 - 6th Ave. E. 301 - 5th Ave. E 572 - 4th Ave. W. 348 - 8th Ave. E. 829 Main St. MLS®SK840724 MLS®SK810235 MLS®SK839687 MLS®SK847452 MLS®SK824177

$135,000 $134,000 $159,000 $175,000 $199,500

Duplex 202 - 5thhA Ave. W. 329 - 3rd Ave. W. 374 - 8th Ave. W. 528 Main St. 423 - 9th Ave. W. MLS®SK839162 MLS®SK823956 MLS®SK834381 MLS®SK839454 MLS®SK817235

$235,00235,0000 $279279,900,900 $329,000 $388,000 $19,500 PRICE REDUCED

7 Carlton Bay 8 Carlton Bay 799 - 1st Ave. E. 326 Toronto St. Lot 60A, Grenfell Beach MLS®SK809915 MLS®SK813274 MLS®SK839913 MLS®SK845015 MLS®SK 840906

$125,00125,0000 $218,0218,00000 $359,000 $369369,000,000 $100,000 JUST LISTED JUST LISTED

108 Indian Point, Crooked 100 Indian Point, Crooked 208-210 Criddle Ave - 115 - 1st St. - Crooked Lake 537 - 5th St. NE - Ituna Lake MLS®SK814800 Lake MLS®SK846448 Crooked Lake MLS®SK817614 MLS®SK846190 MLS®SK823881

$69,900 $7777,000,000 $272,500 $3,439,800 $649,000

310 Main St. - Neudorf 205 Taylor St. - Neudorf RM of Foam Lake RM of Insinger RM of Good Lake MLS®SK837324 MLS®SK815620 MLS®SK839581 MLS®SK839586 MLS®SK817569

$575,000 $300,000 $1,890,001,890,0000 $490,00490,0000 $499,000

RM of Stanley #215 - RM of Orkney, York Lake RM of Orkney Land RM of Preeceville RM of Wallace #243 - Land MLS®SK833880 MLS®SK842430 MLS®SK841970 MLS®SK839593 Acreage MLS®SK817645 AgNEWS SPRING EDITION

Publishers of the Melville Advance, Fort Qu’Appelle Times and Whitewood and Grenfell Herald Sun

Fort inventor to be honoured into H of F By Alan Hustak Olson, 68, told Grasslands power take off. I was lucky Grasslands News News. “This is the icing on enough to have been able the cake; I am humbled, to solve their problem.” and thankful for this rec- Olson built a 20,000 An entrepreneur based ognition. I need to thank square foot building in in Fort Qu’Appelle is my original investors, my Fort Qu’Appelle 23 years about to be inducted into children and all of our ago to assemble the draw- the Canadian Western customers and valuable bar hitching components Agribition Hall of Fame as employees over the years. for John Deere which over one the 50 most influential Especially my partner of the years has brought in agricultural industry lead- 30 years, TJ Batke. She is over $100-million export ers in the country. my rock.” dollars to the community. Brian Olson, who in- Olson recalled the “He is one of the best in vented a hitch that is now struggles he went through an industry which contin- a standard feature on most to get his invention off ues to create endless op- large tractors is being rec- the ground. “At the time, portunities to dream and ognized for his exceptional if you had a piece of grow and thrive,” said contribution to improving equipment you’d line up Todd Klink, Farm Credit safety standards in the two holes and use a bolt marketing officer. fields. It is the latest in a or whatever you could Asked how he plans number of honours that throw in the hole as a to spend his retirement, Olson has received for hitch. There was no con- Olson replied, “I’ve done Hall of Famer ALAN HUSTAK | GRASSLANDS NEWS inventing the Drop Pin sistency,” He almost went dumb things in my life, hammerstrap 30 years ago bankrupt trying to develop and I’ve done smart ,QYHQWRU%ULDQ2OVRQRI)RUW4X·$SSHOOHZLOOEHLQGXFWHGLQWRWKH$JULELWLRQ when he was farming near his drop pin hammerstrap things, but always I have +DOORI)DPH+HLVRQHRISHRSOHIURPDFURVV&DQDGDFRQVLGHUHGDQLQÁX- Tompkins, SK. His inven- and he mortgaged his done something.” HQWLDOLQGXVWU\OHDGHU tion standardized the way farm. agricultural equipment is “I thought my inven- hitched. tion would be the ticket to “The recognition comes buy back the farm, but 44 at a great time as I am re- patents and patent applica- Crop insurance changes for 2021 tiring and am moving into tions later, my life took a the next chapter of my life. different turn.” Provincial native forage acres. The Forage vegetable production through the I’ll be totally gone from It wasn’t until 1989 Establishment Benefit coverage for Commercial Vegetable Pilot Pro- Power Pin in a month,” when John Deere engi- The Crop Insurance enhance- tame hay and sweetclover is also gram. Commercial operations have neers came from Waterloo, ments introduced in the 2021 year increasing. access to standalone coverage for Iowa, to a Farm Progress will continue to build on previous Crop Insurance customers can damage to cabbage and pumpkin Show in Regina and liked program enhancements. SCIC Is now insure their tame hay acres crops. A minimum of eight acres what they saw that his in- pleased to announce the following under the Forage Rainfall Insur- of cabbage and/or pumpkins is re- vention took off. “At the Program changes for the 2021 sea- ance Program (FRIP) or the Multi- quired to participate. time John Deere had come son: Peril Crop Insurance Program. SCIC is updating the large- out with a line of new trac- Coverage for the Native For- Under FRIP, payments will be seeded Kabuli chickpea base grade tors, and they were getting age Establishment Benefit Option calculated based on rainfall levels to reflect current production and all kinds of complaints be- is increasing from $75 per acre instead of overall yields. marketing patterns. This increases cause the hammerstrap to $200 per acre. This option pro- New for 2021, SCIC is pleased the insured price and quality cov- hitch interfered with their vides coverage on newly seeded to provide coverage for largescale erage.

A Grasslands News agricultural supplement Grasslands News B 2 April 2, 2021 Spring Agriculture Edition Hall of Fame inductee Alanna Koch is ﬁrst female deputy agriculture minister

By Alan Hustak “Mentors are import- Grasslands News ant,” she says over a cup of strong coffee served at the island counter in The first female to “What young women her spacious kitchen. “I serve as Saskatchewan’s seek out in other women, am who I am because of deputy minister of agriculture is being inducted for whatever reason, is a role mentors like Lorne Hep- into the Canadian West- model.” worth, (the former MLA ern Agribition Hall of - Alanna Koch who held several cabinet Fame as one of the 50 portfolio’s in the 80’s) most influential leaders who saw something in me. And Pat Smith, who in Canada’s agricultural to be matched with young was Grant Devine’s dep- industry. men and women looking uty premier. She had so Alanna Koch also for advice through the many amazing qualities. served as deputy minis- Next Gen program,” she “ ter to Premier Brad Wall told Grasslands News. “I and almost became Sas- was able to reflect upon Koch and her husband, katchewan’s premier in my own life experience Gerry Hertz, farm 4 1/2 2018 when she collected in a way that was helpful sections near Edenwold, 46 per cent of the vote on to others. Sometimes that a property they bought the final ballot in which meant I was just there 35 years ago. It is directly First female and hall of famer ALAN HUSTAK | GRASSLANDS NEWS Scott Moe won the Sas- to listen and commiser- north of the farm where katchewan Party leader- ate.” At the moment she she grew up. She enrolled $ODQQD.RFKLVDKDOORIIDPHUIRUPHUGHSXW\DJULFXOWXUHPLQLVWHUDQGÀUVW ship race. is mentoring a young at the University of Sas- female to hold the position in Saskatchewan. She believes Agribi- woman from Saskatoon, katchewan but never tion has recognized her “some one who is not graduated. Early in her not for her political ac- in agriculture. Mentor- career, “when agriculture complishments but for ing is vital for all of us. in Saskatchewan was her role as mentor with What young women seek in a mess” she went to Next Gen, a federal pro- out in other women, for work for Premier Grant vincial initiative which whatever reason, is a role Devine, who also held mentors prospective lead- model. A model they can the agriculture portfolio. ers in agriculture. lean on in a mentoring Since leaving government “I am fortunate. There relationship.” Koch has been running MORE THAN JUST TIRES! are so many people in the Articulate and ambi- her own consulting busi- We Salute - SGI Certifi ed Light Vehicle Inspection Station industry, but I believe I tious, Koch carries the ness KoHert Agri Inc. She was recognized because I shine of having been in is chair of the board for - Heavy Truck and Trailer Inspection Station was often the first woman the spotlight well. the Global Institute for - Truck and Trailer Repair Center Food Security and chair - Wheel Alignments, Oil Changes, Brakes, Shocks of CN’s agriculture ad- - Tune-ups and more! E & T SAGAN visory council. Among her many awards is the OUR TIRES ARE 15W-40 Custom Grain Bin Movers Queen Elizabeth II jubilee ALWAYS ON SALE! ROTELLA OIL medal. “We’ll beat any $ 99 written quotes” 63 / pail Please call Edward at So does she miss being out of government? (on same name tires) When you purchase 10 or more pails the Farming “I do miss it, being on We also offer 1.306.728.3760 Free wheel checks! Less than 10 $68.99 the inside, the adrenalin Leave a message rush of all the deadlines,” Community! Melville, SK she said, “but what I re- 306.728.4002 ally miss most are all the 280 Service Road North, Melville people I worked with.” “No job too big or small!”

&'( #) *$+, !" #$% -'./ " 0" )) #" $% '"12554)$5* " '"126##5

!"#$ %"!& ' ( '"12123!*44 )"#$ %"!& ' ( '"123!* 4 "#$%& '()*+,-) ./ .0 Grasslands News www.grasslandsnews.ca April 2, 2021 B 3 Yorkton Richardson Expansion at canola crushing plant to be largest in Canada

Provincial in our Growth Plan, which includes a Grasslands News target to crush 75 per cent of the canola our province produces here in Saskatch- ewan. The Government of Saskatchewan “We opened the original Yorkton last week welcomed Richardson Inter- plant in 2010 and at that time, it was by national Limited’s announcement of a far the largest capital investment Rich- new investment to double processing ardson had ever undertaken,” Richard- capacity at its canola crush plant in son International President and CEO Yorkton, which will make it the largest Curt Vossen said. “Saskatchewan and in Canada. Manitoba producers have responded “This is a significant investment in effectively, providing growth in canola our province that will create local jobs, production over the years - this has support economic recovery and help our given us the confidence to move for- RICHARDSON INT. | GRASSLANDS NEWS province continue to grow,” Trade and ward with expansion once again. We Major expansion announced Export Development Minister Jeremy have appreciated the encouragement When the expansion project is completed in early 2024 the Richardson In- Harrison said. “As the world recovers and cooperation of the rural municipal- ternational facility in Yorkton will be able to crush 2.2 million tonnes of seed from the economic impacts of the pan- ity of Orkney, the city of Yorkton, and annually, making it the largest canola crush facility in Canada. demic, there remains a growing need the province of Saskatchewan.” for the food products Saskatchewan The new expansion will double the Saskatchewan’s Growth Plan also and Processing Exporter Tax Incentive produces, such as canola oil and canola canola crush capacity at the facility to includes a commitment to maintain- and the Saskatchewan Commercial In- meal, and we appreciate this investment 2.2 million tonnes of canola seed annu- ing a competitive tax environment and novation Incentive (Patent Box Pro- and expansion at Richardson’s Yorkton ally. The project will also optimize op- providing incentives to help attract gram). canola crush plant, which will help erational efficiencies and modernize the further investment. These include the Richardson plans to begin construc- meet that demand. Our government is facility. The project will also upgrade Saskatchewan Value-Added Agriculture tion on the expansion immediately and committed to maintaining a competitive infrastructure that will include a high- Incentive, the Saskatchewan Chemical is expected to be completed in early business environment to attract these speed shipping system with three 9,500- Fertilizer Incentive, the Manufacturing 2024. types of investments, which will benefit foot loop tracks that will serve both all Saskatchewan residents, and we look major railways. forward to working with Richardson on This project will help to achieve sev- this important project.” eral of Saskatchewan’s Growth Plan “Saskatchewan is a leader in agricul- goals, including to: To all Saskatchewan farm producers tural production and we welcome this • Grow private capital investment in investment to increase canola crush Saskatchewan to $16 billion annually; capacity in the province,” Agriculture • Increase the value of exports by 50 per Minister David Marit said. “We know cent; the world wants the high quality prod- • Grow Saskatchewan’s agri-food ex- Thank you! ucts Saskatchewan produces, with ports to $20 billion; canola oil and canola meal our top val- • Increase agriculture value-added reve- ue-added exports in 2020. This expan- nue to $10 billion; and sion of processing capacity will help • Crush 75 per cent of the canola Sas- Saskatchewan meet the goals outlined katchewan produces in Saskatchewan.

Trust us with what matters AGRONOMIC EXPERTISE. most. MEASURABLE RESULTS. 215 - 3rd Ave. W., Melville, SK 306.728.2165 www.trustmarkinsurance.ca

Farmers sequestering carbon Give credit where credit is due .

YoY urr yieieldds sts art wiw thh suppererioor sseeedd froom NuN trt ieen olutions, Inc S

g AgA Solo uttioionsns™. OuO r local cropp connsus ltltanantsts Nutrien A Nutrien f cac n offfferr best-t inin-c-cllasss seed pror ductc s anand unu paralllellede acccese s tot solo uttiionsn to heelpp youu lelead thee ﬁele d all seeason long.g Cala l yoyouru lococala n is a trademark o g DR. Robert Kitchen MP NuNutrt iei n AgAg Solutionns todayy or visit us at our did gitaal hub at NutrieenAggSoSoluutions.ca Souris-Moose Mountain olutions™ and Desi S

Nutrien A 1-866-249-4697 • www.drrobertkitchen.ca Grasslands News B 4 April 2, 2021 Spring Agriculture Edition REMOTE BOOM CONTROL

j!='ধ1'!2&132'@ j3138'8<22-2+-2!2&3<;3(;,'$!# j,!2&,'£&8'13;';<82932-2&-=-&-;,6£<+!2&6£!@,!82'99'9 • Order your Spraytest today!

411 Railway Ave • Beechy, SK 306-859-1200 • 1-855-859-1200 [email protected] • www.spraytest.com

BORDERLAND CO-OP

BORDERLAND CO-OP’S BULK UP YOUR BIGGEST OIL SALE STORAGE AND SAVE! OF THE YEAR! Moosomin • Rocanville • Whitewood SALE ENDS MAY 2, 2021 300G, 500G, 1,000G and 0DU\ÀHOG6XUURXQGLQJ$UHD 10L 20L 110L 205L 1000L 1,250G Single DMO 15W40 $4.13/L $4.01/L $4.11/L $3.78/L $3.53/L Wall & Double Trans Hydraulic $3.96/L $3.86/L $3.96/L $3.66/L $3.41/L Wall Fuel Tanks Available! Trans Hydraulic Plus 20L: $4.91/L Sonic Blue Guard Grease case price $30.68 1,000G Ask about our DEFERRED Sonic Moly Guard SL Grease case price $42.99 Single Wall Tanks PAYMENT PROGRAM for summer fuel ﬁ lls BULK OIL 3 YEAR AVERAGE $1,999.99 prior to seeding! DELIVERY OIL EQUITY HAS NOW AVAILABLE BEEN OVER % FREE DELIVERY 10 Increase your farm storage and ﬁ ll up OR 3 year 0% ¢ interest payment early to be prepared for seeding time! 40 plan available To book your tank delivery or for more details contact PER LITRE *O.A.C. Mike at 306-435-4004 or [email protected] Tank and Borderland Co-op Moosomin Rocanville Whitewood Pump combos Box 1410 Moosomin, SK S0G 3N0 Home Centre Home Centre Home Centre available 306-435-2642 306-645-2152 306-735-2414 www.borderlandco-op.crs Grasslands News www.grasslandsnews.ca April 2, 2021 B 5 Career change both challenging and rewarding

By Brian Cross The Velestuks constantly seek ways of the Western Producer to increase their productivity, improve $ELJSDUWRI-RFHO\Q9HOHVWXN·VFRQWULEXWLRQWRWKH their soil health and ensure that the IDUPLQYROYHVVWD\LQJFRQQHFWHGZLWKSURIHVVLRQDO farm follows a sustainable path toward DJURQRP\DSSO\LQJKHUVRLOVFLHQFHNQRZOHGJHDW Saskatchewan grain and cattle pro- long-term profitability, says Jocelyn, who KRPH PDNLQJ FRQQHFWLRQV WKURXJK KHU ERDUG LQ- ducer Jocelyn Velestuk describes her has a master’s degree in soil science from volvement, attending farm conferences and bringing first six years in farming as a whirlwind the University of Saskatchewan. KRPHQHZNQRZOHGJHDERXWHPHUJLQJWUHQGVLQSUR- of activity. Maintaining a diverse crop rotation GXFWLRQDJULFXOWXUDOUHVHDUFKPDUNHWLQJDQGSROLF\ “It’s been a wild ride,” says Velestuk, is a big part of the farm’s sustainability PHOTOS COURTESY JOCELYN VELESTUK who farms with her husband and his plan. The Velestuks produce as many as parents near Broadview, Sask. 10 different crops and are also experi- “There’s always lots going on. There menting with inter-cropping in silage are times when we’re going flat out and and grain crops. there are times when things slow down “We’re a very diverse operation,” a bit but we’re always very busy.” Jocelyn says. In 2016, Velestuk and her husband, “It’s something that’s important to all Jesse, decided to make a career change of us, is to have that diversity.” and become full-time grain and live- Jocelyn has also parlayed her stock producers. post-secondary education in soil science Jocelyn, previously an environmental into a career as professional agronomy consultant, and Jesse, an oilfield welder, consultant. were on the road frequently and began When she’s not working on her own to yearn for a career that would allow farm, she works as a contracted con- them to set down roots, spend more time sultant for Western Ag, producing cus- together and raise a family. tomized soil fertility plans for other “We decided that to have the fam- growers. connections through her board involve- many moving parts involved in the ily life that we wanted to have and to On their own farm, the Velestuks ment, attending farm conferences and farm’s success, Jocelyn says it’s also see each other as much as we wanted plan to seed about 3,500 acres this bringing home new knowledge about necessary to slow down occasionally, to, that the farm life was for us,” says spring, both for feed and commercial emerging trends in production, agricul- revisit priorities, communicate openly Jocelyn. grain production. tural research, marketing and policy. and focus on personal well-being. “We got to a point where we knew we Feed crops are used to maintain a “We each do what we’re best at and “Farming is not an easy thing. It needed to make a change so we decided: herd of approximately 350 cows. Calving that’s how we’re going to be successful can be very stressful and we’ve been OK, let’s start farming.” is just around the corner so that will add at our farm,” Jocelyn says. through some very tough times…,” she That’s when the whirlwind began. to the farm’s already heavy workload. “It’s kind of neat how everyone’s role says. After approaching Jesse’s parents, The Velestuks are also background- fits in,” she adds. “But we’ve learned how to talk about who are also active farmers in the ing another 300 cattle so even in the “It doesn’t matter if you’re a woman the stress. We’ve learned that a big part Broadview area, Jocelyn and Jesse winter, the demands on their time are or a man, you do what you’re good at of coping is learning how to talk about rolled up their sleeves and got down to significant. and I think that’s something that’s been the white elephant in the room, even if business. Somehow, between everything else, a strength of our farm.” it means having some very uncomfort- In the past six years, the Velestuks Jocelyn and Jesse have also found time Jocelyn says it can be challenging able conversations. have restructured the farming operation to start a family. as a woman to define your role on the “I think everyone has to know where to accommodate two families. Their children, aged four and six farm. everyone else is at so that the farm can The farm’s land base has almost tri- years old, live just a hop, skip and a “The industry, I think, has its own move forward and be successful. pled since 2016 and most of the machin- jump from their grandparents, Jesse’s idea of what a woman should do on the “Every farmer is different and every ery has been upgraded or replaced to mom and dad. farm but I think a lot of women today farm makes decisions for different rea- accommodate the extra acres. Jocelyn says the decision to settle are kind of breaking that trend, or sons,” she adds. down and become full-time parents and breaking from the norm….” “But we are all in this high-risk game farmers was the right one, even though With such a busy operation and so together.” the workload can be demanding. “We both grew up farming and we both loved it but we knew what we were getting into,” says Jocelyn, who also serves as president of the Saskatchewan Soil Conservation Association and is a director with the Saskatchewan Wheat Development Commission. “We knew that it wasn’t necessarily the easiest career choice and that it would take a lot of hard work,” she adds. “But it was a well thought-out decision and it was definitely made for fam- 202 Boundary Ave. Fort Qu’Appelle, SK ily reasons.” Jocelyn says each family member brings unique skills to the farm. She 1-306-332-5444 takes pride in the fact that her role as a woman on the farm doesn’t necessarily Open: Monday to Friday 8:30 a.m. – 5:00 p.m. conform with established industry ex- pectations. A big part of Jocelyn’s contribu- Jocelyn and Jesse Velestuk moved to tion involves staying involved in professional agronomy, applying her soil Tractor & Implement Tires WKHIDUPSDUWO\IRUWKHLUFKLOGUHQ science knowledge at home, making Trailer Tires Tubes Thanks for Helping Calcium Hydraulic Hoses Feed the World Shell Oils and Lubricants Filters Mobile Unit

For all your insurance needs. Residential - Commercial Real people Auto - Hail - Farm servicing real life.

OPEN Monday thru Friday Balcarres Agencies Ltd. :00 p.m 9:00 a.m. - . open over lunch 216 Main Street, Balcarres, SK, Box 970, S0G 0C0 Phone: (306) 334-2401 — Fax: (306) 334-2705 Email: balcarresagencies@TBTLUFMOFU — Website: www.balcarresagencies.saskbrokers.com Grasslands News B 6 April 2, 2021 Spring Agriculture Edition Parkland College program offered for farm hands

By Emily Jane Fulford More good news for those re-entering Grasslands News the workforce after COVID-19, many applicants may be eligible for the Can- ada-Saskatchewan Job Grant and the If you’ve ever been interested in Re-Open Saskatchewan Training Sub- working on a farm but grew up in town, sidy. or if you’ve recently acquired a farm- This three-day course will cover: ing operation and are not sure where to • Basic farm safety start when it comes to staffing and em- • Overview of field crops ployee training, Parkland College may • Introduction to selected pieces of farm have the answer you’ve been looking equipment for. • Safe work practices for moving equip- The institution announced on Mon- ment in and around work sites day, March 8 that they were launching • Power Mobile Equipment theory a new program, Introduction to Farm Important Notes: Hand, which has been created in order • Participants are required to have to assist growing farm operations with steel-toed boots, work gloves and safety the need for added labour. Some topics glasses. include field crops, Power Mobile Equip- • Please dress appropriately for out- ment theory, and hands-on training with doors. various pieces of farm equipment. Basic • Bring a copy of a valid driver’s licence farm safety, as well as instruction for at a nearby farm for the vocational com- gain the experience needed to work in on the first day of the course. safely moving equipment around work ponents. agriculture.” • They recommend you take a First Aid/ sites, will be covered as well. “This program is designed to meet The short format course, which is CPR/AED course if you are not already Students will be taught both in the the need for more skilled labour on Sas- taught over a three-day period, provides certified. (First Aid/CPR A/AED train- classroom as well as receive hands-on katchewan’s farms,” said Connie Brown, basic skills training and hands-on expe- ing will be available in Melville – April experience which is split up over the Manager of Business Development at rience in a number of the areas required 6 & 7, 2021; Fee: $180 per person) span of three Saturdays including April Parkland College. “Farmers can send to perform work on a typical Saskatche- • Please bring you own lunch, snacks, 17, April 24, and May 1. The Town of current or potential employees through wan grain farm. The first-course module and water. Lemberg agreed to assist the College the program to develop their skills. is set to commence on April 17 and will For more information visit: www. and provide space for the training at And it gives general labourers without focus on seeding in order to prepare em- parklandcollege.sk.ca or call 306-786- the town office for classroom work and a farm background the opportunity to ployees for the upcoming spring season. 2760. Next Gen Agriculture Mentorship Program supports industry’s future Provincial high-quality food,” Agriculture Minister tunities. the Canadian Agricultural Partnership, Grasslands News David Marit said. “I want to congrat- “It’s been a pleasure watching the a five-year, $3-billion investment by ulate Canadian Western Agribition on Next Gen Agriculture Mentorship pro- federal, provincial and territorial gov- matching their third intake of mentees gram grow and CWA is proud to be part ernments to strengthen the agriculture Canadian Western Agribition’s Next with mentors and thank them for their of the success of our industry’s future,” and agri-food sector. This includes a Gen Agriculture Mentorship Program efforts to engage young people.” CWA President Chris Lees said. “Al- $388-million investment in strategic ini- welcomed the newest group of eight The successful mentees and mentors young agriculture leaders. This pro- ready, graduates from the program are tiatives for Saskatchewan agriculture. chosen to participate in this intake are: filling leadership roles in agriculture all More information about the program gram matches young leaders in the • Alexandra Clarke, paired with Gerry agriculture industry with experienced over the province.” is available online at www.saskatche- Hertz This project is supported through wan.ca/CAP professionals who provide them with • Sandra Hessdorfer, paired with Sara skills and experiences to advance their Shymko careers. The Governments of Canada • Megan Roger, paired with Brett and Saskatchewan committed $100,000 Halstead in funding through the Canadian Agri- • Morgan Follensbee, paired with Kim cultural Partnership to support this in- Keller take of mentees. • Blaine Lamontagne, paired with Danny “Canada’s young people are key to Petty the future success of our agricultural • Grayson Berting, paired with Joe Bar- sector,” said Marie-Claude Bibeau, Min- nett ister of Agriculture and Agri-Food Can- • Ryan Garbarczyk, paired with Shelley ada. “The government is working hard Jones to ensure our youth are able to play an • Anna Karlsson, paired with Heather active role in building a stronger and Deobald more prosperous sector. The Next Gen The Next Gen Program is an agri- NEW STEEL | INDUSTRIAL GASES & SUPPLIES | SCRAP METAL RECYCLING program creates leadership develop- cultural mentorship program for future ment opportunities to give the future leaders in Saskatchewan delivered by agriculture leaders the skills and expe- Canadian Western Agribition (CWA). rience they need to contribute and make The program accepts eight applicants a difference in our industry.” into an 18-month mentorship experi- “Canadian Western Agribition’s ence. Mentees are paired with some Next Gen Agriculture Mentorship proof the strongest leaders in Canadian gram provides young industry leaders agriculture. During their mentorship, with valuable skills that will help them mentees will gain industry knowledge, advance their careers and share the board and governance training, busi- story of how our producers create safe, ness education and networking oppor- CA$H for Scrap Metal Wishing a very successful year to all our agriculturists. METAL RECYCLING DEPOT Steel, Cars, Farm Equipment, Copper, Brass Please practice farm safety <;313ধ='{ !81!ħ'8-'9 in your daily activities. RECYCLING FOR A BETTER TOMORROW

775 Broadway St. W. - Hwy. #52 West Yorkton, SK Open Monday to Friday: RM of Lipton #217 8:00 a.m. to 12:00 noon • and 1:00 to 5:30 p.m. Telephone: (306) 783-6122 Reeve & Council www.smithsteelservice.com Grasslands News www.grasslandsnews.ca April 2, 2021 B 7 FCC sees opportunities for Indigenous agriculture

Farm Credit Canada digenous agriculture in the spirit of are integrating indoor farming with tra- food sector with the aim of being a for Grasslands News reconciliation and collaboration,” said ditional plants and medicines. trusted partner to support Indigenous Shaun Soonias, director of FCC Indig- “As we gain a greater understanding peoples’ full participation in this ex- enous relations. “As Canada’s leading of how to best support their success in citing, dynamic and diverse industry,” Farm Credit Canada (FCC) is build- agriculture lender, we are uniquely agriculture, we will work in partnership Hoffort said. ing a foundation of knowledge to bet- positioned to contribute to the success with Indigenous communities, stake- FCC is Canada’s leading agriculture ter understand and support Indigenous of Indigenous communities and entre- holders and entrepreneurs to develop and food lender, with a healthy loan communities and entrepreneurs to grow preneurs in this diverse and dynamic solutions that work for them, as well portfolio of more than $41 billion. Our and thrive in Canada’s industry.” as address their community priorities,” employees are dedicated to the future agriculture and food in- To become a better Soonias said. of Canadian agriculture and food. We dustry. partner, FCC is provid- Almost half of those surveyed see provide flexible, competitively priced “Diversification of ing extensive Indigenous significant opportunities in greenhouse financing, management software, in- Canada’s agriculture awareness and relations operation, community gardens, Indig- formation and knowledge specifically and food industry is one “FCC is working to become training to its more than designed for the agriculture and food of our top priorities and enous foods and food processing, al- a stronger partner in the ad- 2,000 employees across industry. As a self-sustaining Crown an integral part of FCC’s though there is a wide range of other vancement of Indigenous Canada. The training is small-scale agriculture activities taking corporation, we provide an appropriate mandate,” said Michael meant to help employees Hoffort, FCC’s president agriculture in the spirit of place on Indigenous lands. return to our shareholder, and reinvest better understand the “FCC is committed to building long- our profits back into the industry and and CEO. “It begins with reconciliation and collabora- legislative and systemic developing a deeper un- term relationships with key stakehold- communities we serve. For more infor- tion.” barriers that prevent In- ers in the Indigenous agriculture and mation, visit fcc.ca derstanding of Indige- digenous communities nous agriculture – the - Shaun Soonias, Director of FCC from fully participating history, barriers, aspira- in Canada’s agriculture Indigenous Relations tions and opportunities industry, as well as the $1.4 million aimed at farm safety of today.” historic, social and eco- FCC recently commissioned an on- nomic challenges facing First Nations, line survey of Indigenous producers Métis and Inuit across Canada. National News the development and maintenance of and stakeholders, which indicated more “There is a rich history and tradi- Grasslands News safety resources and tools to address ex- than 70 per cent of producers plan to tions of Indigenous agriculture prior isting and emerging safety needs at the increase participation in the sector over to European settlement, and we are provincial and national level. Minister of Agriculture and Agri- the next five years, despite reporting a now several generations removed from In addition to outreach and aware- Food, the Hon. Marie-Claude Bibeau, poor to average experience in the sec- those practices and knowledge,” said ness activities, CASA will continue to announced on March 15, an investment tor. Some of the biggest challenges cited Soonias, who is also a member of the provide farm safety learning opportuni- of up to $1.4 million over two years to were access to capital, equipment, la- Red Pheasant Cree Nation near Battle- ties to rural emergency responders and improve farm safety. The announce- bour and knowledge. ford, Saskatchewan. “FCC not only has firefighters, and provide online health ment helps kick off this year’s Canadian Most respondents believe growth is an opportunity to better understand the and safety training courses to farm Agriculture Safety Week by providing coming from multiple areas but tend to landscape of Indigenous agriculture in workers. the Canadian Agricultural Safety Asso- focus on crops and food processing. Canada but, more importantly, provide CASA will continue to provide essen- ciation (CASA) with funding to provide In order to sustain the growth needed Indigenous entrepreneurs with learn- tial training and tools to farmers and valuable farm safety tools and advice to to re-establish Indigenous food security, ing opportunities about agriculture and stakeholders relating to existing and Canada’s agriculture industry. respondents placed a high priority on farm management.” emerging safety concerns at the farm This funding through the AgriCom- the need to create agricultural and fi- Most Indigenous producers and stake- level. petitiveness program will also facilitate nancial learning opportunities for In- holders surveyed suggested the key to Farm safety is crucial to the overall a series of initiatives that promote farm digenous youth. They also want to see overcoming the various challenges in health and wellbeing of Canada’s farm- safety for producers, their families, and a deliberate approach for ensuring the Indigenous agriculture resides in train- ers, ensuring farmers have access to workers. Activities include awareness next generation is prepared and excited ing, education and mentorship oppor- tools to protect both their mental and raising, community engagement, and to continue growing agriculture and tunities, as well as access to capital to physical health. food businesses, while fostering rela- grow their businesses. There are also tionships with elders who offer a wealth many Indigenous agri-food and agribusi- of traditional knowledge. nesses that are well established, export- “FCC is working to become a stron- ing their products internationally and ger partner in the advancement of In- expanding operations and others who

21041DA0 Grasslands News B 8 April 2, 2021 Spring Agriculture Edition $11 million more for RM roads and channel clearing Premier Scott Moe’s address to SARM By Michael Oleksyn again to $1.5 million for a total invest- Local Journalism Initiative Reporter ment of $2 million over two years. This is an additional $1.4 million over two years to support RMs with channel Though it was headlined by an clearing activities. announcement about vaccinations, Channel clearing involves removing Premier Scott Moe’s address to the Sas- beaver dams, debris, trees and shrubs, katchewan Association of Rural Munici- and the removal of silt and blow dirt palities (SARM) convention on March 10 from and along natural channels, less- included some specific announcements ening the possibilities of blockages that targeted at rural municipalities. This can cause flooding and damage to infra- includes announcements of funding for structure. roads and expansion of channel clear- Obstructed creeks and channels ing. cause flooding and erosion problems to “This morning I want to provide many RMs and local landowners. This some details on how we are going to program supports RMs in the removal build a stronger Saskatchewan in the of these obstructions. months and in the years to come,” Moe “Our members welcome the news said. of this timely additional support for a Moe also discussed previous fund- needed program, especially as we enter ing initiatives such the Municipal Eco- the spring season,” SARM President nomic Enhancement Program (MEEP) Ray Orb said in a release. and the fast tracking of revenue sharing “Our communities are concerned not during the beginning of the COVID be- bridges over the next four years. “I’m hoping that that investment is only about proactively dealing with sit- fore going into the roads announcement. Through the first two phases of fund- an indication that the Water Security uations like flooding, but also practicing “That is why today I am announcing ing, 89 road projects and 45 bridge proj- Agency is going to be more responsive good water management that protects that we are going to invest an additional ects have been provincially approved, to some of the challenges that you have $11 million into rural integrated roads our ratepayers investments.” receiving nearly $38 million in support. been facing and in the future we will be Clearing dense vegetation can also for growth program.” Several of the bridge projects are still more responsive and be willing to work reduce unwanted nutrients from water The $11 million announced was on going through the federal approval pro- in partnership to deal with the water bodies and is an essential component of top of $28 million that is already bud- cess. and drainage issues that you are experi- any long-term water management plan. geted and was announced in June 2020. Moe said that making the announce- encing in your community in a way that Moe also discussed the meeting of “This money we know will be used ment now will ensure projects will be doesn’t unduly hinder economic growth campaign commitments such as the 10 and used efficiently to construct and ready for the next construction season. in this province and doesn’t hinder the per cent reduction on power bills, that repair roads in your municipality, to The province has committed to re-build economic recovery that we all seek,” the small business tax rate is temporar- construct and repair bridges and cul- 100 roads over the next three years and Moe said. ily cut to zero, the Home Renovation verts in RM’s right across this province 100 bridges over the next four years. The Water Security Agency origi- Tax Credit and the SGI rebate which and it’s a partnership that we are very As well, Moe announced $2 million nally budgeted $600,000 over two years proud of,” Moe said. over two years in funding to expand is coming in May. The rebate is due to for channel clearing. This increase in According to the SARM website, the channel clearing for rural municipali- a decline in accidents and the perfor- funding will allow for the program to RIRG programs funding is provided ties across Saskatchewan. This matter mance of the SGI portfolio. for roads, bridges and large diameter has been a concern for a number of grow to $500,000 for the 2020-21 fiscal “In our view this money belongs to culverts. According to the province years in municipalities. He explained year. In 2021-22, funding will increase the people of Saskatchewan,” Moe said. the RIRG is an important component that MLAs had heard for a number of of the province’s plan to re-build 100 years about this issue and it was time roads over the next three years and 100 to address it. • CLEAR LAND FOR FARMING & DUGOUT DEVELOPMENT Terry Halushka • SEPTIC TANK INSTALLATION 306-621-2588 Yorkton, SK • DEMOLITION CAT, SKIDSTEER & DUMPTRUCK WORK • TRENCHING

38 Deerwood Crescent Yorkton, SK S3N 2M5 [email protected] • EXCAVATING 306.782.3582 306.641.5559 LAWRENCE • GRAVEL HAULING Safely In ScrewPiling Securing your Modular Home, Garage, Deck or Addition THANK YOU Saskatchewan Ag Producers Tree Removal of any size Box 129 – 731 Lalonde Street Phone (306) 735-2210 Grasslands News www.grasslandsnews.ca April 2, 2021 B 9 Managing on-farm plastic waste and growing the bioeconomy

National News Baker, Member of Parliament for Etobicoke Centre bioplastic film and injection molded products that tar- Grasslands News The other recipients are: get agriculture applications such as mulch film and • EcoEnviro Labs Inc., which will receive up to $1 mil- seed trays. The project intends to displace conven- lion through Innovative Solutions Canada to advance tional petroleum-based agricultural plastics. Canadian farmers are looking to reduce waste, and testing of a new organic bioplastic mulch made from • Red Leaf Pulp Ltd., which will receive up to $495,000 plant-based plastics are an increasingly popular al- poultry feathers. This could serve as a lower-waste, through the Agricultural Clean Technology Program ternative as part of a growing Canadian bioeconomy. fully biodegradable and compostable way to produce to support research and product trials for a straw pulp Creating exciting new options for Canadian farmers, mulch needed in Canada’s agriculture sector. bio-polymer for use within the wood and pulp indus- while supporting them in responsibly managing on- • Titan Clean Energy Projects Corp., which will receive try, and in the production of low carbon fuels and re- farm plastic waste, is helping to build a healthier econ- up to $1 million through Innovative Solutions Canada newable natural gas. The project intends to displace omy and environment. to test a food-grade quality bioplastic, ideal for fruit or plastic and Styrofoam packaging. Late last month, Minister of Agriculture and prepared vegetable containers, that biodegrades more The announcement complements Agriculture and Agri-Food, the Honourable Marie-Claude Bibeau, an- quickly and will result in less landfill and more sus- Agri-Food Canada’s broader commitment to Canada’s nounced funding of more than $4.5 million for five new tainable options for grocery stores and shoppers. bioeconomy. Together, these investments highlight the projects that will improve plastic waste management • TerraVerdae Bioworks Inc., which will receive up to Government of Canada’s commitment to sustainability and on-farm sustainability, and advance bioplastics $1 million through the Agricultural Clean Technology while growing the bioeconomy and creating economic research. These green agricultural projects will help Program to develop a new generation of biodegradable opportunities and jobs. Canadian farmers remain leaders in sustainable, climate-smart agriculture. “Canada’s agricultural sector continues to develop innovative tools and approaches to ensure their operations are sustainable. Today’s funding will sup- NFU applauds Supreme Court GGPPA decision port farmers looking for ways to better manage their plastic waste, and help advance the necessary work National News preme Court case, not believe that the cur- (FCS) have put forward a to turn crop residues and other agricultural by-prod- Grasslands News because our organiza- rent climate emergency comprehensive list of gov- ucts into renewable energy. This is a win-win for our tion endorses the federal requires strong, swift ernment policies that can hardworking farmers, the environment and Canada’s government’s current Canadian government ac- assist farmers in reducing The National Farmers bioeconomy,” said Marie-Claude Bibeau, Minister of greenhouse gas pricing tion. NFU member Glenn agricultural emissions. Union (NFU) applauds Agriculture and Agri-Food. measures, but because the Wright stated: “The facts “This decision clears the the recent decision of the The minister made the announcement alongside NFU strongly supports are clear; we must acceler- way for the federal gov- Supreme Court of Canada Cleanfarms, a national non-profit industry steward- the federal government’s ate the transition to clean ernment to expand efforts to declare the Greenhouse ship organization. Cleanfarms will receive up to $1.1 constitutional authority energy and efficiency in to support farmers in re- Gas Pollution Pricing Act million through the Canadian Agricultural Strategic to create national policies order to mitigate the se- ducing emissions. Farm- (GGPPA) constitutionally Priorities Program to develop a strategy to responsibly to reduce emissions. This verity of the Climate Cri- ers want to lead in the valid. This decision con- manage the estimated 60,000 tonnes of plastic waste decision clears the way sis, safeguard our food struggle to safeguard the firms the federal govern- generated on Canadian farms every year. Their proj- for strong federal lead- supply, and protect biodi- climate and food system ment’s jurisdiction to take ect will increase farmer access to recycling programs ership and enforcement versity, and we must turn and reduce emissions, strong national leadership and explore ways to deliver long-term, permanent pro- powers coupled with on- our attention to creating but we need strong fed- action to curb greenhouse grams that will help Canadian farmers continue to im- going federal, provin- opportunities through col- eral partnership. This de- gas emissions and safe- prove the sustainability of their operations. cial, and territorial work laboration across multiple cision paves the way for guard the future for all “The Government of Canada is committed to sus- rooted in the principles jurisdictions.” that federal action” said Canadians. tainability and growing the bioeconomy. Today’s and traditions of co-oper- The NFU and its coa- NFU Director of Climate NFU President Katie announcement will not only create new recycling ative federalism.” lition partners in Farm- Crisis Policy and Action, Ward summed up the programs and opportunities, but it will improve sus- NFU members strongly ers for Climate Solutions Darrin Qualman. tainability and operations within farming. These new NFU’s approach to the projects will help local farmers continue to be leaders case: “The NFU became in sustainable, climate-smart agriculture,” said Yvan an intervenor in the Su- Salute to BUILT ON FARMER Relationships. Agriculture Grain producers and ranchers are the engine of our economy.

Best wishes for a safe, productive and prosperous 2021! Travis Keisig, MLA Last Mountain-Touchwood

110 Elgin St. Balcarres, SK Grain Millers is a family-owned company and has been a 306-334-3444 leader in whole-grain milling for over 30 years. We depend on direct farmer relationships and offer competitive farm gate pricing, agronomy and sustainability advice, and strong markets for your grains. Our commitment to producing Your Hometown Broker! quality products begins with you. Melville | Springside | Ituna We Purchase: 306-728-4457 228 Main St. Melville, SK @MA1974LTD www.melvilleagencies.com Oats • Flax • Barley • Motor Licence Issuer • Home/Auto/Farm/Commercial Wheat • Other Grains • Notary Public • Surety • Blue Cross • GMS

MELVILLE HOURS Monday - Friday 8:30 a.m. - 5:00 p.m. Saturday 9:00 a.m. - 12:00 p.m.* Oats/Feed Grains: 306.786.4682 *Excluding Long Weekends Flax: 306.933.4644 Other Grains: 952.983.1269 grainmillers.com | 866.730.4682

#1 Grain Millers Drive, PO Box 5040, Yorkton, SK S3N 3Z4 THANK YOU Saskatchewan Ag Producers Grasslands News B 10 April 2, 2021 Spring Agriculture Edition Sask. strikes partial AgriStability deal with feds

By Nick Pearce a change that will send about $95 mil- Saskatchewan farm groups. Last year, The overall changes to compensation Local Journalism Initiative Reporter lion more to producers nationally, a they lined up to call for easier aid access will be a relief for farmers, particularly Thursday news release said. The deal for industries scrambled by COVID-19. livestock producers, noted Thomas Lin- with the provinces applies retroactively The provinces and the federal gov- ner, agriculture critic for the provincial Saskatchewan has reached a partial to the program’s 2020 year, and will also ernment share the costs for the pro- Opposition NDP. However, he expressed deal with the federal government on the gram. However, a roughly $170-million concern that the agreement didn’t also linchpin farm aid program AgriStabil- extend the 2021 program deadline to top-up proposed by Ottawa months ago increase Saskatchewan’s cost-sharing ity. enrol to June 30. has failed to secure the support of the commitments. Federal Agriculture Minister Ma- “Reliable business risk management rie-Claude Bibeau announced Thursday programming is essential for the con- Prairie provinces. “These changes have the federal gov- that all the provinces have agreed to tinued growth of the agriculture sector. So far, Saskatchewan — along with ernment’s support, but the Sask. Party part of a plan to improve AgriStability, Producers made it clear (the change) Alberta and Manitoba — isn’t commit- government is blocking these changes a business risk management program will help the AgriStability program ted to covering its share of the money. from becoming a reality,” he said. that protects Canadian producers from function as intended and make the pro- The offer is still on the table, Bibeau In a news release on Thursday, the large declines in their farming income. gram more effective and equitable,” said said. Canadian Cattlemen’s Association wel- The parties struck the deal at a fed- Saskatchewan Minister of Agriculture A recent push from the Prairie prov- comed the changes, but expressed dis- eral-provincial-territorial meeting last David Marit. inces urged the federal government to appointment that the parties couldn’t Thursday. Lowering the trigger for payments cover its 60 per cent to boost the com- strike a deal on compensation rates. The deal makes it easier for farmers covering lost income has been a pensation rate, while leaving the prov- “(This) will go a long way in making to trigger payments over lost income — long-standing point of contention for inces “ﬂexibility” in their funding, a AgriStability more predictable and equi- Saskatchewan Ministry of Agriculture table for our industry,” the release said. statement said. — With Calgary Herald ﬁles AGRICULTURE WEEK 2021

Estevan looks to canola-based Ǥ ǣ diesel for city’s jobs transition ǯ By Evan Radford area to keep the economic release the facility will Ǥ Local Journalism Initiative Reporter development moving for- yield “greenhouse gas ǯ ward?” he said. emission reductions in To that end, Estevan is Ǥ Estevan Mayor Roy the range of 80 to 85 per Ludwig hopes a proposed working with Covenant cent when compared to Ǧ renewable diesel refinery Energy CEO Josh Gus- fossil fuel diesel.” It’s also Ǥ in the area helps his city tafson on his company’s to use recycled hydrogen secure long-term jobs. pitch for a large renew- in the refining process. able diesel refinery in the The renewable diesel 984-A Albert Street Two coal-fired units at SaskPower’s boundary area. would be sold to fuel dis- Regina SK S4R 2P7 dam are to close down Thanks to a provincial tributors like Husky or funding pot of $8 million (306) 790-4727 this year and in 2024. “We Shell or Co-op, who would can’t turn the clock back over three years, the city blend it into their diesel [email protected] on that. Of course we’re and nearby communities products sold to consum- looking at how do we have provided Covenant ers. WWW.ANDREWMP.CAWWW. transition for jobs in our with $200,000 to do a fea- The projected start sibility study for the re- year is 2023, though Gus- finery. tafson doesn’t yet have Gustafson projects the a firm month or specific refinery would process location nailed down. He 6,500 barrels of renewable hopes it will be in south- diesel per day. He said east Saskatchewan in the renewable diesel is differ- Estevan area. ent from biodiesel. ALWAYS KNOW WHAT’S BELOW Covenant suggests the Both use oil from facility’s operation will crushed canola seeds, create a maximum 60 per- but renewable diesel re- fines the oil in a process manent jobs. resembling what’s done Ludwig said Estevan’s with fossil-based crude. goal is to “create well-pay- It means there’s little ing jobs in our commu- oxygen left in renew- nity to make up for some able canola-based diesel, of the potential job losses which allows it to be used we see coming down the in sub-zero temperatures. pike.” The refining process Gustafson is also pre- uses hydrogen and a cata- dicting a boost to the lyst, Gustafson said. province’s agricultural By using canola oil as sector, concluding based a starting point, there’s on his research the fa- “no ash or metals” left in cility will create annual a vehicle’s engine when demand for 35 million it burns the refined prod- bushels of canola seed. CLICKING or CALLING before you dig costs nothing. uct, he said. Covenant Energy is Based on Covenant’s based in Macoun, about NOT CLICKING or CALLING could cost you and your initial research, the com- 25 kilometres northwest neighbours everything! pany said in a media of Estevan. The SASKATCHEWAN COMMON GROUND ALLIANCE and SASK 1ST CALL8'1-2&9'='8@32';38'7<'9;!£3$!;'(38<2&'8+83<2&<ধ£-;@ lines to be marked prior to any ground disturbance like digging. LET US KNOW

ALWAYS DIG SAFE! Do you know something that would make a great news story? About an event... or a person... or an organization. Let us know.

Toll Free: 1-844-GNG-NEWS www.sask1stcall.com Email: [email protected] Grasslands News www.grasslandsnews.ca April 2, 2021 B 11 Researcher making strides in prairie agriculture

By Emily Jane Fulford years, studying cover crops in culture, understand what this “Full season cover crops matically different climate and Grasslands News the prairies was a topic that process is all about. have also been used to tackle thus this information is not the came just at the right time for “Cover crops are grown at problem soils. A full-season best for Prairie farmers who Morrison to incorporate into times when a cash crop is not cover crop may involve a need to make their decisions,” University of Manitoba (U of his studies at U of M. growing, such as in the fall farmer taking an entire field said Morrison. “The report that M) Ph.D. student, Callum Mor- “I did my undergraduate or targeted areas within a field the survey will help create can rison, is only 25 years old but after harvest. The aim of cover thesis at the University of Ar- out of annual cash crop produc- be used as part of farmers’ de- is making significant ground in crops is to benefit the soil, the kansas, USA during a summer tion to improve the soil. Fruit cision-making process by al- the agricultural industry, spe- environment, and improve the exchange. While there I trav- growers may use full-season lowing them to see how cover cifically on the topic of cover subsequent crop. A common ex- eled to see my pen pal who lived cover crops in between rows of crops are being adopted by crops in the Canadian Prairies. ample would be planting a fall in Minneapolis. We decided farmers like them. The survey The research, which focuses on rye cover crop in late August or fruit crops. Farmers with fields the use of cover crops by prai- that we should go to Fargo early September following the that were too wet for planting also gives respondents a voice rie farmers, is being done in together and then decided we may plant a cover crop to dry to highlight areas for future re- conjunction with research fo- should go to Manitoba and at- out a field and improve the soil search.” cusing on the effects that cover tended the Winkler Harvest for planting the following year. After the research team gets crops have on yield, soil chem- Festival,” explains Morrison. Full season cover crops are the feedback they compile the ical, biological and physical “We had such a great time and popular with cattle farmers as responses into an annual re- properties. made some friends. One farmer they can be grazed at the end port. That report is then dis- “I grew up in Scotland with invited me back a month later of the season. This not only tributed free of charge to any parents who were both in the to see the harvest (due to the provides extra feed for hungry individuals who may be able agricultural industry,” explains realities of Arkansas cropping cows but also adds manure to to put it to good use. Doing the Morrison. “My father worked systems I would not get to see feed hungry soil microbes.” survey ensures that contact infor a company which produced a harvest during my summer The survey is designed to di- formation is available and that virus potato mini-tubers and there). I enjoyed seeing the rectly benefit Prairie farmers. a copy is sent out via email. horticultural plantlets via tis- Prairies and a year later came Even though cover crops are The team also posts the results sue culture and my mother was back to Manitoba to do a work- becoming increasingly popular to a website and sends the in- a research scientist researching ing holiday visa. I worked on a over the last few years, there formation out to a number of pests of potatoes and fruit. My rotationally grazed beef opera- remains limited information commodity groups and grow- grandfather used to work on tion and a canola breeding com- on how local farmers are using ers’ associations in an effort sugar cane and banana planta- pany. I then returned home to cover crops, and often is the to make sure that it gets in the tions in Trinidad and St Lucia. study a masters researching a case that farming is a small hands of farmers. Over the summers I used to bacterium which infects potato. world where communication “The report will include a work at the Scottish Crop Re- I knew I wanted to return to can make all the difference. summary of the overall findings search Institute.” the Prairies and wanted to do Without access to that infor- but also subsections where the Callum’s family background something that was innovative harvest of a cereal grain crop. mation, it made it difficult for results are broken down into is the reason for his growing and had the potential to benefit This has been one way that local farmers to learn from farm type (organic, livestock, interest in how farms can op- farmers and the environment. farmers get around our short each other what worked and tillage type etc.) but also, for erate in a way that is more I connected with Dr. Yvonne Prairie growing season. These did not. As a result, there was the major cash crops grown in sustainable. Since cover crops Lawley (my now professor) and types of fall shoulder season a limited use of cover crops, the prairies (oats, spring wheat, have the potential to benefit I decided that working with her cover crops will grow through simply because of the limit of canola etc.)” said Morrison. the environment as well as the was what I wanted to do!” the fall until freeze up. If the information about them avail- “This is to make the survey as farmers, it is a topic that ap- So what is a cover crop and cover crop can overwinter, they able locally. specific and relevant as possi- peals to both the agricultural how does this help farmers in will also grow next spring until “Many of those adopting ble to Prairie farmers thinking industry as well as environ- Saskatchewan? Callum Morri- they are terminated using her- cover crops have had to look about growing a cover crop or mentalists. With the use of the son put together an explanation bicides or tillage before plant- at data coming from the United those interested in how Prairie research and practice becom- to help people, especially those ing next year’s crop,” explains States. Although this is helpful, farmers are using cover crops.” ing more widespread in recent who are not involved in agri- Morrison. the United States has a dra-

ZzKE/d/KE^'KdzKhKtE͍

dŚĞƐƐŝŶŝďŽŝŶĞtĂƚĞƌƐŚĞĚ^ƚĞǁĂƌĚƐŚŝƉƐƐŽĐŝĂƟŽŶŝƐŚĞƌĞƚŽŚĞůƉ͊

FUNDING ŝƐĐƵƌƌĞŶƚůǇĂǀĂŝůĂďůĞĨŽƌ͗

DUGOUTS WELLS SOLAR WATERING SYSTEMS

FENCING WELL FORAGE DECOMMISSIONING CONVERSION

CALL (306) 783-1696 TODAY, PIPELINES YOU͛>>'>zKh/͊ www.assiniboinewatershed.com Grasslands News B 12 April 2, 2021 Spring Agriculture Edition Farm Stress Line sees an increase in calls By Spencer Kemp normalization, assure people that this Local Journalism Initiative Reporter is a normal response to a very difficult situation across the globe. We encourage them to call us at any time as often Many producers have turned to the as they need to if that will be helpful for Farm Stress Line to help deal with some them,” said Thorson. of the stress and feelings of isolation Concerns raised by producers were brought on by the job. largely around the stress of being iso- Acting Executive Director of Sas- lated during the pandemic. Thorson katchewan Mobile Crisis Services noted that the increase in isolation due which oversees the Farm Stress Line, to the pandemic has led to increased Jan Thorson, says that in the last quar- depression amongst the producers who ter of 2020 the agency has seen an in- have contacted them. crease in calls, followed by a seasonal “The main issues brought up to us decrease. are around mental health concerns, con- “I can certainly say for the last quar- cerns about depression, isolation, those ter with what we have statistically avail- kinds of things; family disputes and ad- able to us, yes we did see an uptake over dictions too.” Farm stress the summer and into the fall. We don’t Thorson explained that they have The Farm Stress Line in Saskatchewan saw an increase in calls in the last have our early winter statistics back been implementing a new system to quarter of 2020. Many of the concerns raised by farmers to the help line were yet, but I would suggest that there’s help track COVID-19 related concerns largely around feeling isolated during the pandemic. been a slight drop-off just because of the from producers as they currently do not time of year and the stresses of farming have a system in place. forefront of many producer’s minds, those things contribute to your overall aren’t as great in the winter in many This new system as it’s implemented Thorson reminds farmers of a few ways well-being all the time and they’re par- cases. We suspect that will turn around will provide Mobile Crisis Services with to deal with some of the stress. ticularly important during a pandemic.” again in the spring and we will see more additional information and will better “I would say, particularly during If a producer is feeling that they need calls to the line.” Thorson said. allow them to keep track of statistics. COVID, it’s very important to main- additional help, Thorson says that they The Farm Stress Line provides a ser- “It’s not something that we track tain contact with your friends or fam- provide recommendation services to vice to producers in Saskatchewan who specifically with our statistics, but we ily, whether that be through telephone callers who feel they may need them. feel the pressure of their job and pro- made some changes so we will be able calls or zoom meetings. I would really This service gets callers in contact with vides an opportunity to normalize their to do that, but it won’t be until down encourage them to reach out to someone professionals who can better help them. concerns. the road until we get that data back. they’re close to at least once a day.” Thorson explained that they see sea- “The Farm Stress Line is a gateway But I think what’s been hard for farm- Thorson also reminds producers to sonal increases and decreases in calls to service. It’s a place to bring your imme- ers has been the isolation that the cur- participate in some self-care, which can the Farm Stress Line, but have been see- diate concerns, talk with a profession- rent health orders have produced. And help reduce stress. ing more since the start of the COVID-19 ally trained counselor who can help I’d say that across the board for all our “Go easy on yourself, everybody is pandemic. you normalize some of the things you’re clients, that’s been very difficult for peo- suffering right now and it’s okay to not The Farm Stress Line is available going through, and help you decide if ple, particularly people who live alone be managing this as well as you may 24/7 and can be reached at 1-800-667-4442. you need more help. We have a resource or do not have access to a friend or fam- think you should be. Whatever you feel The Mobile Crisis Services also pro- bank of referrals that we can make for ily group, don’t have great wi-fi or in- you need to do to make yourself feel vides services for gambling addictions people if they feel they need more help. ternet access.” better is fine unless it’s destructive. Eat and a suicide hotline as well as a gen- I think the main thing we do is provide With the stress of COVID-19 at the properly, get some rest, exercise, all eral crisis hotline for those who need it.

NEW APPLY FOR THIS INDUSTRY PROGRAM TODAY! DRIVEN HEAVY June 7 - Aug. 27 or July 19 - Oct. 8 EQUIPMENT 1-866-999-7372 www.southeastcollege.org

2$8'!9'&9'!;ধ1'-2#3;,9-1<£!ধ32 OPERATOR COURSE !2&,!2&9f32;8!-2-2+R '2;8!££@£3$!;'&-23<;,'!9; !90!;$,'>!2W

Grasslands News www.grasslandsnews.ca April 2, 2021 B 13 Saskatchewan ag exports hit a record high Province produced $16.9 billion in ag exports in 2020, a 31 per cent increase from 2019

By Rob Paul Currently, the Government of Saskatchewan is creating jobs and bringing in money. Local Journalism Initiative Reporter working to open three new trade offices in Singapore, “Saskatchewan is an export-dependent province Japan and India in 2021 to support increased export and agri-food production continues to be an import- diversification. The new offices will complement the ant part of the province’s economy, which is driven 2020 was a record year for agricultural exports in existing trade office in China, and continued access to by fuel, fertilizer and food,” the spokesperson said. Saskatchewan, helping the province lead the nation in Asian markets will benefit our key economic sectors. “Saskatchewan’s top exports are: fertilizer ($6.1 bil- growth in overall export sales over the previous year. Saskatchewan’s 31 per cent increase in agricultural lion), cereal grains ($5.5 billion), mineral oil ($5.3 bil- Saskatchewan produced $16.9 billion in agricultural exports since 2019 has been in large part to increased lion), oilseeds ($4.6 billion), pulses and vegetables ($3.5 exports last year, a 31 per cent increase from 2019 and demand which has led to increased prices of high qual- billion), and animal/vegetable oils ($1.8 billion). The a new high for the province. This represents more than ity products. agri-food sector is a cornerstone of the Saskatchewan 55 per cent of total provincial exports in 2020, which “In 2020, Saskatchewan had more product available and Canadian economy, with agriculture and related were valued at $30.4 billion. to service international markets. In 2019 and 2020, Sas- activities accounting for approximately 10 per cent of This helps bring the province closer to meeting its katchewan recorded its second and third largest crops Saskatchewan’s GDP and 35,000 jobs. In 2020, the value Growth Plan goals, which include growing agri-food ever, with both years producing over 38 million metric of Saskatchewan’s top 10 exports increased by 3 per exports to $20 billion and increasing agriculture val- tonnes of crop,” said a spokesperson for the Govern- cent from $24.2 billion in 2019 to $24.9 billion in 2020. ue-added revenue to $10 billion by 2030. These strong ment of Saskatchewan. The top ten exports accounts for 82 per cent of the export numbers also reinforce Saskatchewan’s global “Many agriculture commodities experienced in- total Saskatchewan exports and agriculture exports reputation as a dependable source of safe, high-quality creased prices due to increased world demand and accounts for 56 per cent of the top 10 exports in 2020, resources, goods and products. some production problems in other parts of the world an increased from 43 per cent in 2019 and accounts for Overall merchandise export sales in 2020 were more (Australia and Europe) as a result of adverse weather more than 40 per cent of overall merchandise exports than $30 billion, up 2.5 per cent over 2019, the highest conditions. Other factors include prices in canola, in 2020.” percentage increase among the provinces. On a na- pulses, barley and other crops increasing, Canada’s The success of Saskatchewan’s record agricultural tional basis, exports were down 12.2 per cent over the grain handling and transportation system performed exports is expected to continue in 2021—though noth- same period. well during the year, and all of Saskatchewan’s main ing is guaranteed in the sector because of a number of Leading agriculture exports in 2020 continue to be field crops saw exports increase in 2020, with cereal factors, the Government of Saskatchewan is optimistic canola seed, non-durum wheat, lentils, canola oil and grains, oilseeds and pulses increasing 21, 42 and 78 per they will hit their Growth Plan goals for 2030. durum wheat. cent respectively.” “Agriculture production is weather dependent and “The global COVID-19 pandemic has hit all econo- As a result of the pandemic, the province saw in- can therefore be difficult to predict, however, over the mies hard worldwide, but these export numbers are creased demand in Saskatchewan produced agricul- medium term, we expect agri-food exports to reach new strong signs our province is in a positive position for ture products due to its strong reputations around the record levels. In 2020, the Government of Saskatchewan economic recovery in 2021,” Trade and Export Devel- world. released its new growth plan,” said the spokesperson. opment Minister Jeremy Harrison said. “With our “In 2020, Saskatchewan’s reputation as a trusted, “Two notable targets for 2030 include increasing agri- world-class and growing export base, we have what the safe and stable supplier of high quality agriculture food exports to $20 billion and crop production to 45 world wants and needs, and it will continue to drive commodities and value-added products was strength- million metric tonnes. In 2020, Saskatchewan had ad- investment and jobs for communities right across Sas- ened,” said the spokesperson. “There was an increased ditional product to service international markets and katchewan.” level of demand/dependence on Saskatchewan agricul- we expect that capacity to increase in the years ahead. In 2020, major increases in exports were seen in ture commodities as essential food staples in local diets In 2019 and 2020, Saskatchewan recorded its second farm and intermediate food products, forestry prod- around the world, including pulses and canola seed. and third largest crops ever, with both years producing ucts and building and packaging materials, and indus- The Saskatchewan government remains committed to over 38 million metric tonnes of crop. Global demand trial machinery, equipment, and parts. Saskatchewan’s supporting open and stable global supply chains by en- for food, due to a growing population and rising in- top international markets for 2020 include the United suring agri-food products can move efficiently, without comes, is creating additional export opportunities. States, China, Japan, and India—top markets for Sas- disruption, through our transportation system.” “There are many factors that influence exports from katchewan agri-food exports in 2020 were the United With COVID-19 having a negative impact both in year to year, for example crop prices. The Government States, China, Japan, India and Mexico. Canada and globally on economies, Saskatchewan’s ag- of Saskatchewan will continue to work on and nurture “Saskatchewan producers grow safe, high-quality riculture sector has been as important as ever in help- trade relationships in priority markets, as well as seek food that the world needs and our agriculture exporters ing support the country as its backbone both through growth opportunities in the agri-food industry.” remain committed to providing the world with these products,” Agriculture Minister David Marit said. “I want to commend our producers on their hard work and resilience, which led to a new record in agri-food exports for 2020.” EVERY STEP. Increases in primary production as well as a growing value-added sector have contributed to the record agri-food export growth in Saskatchewan. In 2020, val- EVERY SEASON. ue-added exports were $3.2 billion. Canola oil, canola meal and processed oats were Saskatchewan’s top value-added products.

Double Bar D Farms Grenfell, SK

• Family owned and operated • 3 generations working together

Ken Dimler . c. 306-697-7204 olutions, Inc MaMake theh moost off everyy oppportunity to lead the ﬁeld S

g Mark Dimler wiw tht Nutrien Ag Solutit onons™. Offffering a comprereheh nsnsivve Nutrien A Nutrien c. 306-697-7203 f poortfolio of innnovative prodo ucts and sere vices plp us locala Email: [email protected] exxpertise. Calll your local Nutrien Ag Solutions tooday oro n is a trademark o g www.doublebardfarms.com visis t us at our digital hub at Nutrir ennAgSolutionns.ca olutions™ and Desi S

g As much as we strive for personal success we take equal pride in seeing others succeed! Nutrien A Grasslands News B 14 April 2, 2021 Spring Agriculture Edition Bill may lead to exemption for grain drying: APAS

By Rob Paul such as rail and road transportation, electricity, and ment there as well whether it be with a rebate program Local Journalism Initiative Reporter grain drying. These costs would be even higher in years or an exemption or whatever they’re going to come up like 2019, when most of the grain and oilseed crop re- with. It’s very positive on both sides and we’ve seen all quired grain drying due to a wet harvest. political parties in Ottawa recognize that it’s an issue.” A Saskatchewan farm group is optimistic that a “We have argued for years that producers cannot Since the introduction of the carbon tax, Lewis and private member’s bill will lead to an exemption from pass these additional costs along to our customers, and APAS have made lobbying for exemptions a priority the carbon tax for grain drying and heating on farms, that they further reduce our financial viability,” Lewis and now they’re beginning to see the hard work come which are dependent on natural gas. said. “This additional cost of carbon taxation does not to fruition. Bill C-206 has passed its second reading and will be help to solve the problem of carbon emissions.” “We’ve had a long sustained lobby on this and I know reviewed by the Standing Committee on Agriculture In December 2020, the federal government announced we’ll continue to push it every chance we (get to) talk and Agri-Food before returning to the House of Com- that the carbon tax will increase to $170 per tonne by to decision makers,” he said. “It goes to show with the mons for its third reading. If the bill passes through 2030. In January, APAS released updated estimates of passing of C-206—especially in a minority parliament— the House it will allow for carbon tax grain drying ex- the impacts the carbon tax will have on agriculture. how important this is to be in touch with all parties emptions. “Our updated numbers show that the cost of produc- down in Ottawa. You never know where support might The bill was introduced by Northumberland—Peter- ing wheat could go up to over $12.50 per acre in 2030 be needed and it’s always good to talk to opposition borough South MP Philip Lawrence and seconded by due to the carbon tax,” said Lewis. “This cost increase and government members and that’s something we’ve Provencher MP Ted Falk. It received support from all is carried entirely by farmers and can’t be passed along really strived to do over the years. We want to approach Conservative, NDP, Bloc Quebecois, and Green Mem- to our customers. We’re looking at a reduction of net everyone in Ottawa to tell them what we’re lobbying on bers of Parliament. farm income by hundreds of millions of dollars in Sas- and what our concerns are and certainly in a minority The Agricultural Producers Association of Saskatch- katchewan alone, and the modest rebates provided by parliament it’s paid some dividends.” ewan (APAS) has supported the passage of Bill-C-206, the federal government won’t make up for these losses. Seeing their efforts pay off has been huge for APAS which would exempt on-farm natural gas and propane It’s unsustainable for our members. says Lewis, and it only furthers their drive to continue use for grain drying and heating from the carbon tax. “The carbon tax is designed to provide incentives to ensure there’s a stronger understanding of agricul- APAS has been pushing for carbon tax exemptions since to reduce energy consumption, but these dramatic cost ture and the negative impact a carbon tax can have on the tax was introduced by the federal government. increases will decrease our ability to adopt the new Canada’s producers. “Our members have been very concerned about the technologies that help us do just that. In some cases, “Farmers support the ag groups and certainly our impact of the federal carbon pricing system on un- producers will pay for efficiency gains like high-capac- membership has given lots of feedback about Bill C-206 avoidable energy inputs like fuel to dry grain or heat ity grain hopper cars through their freight rates, and and also another bill about farm transport,” he said. livestock facilities,” said APAS President Todd Lewis. yet those cost savings will go to the railways. Our mem- “Those are both good examples of long-term lobbying “We have been calling for the federal government to bers expect us to stay on this issue until our concerns efforts that we’ve been doing for a number of years. recognize these impacts and provide relief through ex- are heard.” “Sometimes it seems like you’re out there just spin- emptions, or rebates at the very least. We would like to Lewis isn’t only worried about the economic impact ning your wheels, but we’re finally getting some trac- thank the members of the House of Commons that heard of a carbon tax, but APAS has concerns that it will action—especially on the carbon pricing model. It’s so the concerns of producers.” tually cause a negative environmental impact as well. important to get these exemptions right to start with Cost estimates developed by APAS in 2019 and up- “When you add costs to a producer’s bottom line it and we look forward to continuing to tell agriculture’s dated in 2021 showed a $1.04 per acre production cost creates incentives for them to convert grasslands and story when it comes to things like carbon sequestration increase for wheat, rising to $4.44 per acre by 2030. other natural carbon sinks into cropland just to remain and carbon sinks on both pasture land and crop land in The APAS estimates were calculated using key in- viable,” he said. “That works directly against the goals Saskatchewan. We’re world leaders and hopefully we’ll direct costs that are not exempt from carbon taxation, of the policy. Agricultural producers have waited de- see some traction on that—same thing with clean fuel cades to see some recognition of our environmental standards. The carbon file is getting to be more and stewardship, and we have seen a lot of lip service, but more relevant and of course agriculture is really part A salute to not much concrete action.” of the solution.” With the bill passing through its second reading in The environmental changes in modern agriculture Agriculture Producers the House, Lewis sees it not only as a big step for the over the last few decades have been vast and Lewis agriculture community, but a big step in members of thinks there’s starting to become a better grasp by deci- parliament gaining a better understanding of grain dry- sion makers of just how important these changes have I would like to express my appreciation ing and how impactful the carbon tax will be on it. been. to our agriculture community for the “The C-206 passing (second reading) is good news, “I think there is a general understanding now,” he especially with the people voting in favour of it being said. “We saw last week, members of parliament from enormous contribution you make to our all the opposition parties and even one member of the coast-to-coast—it’s safe to say that two to three years province’s economy. Liberal caucus did as well,” he said. “I think having ago they didn’t even know the grain was dried—voting support from all parties is pretty significant—even the on this. There’s more and more understanding around Green Party is on our side with it. modern agriculture and what we have done for the envi- “Obviously we’ve gained some traction and under- ronment and there’s lot of opportunities for recognition Steven Bonk, standing around how important grain drying is and of what we do. We’re always trying to make improve- there really are no alternatives to using propane and ments. Nobody is saying that agriculture can’t improve MLA natural gas to dry grain. I think that was a real positive its carbon management, but at the same time, we’ve MOOSOMIN and after the bill passed the government has said they’re been doing it for years and we will continue to with or going to look at grain drying so there’s been some move- without carbon pricing.” CONSTITUENCY

Phone: 306-435-4005 Call Tim at 306.730.9933 622 Main St. • Moosomin, SK [email protected] FAIRLAND SEEDS LTD. Melville, Sask. Your Canola Seed Specialist Proud to support local communities

Premier Realty Selling Saskatchewan • Canola, Corn, Soybean & Forage Seed Grain farms, Ranches, &HUWLÀHG&URS&RQVXOWDQW Organic farms and 1H[HUD&RQWUDFWV Acreages. 6DOHV$JHQWIRU1XWULHQ$J6ROXWLRQV Call for competitive rates. $OSLQH3ODQW)RRG0LFUR1XWULHQWV Book an appointment today. *UDLQ%DJVDQG1HW:UDS *O\SKRVDWH6HHG7UHDWPHQWV,QRFXODQWV Larry Hanowski Melville, Sask. 0RUH3URGXFWV Cell: 306-728-9033 6DPH*UHDW6HUYLFH*XDUDQWHHG Email: [email protected] Web: www.langenburgrealestate.ca Grasslands News www.grasslandsnews.ca April 2, 2021 B 15 Farmland value increases during pandemic

Canada’s farmland scribes changes in Cana- chief economist. “Despite “Producer investments of 2.3 per cent, Nova Sco- tain a risk management market remained strong da’s farmland values from having gone through a in farmland are a reflec- tia’s increase was 1.6 per plan that takes into ac- and stable during a year Jan.1 to Dec. 31, 2020, cov- uniquely volatile year, tion of their confidence cent and New Brunswick count possible economic marked by economic tur- ers almost an entire year farm income generally and optimism,” he said. had a 1.3-per-cent in- changes, ensuring their bulence caused by the of disruptions caused by improved and the overall “Agriculture presents op- crease. This follows more budgets have room to COVID-19 pandemic, ac- the pandemic. For Cana- demand for farmland re- portunities as producers significant increases in flex if commodity prices, cording to the latest Farm dian agriculture, disrup- mained strong throughout seek to expand, diversify 2019. yields or interest rates Credit Canada (FCC) tions included temporary 2020.” or transfer their opera- Weather played a sig- shift. They also need to Farmland Values Report. food processing plant Despite important tions to the next genera- nificant factor in New exercise caution, espe- The average value of closures, some displaced supply chain disruptions tion.” Brunswick and Nova Sco- cially in regions where Canadian farmland in- exports, sector-specific caused by the pandemic, The highest average tia, as well as other parts the growth rate of farm- creased by 5.4 per cent in labour shortages and commodity prices climbed provincial increase for of the Atlantic provinces land values exceeded that 2020, slightly more than significantly altered con- in the last half of 2020 for farmland in 2020 was in in 2020. The region expe- of farm income in recent the 5.2 per cent increase sumer buying habits. many crops and interest British Columbia and rienced the worst drought years. reported in 2019. “Since land is the rates kept close to historic Quebec, with averages in decades during the “The pandemic has In Saskatchewan, av- most valuable asset on lows. Domestic demand of eight and 7.3 per cent, critical growing season, underscored the value of erage farmland values any farm operation, the for food remained strong respectively. Alberta fol- which significantly dimin- having a comprehensive increased by 5.4 per cent agriculture land market and global supply chains lowed with a six-per-cent ished the value of cash risk management plan in 2020, following gains of is a good barometer for continued to have an ap- increase and Saskatch- crops, as well as created that covers all risks areas: 6.2 per cent in 2019 and 7.4 measuring the strength petite for Canadian food ewan mirrored the na- hay and forage shortages. production, marketing, fi- per cent in 2018. of Canadian agriculture,” and commodity exports, tional average increase of There was an insuffi- nancial, legal and human The report, which de- said J.P. Gervais, FCC’s Gervais noted. 5.4 per cent. cient number of publicly resources,” he said. Ontario and Manitoba reported sales in New- “Farm operators need to both reported increases foundland and Labrador have the financial ability that were lower than the to fully assess farmland to protect their operations national average at 4.7 values in that province. from the potential impact Feds to sow a farm-based and 3.6 per cent, respec- Increases in farmland of risks that may not be tively. values reported across on their radar. Fluctua- Farmland values the country are as wide tions in commodity prices across the prairies were and varied as the factors and interest rates and/or climate research hub in Sask. mainly influenced by that may have influenced unforeseen variations in tenants purchasing land them. Average farmland production can diminish By Nick Pearce include cover crops, intercropping, con- from landlords, neigh- values have increased the ability to safeguard Local Journalism Initiative Reporter version of marginal land to permanent bour-to-neighbour sales, every year since 1993; and build equity in the op- cover, shelterbelts, nutrient manage- producers buying or sell- however, increases were eration and successfully ment, and inclusion of pulse crops in The federal government wants to ing land to gain opera- more pronounced from meet cash flow require- rotations, a Thursday news release said. plant the seed of an open air climate tional efficiencies and 2011 to 2015 in many dif- ments.” Federal funding for farm research is change laboratory on Saskatchewan family farm purchases to ferent regions. Since then, Given the uncertain positive, but “the devil is always in the farmland. support succession plans. Canada has seen more economic environment, details,” said Agricultural Producers Atlantic provinces moderate single-digit in- Gervais recommends Minister of Agriculture and Agri- Association of Saskatchewan (APAS) saw the smallest average creases in average farm- farmers, ranchers and Food Marie-Claude Bibeau wants the lab President Todd Lewis. farmland value increases land values. food processors continue to act as a hub, bringing farmers and in 2020. Prince Edward Is- Gervais said producers to thoroughly evaluate scientists together to find best practices If the projects are successful, it could land reported an increase should have and main- their investments. for a sector facing the brunt of climate reveal valuable information about farm- change. ing in Saskatchewan, he said. “The aim of this program is for every Saskatchewan producers are open province in Canada to have at least to research opportunities and benefit one hub of collaboration,” she said on from close ties with the University of The Importance of Agriculture Thursday. Saskatchewan and the University of Re- “Each hub will centre on real farms gina, he said. First Nations in Saskatch- and the Food Supply Chain where farmers and researchers can ewan with large agricultural footprints co-develop and widely share their best may also be strong candidates, Lewis practices.” added. To all our Farmers & Ranchers The federal government has ear- Farm groups encouraging their marked $185 million over the next 10 members to participate could help up- We Thank you so much for all you do. years to kick-start the project. The first take, but that also goes for individual phase launches April 1 and aims to cre- producers looking to improve their best ate proposals for the hubs, known as practices. “living labs,” by offering grants of up Lewis pointed to shelterbelts as an Hon. Warren Kaeding, PAg example of a strong possible research to $100,000. Minister for the Enviroment The second phase is slated to begin in project. Many of the lines of trees and the fall; up to $10 million is to be spent shrubs forming barriers on farmland '£=-££'f!£;$3!;9329ধ;<'2$@ă$'9 per project. have been removed in Saskatchewan, Indigenous organizations and non- making them prime targets for study. For assistance please call 306-728-3881 profit groups may also be considered for Ongoing issues with pollinators may funding, a news release added. also mean they’re well suited to be rees- or email [email protected] The money is an expansion of the fed- tablished, potentially as a collaboration eral government’s living labs program, between researchers, canola growers which is currently active in Manitoba, and APAS members, Lewis said. WW3?'£=-££'T Ontario, Quebec, and Prince Edward Is- “Hopefully, the money’s accessible Website: www.warrenkaedingmla.ca land. and we’re able to get some good projects 329ধ;<'2$@99-9;!2;-$0$ 2;@8' Some of the practices up for study up and running.” Stockholm Agencies Ltd. MILLER MOAR GRODECKI 113 Ohlen St., P.O. Box 322, Stockholm, Sask. Tel.: 306.793.2900 Fax: 306.793.2959 Email: [email protected] KREKLEWICH & CHORNEY ,!8;'8'&83('99-32!£$$3<2;!2;9

!81T'8932!£{38638!;'!?8'6!8!ধ32{£!22-2+ Salute our Saskatchewan Farmers $$3<2ধ2+{<&-ধ2+'8=-$'9f -2!2$-!£;!;'1'2;8'6!8!ধ32 3300''6-2+{!@83££'8=-$'9

• Personal Insurance • Hail Insurance MELVILLE ESTERHAZY GRENFELL WHITEWOOD Һ Һ ¤Һ Һ • Farm Insurance • Health Insurance ¤Һ¥Һ ¤ҺҺ¤¤ ¤Һ¤Һ¥ ¤ҺҺ¥ • Commercial Insurance • Motor Licence Issuer • Notary Public Һ Z Business Hours: Һ Tuesday to Friday: 9:00 a.m.-12:00 noon & 1:00 to 5:00 p.m. Saturday: 9:00 a.m. -12:00 noon Sunday & Monday - CLOSED www.millerandco.ca Grasslands News B 16 April 2, 2021 Spring Agriculture Edition Ag investments are up since %(/2:)$&725< elimination of Wheat Board ',5(&735,&,1*

The Western Canadian Wheat Growers is highlight- ing the significant increase in agriculture investment 61$3/2&.+,''(1 Farmland For Sale Employment that has taken place with the elimination of the sin- /22.,1* )25 RU TXDUWHUV RI gle-desk system, also known as the Canadian Wheat )$67(1(5 FOR SALE: 2015 VOLVO and 2017 cultivated grainland within a 30-mile JUDLQ EXONHU %WUDLQ )RU PRUH LQIR HEAVY DUTY Board (CWB). Until August 1, 2012, Western Canadian 67((/522),1*12:$9$,/$%/( radus of Whitewood. Will pay going phone 306-338-7006. MECHANICS & grain farmers were forced to use the CWB to sell their $$ rate for the area. If interest- 1A TRUCK DRIVERS ed, email me at: life.lines@hotmail. REQUIRED: wheat and barley. Since that date, when moderniza- com tion took place, all Canadian grain farmers have been 6758&785$/67((/'($/(5 Auctions Late model, clean CAT, :$17(' 72 5(17 ² )DUPODQG JD equip; winch, dump, able to choose who to sell their grain to, based on near Melville. Cash rent. Prefer 3 - 5 gravel trucks, and QUICK SOLD AUCTION price, quality, delivery dates, contractual terms and *UDGH&RORXUHG year term. 306-631-1586. trailers. Both camp and VTIW Serving Southeast Saskatchewan. shop locations; R & B location. Let us help you sell your items, get- provided “The government-mandated Canadian Wheat Board ting you the best possible price in %*UDGH&RORXUHG Real Estate the least amount of time. Items will Wage negotiable. held western Canadian grain farmers hostage. Our VTIW get Canada-wide coverage with our Clean drivers abstract free-market system has allowed farmers to choose Online auction. a must. )ODWODQGV 5HDO (VWDWH 7HDP %*UDGH*DOYDQL]HG Specializing in antiques, vintage Send resume and what is best for their farm. As markets open up +HOSV ZLWK )DUP $FUHDJH SURS- and collectible items of all kinds. work references to: around the world, as a fellow farmer, I encourage all VTIW erty of all types and situations. Certified personal property ap- Bryden Construction farmers to adopt a free-market system. The freedom to $JHQWV EDVHG LQ 5HJLQD )RUW 0XOWL&RORXUHG0LOO(QGV SUDLVHU'RQ·WWKURZDQ\WKLQJDZD\ )V_(YIVYÄLSK:R market helps increase a farmer’s control over their on- 4X·$SSHOOH &DOO until you talk to us. :,(" VTIW Century 21 Dome Realty Inc. farm decision making with regard to crops, rotation, Free consultations call Fax: 306-769-8844 306-728-5552 or 306-730-7310 ,THPS! inputs and varieties,” said Daryl Fransoo, Chair. &DOOXVQRZIRUEHVWVHOHFWLRQ quicksoldauctions.com brydenconstruct@ Since 2013, there has been over $3.0 billion in grain RIOHQJWKV FRORXUV PL#508277 xplornet.ca Seed www. infrastructure improvements, including new inland 26%·[·&HGDU :$5'·6 %8' +$<1(6 ),5( brydenconstruction terminals, elevators, grain buying companies, and port µ2&µ )25$*( 6((' )25 6$/( $506 $8&7,21 6DWXUGD\ andtransport.ca expansion. In addition, rail companies have poured VKHHW Organic and conventional: Sweet $SULO (GPRQWRQ $% 2QOLQH Clover, Alfalfa, Red Clover, Smooth billions into loop tracks, modern hopper cars and sup- %LGGLQJ /LYH 3UHYLHZ $SULO 1RZVHOOLQJ6FUHZ3LOHV %URPH 0HDGRZ %URPH &UHVWHG :DUGV$XFWLRQVFRP &RQVLJQ 1RZ porting infrastructure. This level of investment would ·)UHH6WDQGLQJ3DQHOV :KHDWJUDVV7LPRWK\HWF6WDU&LW\ %UDG:DUG780-940-8378. not have taken place without a full free-market system 6. %LUFK 5RVH $FUHV /WG 921-9942. for our grain and oilseed markets and all grain farm- $VNXVDERXW Now hiring ers have benefited. Individuals have had the freedom )XHO$OORZDQFH Common millet seed #1. Cleaned CROP HAIL and bagged. $21.00 per bag. Call Wanted ADJUSTERS of diversifying their crops to meet global demands and *LEVRQ·V0RRVRPLQ for the 2021 hail season better meet their crop rotation needs. )28,//$5'67((/ SK. (Jul-Oct). “The Western Canadian Wheat Growers worked for 6833/,(6/7' Competitive salary, many years to achieve a fully free-market system for expenses & mileage ZZZIRXLOODUGVWHHOFRP the sale of our wheat, barley, oats, and other grains. paid, health spending account and pension Farmers, private companies, consumers, and govern- 67/$=$5(0% plan. Continuous ments have all benefited,” said Jim Wickett, Secre- training using our industry leading CHAP tary-Treasurer. WF tablet program. Looking CERTIFIED SEED for seasonal summer employment? Retired or WHEAT semi-retired - this job is GO EARLY, PINTAIL. for you! Join our team OATS and start your new HILLSIDE WELDING AC JUNIPER, AC MORGAN, career. AC MUSTANG, DERBY, Email: SO1 SUPER OAT. [email protected] BARLEY for more details and '-;,!2+T'£=-££' AMISK, BUSBY, CONLON, application form. CDC AUSTENSON, 306-569-1852 ext 170. 1-306-728-4095 CDC MAVERICK, CERVEZA, SUNDRE. PEAS AAC PEACE RIVER '8=-$'9 (VERY EARLY YELLOW), CDC HORIZON (FORAGE), • • POLISH CANOLA, Class 1 Owner Operators Welding Hydraulic Hose SPRING TRITICALE needed to haul bulk liquid • !#8-$!ধ2+ Repair mastinseeds.com products throughout MB, 403-556-2609 SK, AB and the Northern • Break Work • Grade 5 & 8 United States. • tĞŽīĞƌĚĞĚŝĐĂƚĞĚ Shearing Bolts dispatch, well maintained • • equipment serviced at Aluminum Metric Bolts our own facility, modern • • technology, pension and Reynolds Trailer Parts ŚĞĂůƚŚĐĂƌĞďĞŶĞĮƚƐ͘ Roller Chain • Mobile Unit Loaded & empty miles paid! Phone: 204.571.0187 • Bearings RESUMES: Email: ƌĞĐƌƵŝƟŶŐΛ renaissancetrans.ca To everyone in the Agricultural Industry of Fax: 204.727.6651 KŶůŝŶĞƉƉůŝĐĂƟŽŶ͗ Saskatchewan, have a safe harvest season. www.renaissancetrans.ca Join Grasslands News 12,000 weekly readers

SUBSCRIBE TO THE FOLLOWING: ❑ Melville Advance ❑ Fort Qu’Appelle Times ❑ Whitewood/Grenfell Herald Sun

Name:

Address:

Town/City: Prov: ✁ ✁ Help to build a stronger community! Postal Code: Phone:

-$0f<6<#9$8-6ধ32 !90W<#9$8-6ধ32 !2!&!<#9$8-6ধ32 Subscribe TODAY! ¥W W¥ W

CALL US TOLL FREE AT 1-844-464-6397 (EXT. 222) 838!;'&8!;'9(389<#9$8-6ধ3299;!8ধ2+-268-£;,3<+,;3'$WTW 2$£<&'&W Grasslands News www.grasslandsnews.ca April 2, 2021 B 17 of antibiotics in both beef cattle and bison herds, thus reducing antimicro- U of S receives $6.76 million bial resistance. Adams and his team will develop better tools to test wildlife and domestic animals to revive bison population to identify and prevent spread of diseases, including those that can spread By Greg Basky netically isolated herds environmental steward- to humans. for USask Research Profile and Impact and disease, bison remain ship” or “IntegrOmes” With the new funding, a at less than two per cent for short—will include a cow-calf and bull handling of their historic popu- fibre optics network link- facility will be built at the The University of Sas- lation. Without conser- ing on-campus labs with katchewan (USask) has LFCE’s Goodale Research vation efforts, bison as the LFCE to enable rapid Farm and will house the been awarded $6.76 mil- a distinct species would transfer of large volumes lion from the Canada new genome biobank. The cease to exist,” said team of data. animal handling facili- Foundation for Innova- leader Gregg Adams, a A key benefit to beef ties at the LFCE’s Native tion (CFI) to help conserve specialist in reproductive producers will be devel- Hoofstock Centre will be bison and other threat- biology at USask’s West- opment of new genomic renovated and expanded ened animal species and ern College of Veterinary tools to enable trait selec- to enable safer and more address challenges facing Medicine (WCVM). tion, enhance genetic di- efficient collection, cryo- rwal, and Jaswant Singh, (DICE-TAC). the beef cattle industry, Genome biobanks are versity, and diagnosis of preservation and transfer as well as Matthew Links Adams said the pro- including antimicrobial used to store and redis- disease-causing microbes of genetic material among in AgBio. Other team gram will also help train resistance which poses a tribute genetic material in herds. bison herds. members include Toronto the next generation of global threat to animals to preserve genetic di- “Our aim is to make it New equipment for Zoo reproductive biologist wildlife veterinarians, and humans. versity. Adams and other easier for cattle produc- high-performance com- Gabriela Mastromonaco, biologists, and scientists “Working with our researchers will use ge- ers to identify and breed puting and data handling, University of Calgary with skills to incorporate partners in the livestock nomic tools to identify animals with desirable as well as for genetic se- evolutionary ecologist new strategies in their industry, Indigenous and restore the natural traits such as better meat quencing, will be installed Jocelyn Poissant, and species management groups and other leading genetic composition and quality, stronger im- at an on-campus genomics veterinarian and cryobi- plans. academic institutions, genetic diversity of Can- munity against disease, lab for use by the WCVM ologist Muhammad Anzar With the CFI contribut- we will place Canada on ada’s plains bison and improved production ef- and the university’s Col- of the Animal Genetics ing 40 per cent of total pro- the global stage of an- wood bison populations, ficiency (associated with lege of Agriculture and Resources of Canada program funds, the team will imal conservation and ensuring the species will reduced greenhouse gas Bioresources (AgBio). gram at Agriculture and seek an additional $10.1 production,” said USask survive for generations to emissions), and better ad- Some of the CFI fund- Agri-Food Canada. million from other public Vice-President Research come. The work has the aptation to their environ- ing will also be used to Building on an existing and private sources. Dr. Baljit Singh. support of the Assembly ment,” said University of purchase and outfit a collaboration with Sas- A powerhouse for inno- “This expert multidis- of First Nations and other Alberta researcher and mobile lab for conduct- katchewan Polytechnic vative research, teaching ciplinary team will apply Indigenous groups. team member Graham ing time-sensitive testing (Sask Polytech), research and industry engagement, genomics and other new “A genome biobank Plastow, an internation- of animals away from and technical training the LFCE is a complex of technologies to the beef provides one of the best ally recognized expert in the USask campus, such related to secure trans- field and science labs fo- sector to enhance pro- opportunities to revital- the use of genomic tools as bison herds or poten- fer and management of cused on improving all duction, livestock health, ize the bison species and for selecting desirable tial disease outbreaks on big data will be carried aspects of livestock pro- and food safety, as well as will serve as an excellent traits in cattle and pigs. farms. out, working with Terry duction. It includes al- reduce greenhouse gases model that can be applied “This work will lead to Other USask research- Peckham, director of Sask most 9,000 acres of land, for a more sustainable fu- to other threatened Cana- innovations that benefit ers include WCVM sci- Polytech’s Digital Integra- a 1,500-head feedlot, a 400- ture.” dian species, such as car- a host of individuals and entists Cheryl Waldner, tion Centre of Excellence head cow herd and 115 The wide-ranging re- ibou,” Adams said, noting organizations, including Janet Hill, Dinesh Dada- Technology Access Centre bison. search program, made that more than 30,000 ani- livestock producers, vet- possible through the CFI mal species are at risk of erinarians, and policy Innovation Fund, in- extinction worldwide. makers.” cludes working with In- New knowledge, tech- To stay globally com- In recognition of digenous communities to nical expertise and ge- petitive, Canada’s cattle develop the world’s first netic material will be industry—which accounts the Canadian bison genome biobank at shared with zoos around for $18 billion of the coun- the university’s Livestock the world, including try’s annual gross domes- and Forage Centre of Ex- with the Toronto Zoo, a tic product—must reduce farmers who feed cellence (LFCE). long-standing research its environmental impact Prime Minister Jus- partner with its own via- and battle antimicrobial our economy and tin Trudeau announced ble herd of wood bison. resistance, said Adams. more than $518 million Bringing together ex- “The cattle industry is to support the infrastruc- perts in areas as diverse under a lot of pressure to the world. ture needs of universities as reproductive technol- be more sustainable and and research institutions ogy, beef cattle health eco-friendly, and we hope across the country. and disease, genomics, to be part of the solution,” “After the near extinc- microbiomics, and bioin- he said. tion of bison 100 years formatics, the research The IntegrOmes pro- ago, Canada has led the program—“Integrated gram will make possible way in bison conserva- omics for sustainable real-time diagnosis of dis- tion, but due to small ge- animal agriculture and ease and appropriate use C W Ph: 306-782-3309 Member of Parliament Email: [email protected] Proudly Serving Our Agriculture Yorkton-Melville Members Today & Always! HAUSER’S MACHINERY LTD. Hwy. #15 West, Melville, SK TEL: (306) 728-2101 — TOLL FREE: 1-888-939-4444 www.hausers.ca “Proudly serving the agricultural and industrial communities since 1947”

- Complete machine shop service Steel - 6WUXFWXUDOÀDWEDU+6DQJOH - Welding rods; hard surface rods - Mig, tig and stick welding round, rebar, sheet metal and mesh 137¿WWLQJVFXVWRPSLSH - Large inventory of industrial - Custom shearing, forming threading to 4 in. and ag parts and fabrication - Sch 40 - 80 - 160 pipe - Crosby shackles, tow straps - Mobile welding unit Grade 8 bolts - metric 10.9 bolts - Gr. 70 - 100 hooks and slings to - Bearings, seals, hubs, pulleys - Trailer hitch accessories 100,000 lb. cap. and sprockets - Electrical; tail lights, side markers, - Wide load signs, tarp straps, - PTO yokes, roller chain and links beacons load binders by OCM to #100 series - L.E.D. lighting Let us help make the most of Heavy Truck and Trailer Safeties, Repairs and Service YOUR PLANS! Call us today! 1.855.875.2255 ³SGI Safety Inspections ³Fully Stocked Parts Dept. ³Journeyman Truck and Trailer cornerstonecu.com Mechanic on Duty HAUSER’S MACHINERY LTD. – QUALITY SERVICE AND COMPETITIVE PRICING... EVERY DAY Grasslands News B 18 April 2, 2021 Spring Agriculture Edition Column Life down on the farm continues even under COVID By Donna Beutler make beaver tails?” Prairie folks may know them as Done?” “Nope, 62 have calved, two more to go,” the twins Grasslands News elephant ears but to someone raised in the east (moi), tell me. “Any losses?” I continued. “Nope, 100%,” they beaver tails it is. And so it will be –– deep-fried hunks of say. And I don’t doubt they are anything but exact. flattened dough, sugared up to perfection will be served From there we ventured out to play a little street “Mmmmm good,” said the young fellow from the 4-H promptly at 12:09 today. Sorry about the smoke lingering hockey. Okay, so on a gravel laneway, you get a few ‘podium’ as he rubbed his tummy and spoke about the in the air kids; I may have heated the oil a tad too much. stones with your “puck,” as you shoot the little orange very best day of the year on the farm. One of the highlights of our month (February) was a ball toward the net. And then, just like that the ball is It’s March, 2021, one year since COVID became a weekend in Regina where we were caring for our two gone, snatched up by the very nimble, ball-loving, ball- household name. It’s unarguably changed the way we youngest grandchildren (six and four). These two young- thievin’ border collie. That is a futile exercise, trying do things, 4-H speeches included. This year, Whitewood sters were so excited to spend a night and go swimming to play hockey with that dog. She doesn’t understand 4-H beef club members were videoed by a family member at the hotel with us. And we were just as excited as they! English either when you tell her to drop it. Her ears do in their own home –– and judges (like me) –– were de- Since it was my husband’s birthday, I gave him a big however perk up to the word ‘chicken’ –– I am not sure if lighted to be able to hear these speeches as they shared hug and kiss the next morning and then off I went to do that’s a good thing or a bad thing but I am sure I’ll figure a bit about their life, be it life on the farm, their future my hair. When I came back into the room, my husband it out when I get my RV settled on the grassy knoll next aspirations, a warm vacation memory or whatever they was killing himself laughing at our grandson’s question to the shop a couple of weeks down the road. chose to speak about. (in reference to my kiss) to him, “Did you like that, I am getting pretty excited for a change of scenery, as Which brings me back to the ‘mmmm good’ speech. It Grandpa?” in, “green.” You know, green leaves, green grass, green was obvious the eight-year-old at the imaginary mic was With that, I took my grandson and gave him a big hug zero-turn mower with which to cut that grass –– all enthralled with everything about farming, except per- and kiss. I thought his happy grin was a good sign until things green. I am ready and I am going to enjoy every haps the low water pressure when the cows are drinking he marched off to the bathroom and came back wiping outdoor moment I can. Once the camper leaves machin- from the watering bowl. But the day that was the high- his face with a dry face cloth. What!?? He had wiped my ery row for its spot with the view of the chicken house, light in his mind was castrating day! The menu? Prairie kisses off, the little rotter! the fire pit will be set in place for those cool spring eve- oysters of course. No one can make that procedure and I was pretty excited to have a ‘beyond-the-front-door’ nings while the kids and I await the return of the men outcome sound so delightful as this young speechwriter visit with my “farm” grandchildren the other day, actu- from the field. And I, the one who hates cooking, will did, I assure you! ally sitting at their counter and chatting with them, bull have adapted to that nasty chore as I set up my ‘pallet’ And so it was, as these promising young 4-Her’s sale catalogues spread out across the counter. I flipped deck and barbeque outside the RV. Ah yes, spring is in shared everything from how ‘dad’s choice of a 4-H calf through them, absent-mindedly as I chatted until one of the air and despite this COVID fatigue I am sure we all for a first-year 4-Her was less than stellar’ to an aspir- the twins stopped me midway through one of the cata- have, we will carry on stronger than before, soaking up ing auctioneer’s desire to use his obvious talents for an logues. “Didn’t you notice that one?” he said pointing some sun, swearing at that darn wind, watching for the ag-related career, that the judges watching them were left to one in particular (as if they don’t all look the same first sign of budding trees, calves bouncing around in impressed. So impressed in fact that it was a rude reali- to me). “Yeah,” I said, “cool name for a bull.” The boys the pasture and tiny wheat shoots sprouting up through zation that they had to grade these speeches. No matter looked at each other with a slight roll of their eyes. “The the earth. what these kids do in the future, delivering speeches can bull,” they said, “look at the bull, not the name!” Well, Ahh yes, spring is just around the corner –– bring only be an added bonus to what real life will be for them alrighty then, I guess it is a mighty-fine looking bull. it on! I plan to welcome it (and the vaccine) with open somewhere down the road. I continued with my chat, “How’s calving going? arms! With a year of COVID under our belt, I am guessing no one could have predicted that we would be in some sort of lockdown for the better part of a year with continuing uncertainty about future waves despite the vaccine making its way into our lives, or rather, our arms. March 12, 2020 is forever etched in my mind. Yes, it was the day the first COVID case was announced in Sas- katchewan but it was the day I travelled to Regina to have my staples removed following my hip replacement Don McMorris two weeks earlier. As the nurse prepared to remove the MLA for Indian Head-Milestone first staple, she looked up at another nurse close by and said, “I’ve never done this before.” So, if you can be calm, cool and collected when you go under the knife, why was [email protected] it that comment made me a tad nervous? As it was, the nurse did a really good job (once she was shown) but I have always wondered if questions like that should perhaps be asked out of the hearing of the patient lol! One thing that hasn’t changed for me during all this has been caregiving for my grandchildren when needed. Best wishes for a safe, Especially noon on Tuesdays. That’s crepe day with whipped cream and strawberries for the grandkids who productive and prosperous come over from school to join us for lunch. Yesterday (being Monday), our trek to the grocery store netted us zero fresh strawberries so when one of the twins phoned growing season! last night to confirm Tuesday’s lunch plans, I had to break it to him –– no fresh (and they must be fresh) strawberries. Of course, I had some choices to suggest to the kids. 306-771-2733 / 1-877-337-3366 Spaghetti. Hot Dogs. French toast. But the response was negative to each suggestion. “I think beaver tails,” said the young man on the other end of the phone. “Can you 4-H Council hosts first Miccar Aerial Ltd. virtual speaking contest 20 Years of Proven Experience The District 13 4-H Council hosted the first ever virtual SE 4-H Regional Public Speaking Competition on March 27. IMPROVE YOUR BOTTOM LINE PROFIT The event went extremely well with no technical issues which was their main concern. The 4-H speak- ers were amazing as usual with some very inventive Did you know by eliminating wheel tracks you can speeches. The Cloverbuds and Juniors were held in the morning and Intermediates and Seniors in the af- increase your bottom line profi t? ternoon. Congratulations to 1st place Claire Galli (Melville Town ‘N’ Country 4-H Club-Dst 13) CB, 2nd place Maura Stellak (McQuibe Multiple 4-H Club-Dst 14) CB, 3rd place Jessa Martens (Serath Multiple 4-H Club-Dst We specialize in Fungicide, Insecticide & Pre-Harvest 37) CB. 1st place Mara Ward (Elcapo Light Horse 4-H Club-Dst 39) JR, 2nd place Brock Dorrance (Wawota applications to save you time and money. 4-H Beef Club-Dst 5) JR, 3rd place Darian Beattie (Mel- ville Town ‘N’ Country 4-H Club-Dst 13) JR. 1st place Please give us a call to discuss all your spraying needs. Isabelle Erickson (Elcapo Light Horse 4-H Club-Dst 39) INT, 2nd place Grace Woytas (Springside 4-H Beef Located at the Yorkton Municipal Airport Club-Dst 12) INT, 3rd place Kaleigh McLauglin (Rid- (Main Terminal Building) ers & Wranglers 4-H Club-Dst 5) INT. 1st place Kate Axten (Radville 4-H Field Crops Club-Dst 7) SR, 2nd place Emma Bonk (Candiac 4-H Beef Club-Dst 5) SR, 3rd place Lindsay Daniels (Milestone 4-H Variety Club- www.miccaraerial.com Dst 14) SR. Best of luck to the 1st and 2nd place winners as they proceed onto the Provincial Competition being held in May. Phone 306-786-3345 Grasslands News www.grasslandsnews.ca April 2, 2021 B 19 Group advocating for carbon offset for farmers Saskatchewan farm ensuring that Saskatch- tered each year by Sas- wan farm organizations and beyond “business as offset program must also organizations, the Soil ewan farmers are recog- katchewan farmers is a support the Committee’s usual.” include farmer owner- Conservation Council of nized and compensated critical asset to help both efforts. “Even though the ship of soil carbon cred- Canada and the Saskatch- for carbon sequestered the federal and provincial “Each year, through federal government has its, a registry that allows ewan Soil Conservation from conservation prac- governments meet their no-till practices, Sas- recognized the annual farmers to “bank” their Association (SSCA) are tices, including zero-till climate change goals. katchewan farmers se- contribution of new and credits, an effective price encouraging farmers to and continuous cropping. That value should be quester about 9-million incremental sequestra- discovery mechanism, participate in a review of The groups represented recognized and returned new tonnes of carbon di- tion in agricultural soils, and full transparency of the Government of Cana- include Sask Wheat, to the farmgate,” said oxide. We are committed the federal proposal could basis costs. da’s proposed Greenhouse SaskCanola, SaskPulse, Jocelyn Velestuk, a Sask to achieving a regulatory disqualify the majority of To get involved in Gas (GHG) Offset Credit SaskBarley, SaskFlax, Wheat and SSCA direc- environment that rec- Saskatchewan crop pro- the federal consul- System regulations. The SaskOats, Saskatchewan tor, and member of the ognizes this significant ducers from participat- tations visit: www. proposed regulations are Association of Rural Mu- SSCA’s Carbon Advisory positive impact,” added ing in an offset trading canada.ca/en/environ- open for a 60-day com- nicipalities, Agriculture Committee. Velestuk, citing the Gov- system,” explained John ment-climate-change/ ment period from now Producers Association of At this critical junc- ernment of Saskatche- Bennett, Chair of the services/climate-change/ until May 5, 2021. Saskatchewan, the Soil ture, the SSCA’s Carbon wan’s Prairie Resilience SSCA Carbon Advisory pricing-pollution- A coalition of Saskatch- Conservation Council of Advisory Committee is Paper. Committee. how-it-will-work/out- ewan farm group repre- Canada and the SSCA. committed to working While details on what The SSCA Carbon Ad- put-based-pricing-system/ sentatives are united in “The carbon seques- with the federal and pro- farming and ranching visory Committee and federal-greenhouse-gas-off- vincial governments to practices will be eligi- Support Group Members set-system.html develop a science-based ble to earn offset cred- will continue to advocate For more information offset protocol for the its through the federal for separate regulations on the positioning of the Ducks launches a new sequestration of carbon protocols are still being for agricultural carbon SSCA Carbon Advisory in agricultural soils. As developed, the draft reg- sink protocols that would Committee and Support Support Group Members ulations indicate that not be subject to non-sci- Group Members see: farmer-focused website of the Carbon Advisory land-management prac- entific factors such as www.ssca.ca/carbon-ini- Committee, Saskatche- tices will have to go above “business as usual.” Any tiative. Farmers looking for practical solutions to make their operations more sustainable have a new resource to turn to with Ducks Unlimited Canada’s (DUC) – ag.ducks.ca – a new website that builds on DUC’s long-time relationship with the agricultural industry. The new website is easy to navigate and provides users with information about DUC’s conservation programs that offer financial incentives. It also features several success stories that demonstrate how farmers and ranchers on the Prairies promote environmental and economic sustainability through conservation. To recognize the power of partnerships, the web- 7UDQVLWLRQ site features several agriculture industry leaders which DUC is engaged with on its Partners page. When it comes to national, sustainability discussions, SODQQLQJ DUC is often the only conservation group asked to speak to issues relating to conservation and Canadian agriculture. From crops to cows, DUC is proud to be involved in several important industry initiatives. In support of the Canadian beef industry, the new ag website is also home to Beef Belongs – a page dedicated to explaining how beef production benefits the environment. As more research demonstrates the connectivity between agriculture and the environment, DUC is pleased to play a role in helping the agriculture industry find economically and environmentally sound solutions that are based on science. Explore the new website at ag.ducks.ca or contact 68&&(66,21 • $8&7,21 • '2:16,=( your local DUC office to learn about eligible programs near you.

Hands-on training 6WHSSLQJ EDFN LV D XQLTXH DQG RIWHQ GLIILFXOW SDUW RI \RXU MRXUQH\7KHHDUOLHUDSODQLVLQSODFHWKHJUHDWHUQXPEHU for Saskatchewan’s RIRSWLRQVDQGRSSRUWXQLWLHVWKHUHDUHDYDLODEOH farms

Introduction to Farm Hand is a three-day course that +DYLQJZRUNHGZLWKIDUPVRIDOOVL]HVZHFDQKHOSHYDOXDWH provides the basic training and hands-on skills needed to work on a grain farm this spring. \RXU RSWLRQVIURP PDQ\ GLIIHUHQW SHUVSHFWLYHV IDPLO\ WD[ DQGILQDQFLDO

:KHQ\RXDUHUHDG\ZHDUHKHUHIRU\RX

The course includes: &RQQHFWZLWKXV • basic farm safety • overview of field crops bakertilly.ca • introduction to selected pieces of farm equipment • safe work practices for moving equipment • Power Mobile Equipment theory Now, for tomorrow Sponsored by:

Introduction to Farm Hand Apr 17, Apr 24, May 1 Yorkton Lemberg, SK

> parklandcollege.sk.ca > Call 306.786.2760 by Apr 7 to register 306.783.8531 | \RUNWRQ#EDNHUWLOO\FD Grasslands News B 20 April 2, 2021 Spring Agriculture Edition

Proudly connecting with our grain community.

CP has been serving the Canadian grain sector for more than a century. We work with farmers and industry to bring Canadian grain to market safely and reliably, while providing the best service. From farm to elevator to railway, safety in the supply chain allows CP to be a leader in delivering grain to the world.

Learn more at cpr.ca