Unproductive Splicing of SR Genes Associated with Highly Conserved and Ultraconserved DNA Elements

Total Page:16

File Type:pdf, Size:1020Kb

Unproductive Splicing of SR Genes Associated with Highly Conserved and Ultraconserved DNA Elements Vol 446 | 19 April 2007 | doi:10.1038/nature05676 LETTERS Unproductive splicing of SR genes associated with highly conserved and ultraconserved DNA elements Liana F. Lareau1*, Maki Inada2*, Richard E. Green1{, Jordan C. Wengrod1 & Steven E. Brenner1,2 The human and mouse genomes share a number of long, perfectly SRP75 (SFRS4) and 9G8 (SFRS7) contained poison cassette exons conserved nucleotide sequences, termed ultraconserved elements1. that introduced in-frame PTCs. SRp38 (FUSIP1) had two linked Whereas these regions can act as transcriptional enhancers when alternative splicing events: an alternative 59 splice site followed by a upstream of genes, those within genes are less well understood. In cassette exon, with a PTC in the extended upstream exon (Fig. 1, particular, the function of ultraconserved elements that overlap panel 2). For most of these genes, we also observed ESTs in which the alternatively spliced exons of genes encoding RNA-binding pro- introns flanking the poison cassette exons were retained and intro- teins is unknown1,2. Here we report that in every member of the duced PTCs. SRp30c (SFRS9) had similar intron-retention ESTs, but human SR family of splicing regulators, highly or ultraconserved no ESTs supporting the cassette exon (discussed below). The remain- elements are alternatively spliced, either as alternative ‘poison ing genes, ASF/SF2 (also called SFRS1), SC35 (SFRS2) and SRP46 cassette exons’ containing early in-frame stop codons, or as alter- (SFRS2B), had alternative splicing in their 39 untranslated regions native introns in the 39 untranslated region. These alternative (UTRs) (Fig. 1, panel 2). Although splicing in the 39 UTR has no splicing events target the resulting messenger RNAs for degrada- effect on the protein-coding sequence, the introduction of a new tion by means of an RNA surveillance pathway called nonsense- exon–exon junction more than 50 nucleotides downstream of the mediated mRNA decay. Mouse orthologues of the human SR original stop codon marks that stop codon as premature and targets proteins exhibit the same unproductive splicing patterns. Three the transcript for NMD. SR proteins have been previously shown to direct splicing of their The existence of PTC1 isoforms for all of the SR genes led us to ask own transcripts, and one of these is known to autoregulate its ex- whether this alternative splicing is truly unproductive, leading to pression by coupling alternative splicing with decay3–5; our results downregulation of the spliced mRNA. We therefore measured the suggest that unproductive splicing is important for regulation of effect of NMD inhibition on mRNA isoform levels in HeLa cells using the entire SR family. We find that unproductive splicing assoc- quantitative polymerase chain reaction with reverse transcription iated with conserved regions has arisen independently in different (quantitative RT–PCR). We disrupted NMD using short interfering SR genes, suggesting that splicing factors may readily acquire this (si)RNAs against UPF1 (ref. 8), a key effector of the NMD pathway. If form of regulation. the PTCs trigger NMD as expected, the PTC1 isoforms would be The 11 human SR proteins comprise a homologous family of relatively stabilized upon UPF1 depletion. In all nine cases where the splicing factors (Supplementary Fig. 1) with diverse roles in RNA reference isoform could be detected, UPF1 depletion resulted in a 4- processing including control of export, translation, stability, and to 40-fold increase in the relative abundance of PTC-containing constitutive and alternative splicing6. To determine the extent of mRNAs (Fig. 2). We estimate that PTC1 isoforms comprised about alternative splicing of SR genes themselves, we mined expressed 2–14% of the spliced mRNA population from each gene in control sequence tag (EST) libraries for SR transcripts, aligned these ESTs conditions and 40–70% when NMD was inhibited (Supplementary to the human genome to infer splice junctions, and identified alterna- Table 5), suggesting that a substantial fraction of SR transcripts is tive junctions by comparison with a full-length reference mRNA of spliced into a form that is degraded by NMD. Time course experi- each gene. We found that all SR splicing regulators are alternatively ments using cycloheximide rather than RNA interference to inhibit spliced (Fig. 1, panel 2). NMD showed similar effects on PTC1 isoforms, supporting the Notably, we found that all human SR genes had alternative splice expectation that the stabilization is a direct effect of NMD (Sup- forms that are expected to be degraded by nonsense-mediated mRNA plementary Fig. 4). Overall, our results indicate that alternative splice decay (NMD) (Fig. 1, panel 2). The alternative splice forms contain forms of the human SR protein family are produced at appreciable stop codons that are thought to be recognized as premature by the levels and are subsequently downregulated by NMD. NMD machinery because they are located more than 50 nucleotides The 11 human SR genes correspond to 10 mouse SR genes (Sup- upstream of the final exon–exon junction7. In some cases, ESTs with plementary Fig. 1; human SRP46 is an expressed retropseudogene of premature termination codons (PTCs) comprised a sizeable fraction SC35). We used ESTs to identify alternative splicing of the mouse SR of the total ESTs for that gene (Supplementary Table 3 and Sup- genes. All of the genes except SRp30c had ESTs supporting the same plementary Fig. 2). Seven of the SR genes exhibited a distinctive unproductive splicing patterns in mouse as in human (Fig. 1, panel splicing pattern: an alternative, or cassette, exon was skipped in 3); the PTCs were in identical positions except in SRP75 (called Sfrs4 the reference isoform and included in an alternative isoform. SRp20 in mouse). Mouse SRp30c (also called Sfrs9) had a poison cassette (also called SFRS3), SRP40 (SFRS5), p54 (SFRS11), SRP55 (SFRS6), exon, but there was no EST evidence of an equivalent cassette exon in 1Departments of Molecular and Cell Biology and 2Plant and Microbial Biology, University of California, Berkeley, California 94720, USA. {Present address: Max Planck Institute for Evolutionary Anthropology, Leipzig D-04103, Germany. *These authors contributed equally to this work. 926 © 2007 Nature Publishing Group NATURE | Vol 446 | 19 April 2007 LETTERS the human orthologue (Fig. 1, panels 2 and 3). We identified a introns. The remaining gene, SRp30c, had shorter conserved stre- sequence within the human intron that was homologous to the tches of 42 and 44 nucleotides at the ends of its poison cassette mouse cassette exon and experimentally detected the predicted exon. The conserved sequences found in 9G8 (also called Sfrs7 in PTC1 splice form in HeLa cells (Fig. 2). Because alternative splice mouse), ASF/SF2 (Sfrs1), SRp20 (Sfrs3), p54 (Sfrs11) and SRP55 forms are not generally shared between human and mouse, those that (Sfrs6) were previously identified as ultraconserved genomic ele- are conserved may be functionally important9. ments, defined as regions of at least 200 nucleotides of perfect identity We next aligned the full genomic locus of each human SR protein between the human, mouse and rat genomes1; the conserved with its mouse counterpart. Remarkably, all but one SR gene with sequences in the other SR genes were shorter than that threshold, conserved unproductive splice patterns had long regions of 100% although still striking. nucleotide conservation between the human and mouse ortho- We compared the highly conserved regions among the human logues, ranging from 118 to 618 nucleotides in length (Fig. 1, panel paralogues in order to investigate whether these regions arose from 1). The conserved regions corresponded closely to the alternatively a common source. The most parsimonious scenario would be that spliced poison cassette exons or to sequences flanking the 39 UTR the highly conserved sequences and their unproductive splicing SRp20 SRp30c 618 nt 42 44 nt 1 100 1 100 50 50 % ID % ID 0 0 0 1,000 2,000 3,000 4,000 5,000 6,000 7,000 8,000 9,000 10,000 11,000 0 1,000 2,000 3,000 4,000 5,000 6,000 7,000 8,000 9,000 10,000 870 177 2 Human 2 Human 64 3 Mouse 3 Mouse SRp38 SRP40 144 nt 150 nt 1 100 1 100 50 50 % ID %ID 0 0 0 1,000 2,000 3,000 4,000 5,000 6,000 7,000 8,000 9,000 10,000 11,000 12,000 13,000 14,000 15,000 0 1,000 2,000 3,000 4,000 5,000 6,000 207 (AT/AC) 234 2 Human 2 Human 49 (GT/AG) 12 3 Mouse 3 Mouse p54 355 234 nt 1 100 50 % ID 0 0 5,000 10,000 15,000 20,000 25,000 30,000 35,000 40,000 45,000 50,000 125 2 Human 7 3 Mouse 9G8 228 nt SRP55 322 nt 1 100 1 100 50 50 % ID % ID 00 1,000 2,000 3,000 4,000 5,000 6,000 7,000 8,000 9,000 0 0 1,000 2,000 3,000 4,000 5,000 6,000 7,000 297 109 2 Human 2 Human 44 13 3 Mouse 3 Mouse SRP75 114 77 119 nt 1 100 50 % ID 0 0 5,000 10,000 15,000 20,000 25,000 30,000 35,000 122 129 2 Human 4 2 3 Mouse ASF/SF2 SC35 217 nt 188 nt 118 nt 132 nt 1 100 1 100 50 50 % ID % ID 0 0 0 1,000 2,000 3,000 4,000 5,000 0 1,000 2,000 3,000 4,000 5,000 117 2 Human 2 Human 7 21 16 3 Mouse 3 Mouse Figure 1 | SR gene alternative splice forms with PTCs are conserved alternative splicing (drawn below) and intron retention (dotted horizontal between human and mouse and are associated with highly conserved and lines).
Recommended publications
  • Cooperativity of Imprinted Genes Inactivated by Acquired Chromosome 20Q Deletions
    Cooperativity of imprinted genes inactivated by acquired chromosome 20q deletions Athar Aziz, … , Anne C. Ferguson-Smith, Anthony R. Green J Clin Invest. 2013;123(5):2169-2182. https://doi.org/10.1172/JCI66113. Research Article Oncology Large regions of recurrent genomic loss are common in cancers; however, with a few well-characterized exceptions, how they contribute to tumor pathogenesis remains largely obscure. Here we identified primate-restricted imprinting of a gene cluster on chromosome 20 in the region commonly deleted in chronic myeloid malignancies. We showed that a single heterozygous 20q deletion consistently resulted in the complete loss of expression of the imprinted genes L3MBTL1 and SGK2, indicative of a pathogenetic role for loss of the active paternally inherited locus. Concomitant loss of both L3MBTL1 and SGK2 dysregulated erythropoiesis and megakaryopoiesis, 2 lineages commonly affected in chronic myeloid malignancies, with distinct consequences in each lineage. We demonstrated that L3MBTL1 and SGK2 collaborated in the transcriptional regulation of MYC by influencing different aspects of chromatin structure. L3MBTL1 is known to regulate nucleosomal compaction, and we here showed that SGK2 inactivated BRG1, a key ATP-dependent helicase within the SWI/SNF complex that regulates nucleosomal positioning. These results demonstrate a link between an imprinted gene cluster and malignancy, reveal a new pathogenetic mechanism associated with acquired regions of genomic loss, and underline the complex molecular and cellular consequences of “simple” cancer-associated chromosome deletions. Find the latest version: https://jci.me/66113/pdf Research article Cooperativity of imprinted genes inactivated by acquired chromosome 20q deletions Athar Aziz,1,2 E. Joanna Baxter,1,2,3 Carol Edwards,4 Clara Yujing Cheong,5 Mitsuteru Ito,4 Anthony Bench,3 Rebecca Kelley,1,2 Yvonne Silber,1,2 Philip A.
    [Show full text]
  • Lupus-Associated Endogenous Retroviral LTR Polymorphism and Epigenetic Imprinting Promote HRES-1/Rab4 Expression and Mtor Activation
    Lupus-associated endogenous retroviral LTR polymorphism and epigenetic imprinting promote HRES-1/Rab4 expression and mTOR activation Aparna Godavarthy, … , Katalin Banki, Andras Perl JCI Insight. 2019. https://doi.org/10.1172/jci.insight.134010. Research In-Press Preview Immunology Graphical abstract Find the latest version: https://jci.me/134010/pdf LUPUS-ASSOCIATED ENDOGENOUS RETROVIRAL LTR POLYMORPHISM AND EPIGENETIC IMPRINTING PROMOTE HRES-1/RAB4 EXPRESSION AND MTOR ACTIVATION Aparna Godavarthy*1, Ryan Kelly*1, John Jimah1, Miguel Beckford1, Tiffany Caza1,2, David Fernandez1,2, Nick Huang1,3, Manuel Duarte1,2, Joshua Lewis1,2, Hind J. Fadel4, Eric M. Poeschla4, Katalin Banki5, and Andras Perl1,2,3 * These authors contributed equally to the study. 1, Division of Rheumatology, Department of Medicine; 2, Department of Microbiology and Immunology; 3, Department of Biochemistry and Molecular Biology, and 5, Department of Pathology, State University of New York, Upstate Medical University, College of Medicine, 750 East Adams Street, Syracuse, New York 13210; 4, Department of Molecular Medicine; Mayo Clinic College of Medicine, 200 First Street SW, Rochester 55905, USA; Correspondence: Andras Perl, M.D., Ph.D. , State University of New York, College of Medicine, 750 East Adams Street, Syracuse, New York 13210; Phone: (315) 464-4194; Fax: (315) 464- 4176; E-mail: [email protected] Key Words: Systemic Lupus Erythematosus, T Cells, HRES-1/Rab4. mTOR, Autoimmunity The authors have declared that no conflict of interest exists. Supplementary Materials include Supplemental Methods and Supplementary Figures S1-S26. 1 ABSTRACT Overexpression and long terminal repeat (LTR) polymorphism of the HRES-1/Rab4 human endogenous retrovirus locus have been associated with T-cell activation and disease manifestations in systemic lupus erythematosus (SLE).
    [Show full text]
  • Topoisomerase 1 Suppresses Replication Stress and Genomic Instability by Preventing Interference Between Replication and Transcription
    Topoisomerase 1 suppresses replication stress and genomic instability by preventing interference between replication and transcription. Sandie Tuduri, Laure Crabbé, Chiara Conti, Hélène Tourrière, Heidi Holtgreve-Grez, Anna Jauch, Véronique Pantesco, John de Vos, Aubin Thomas, Charles Theillet, et al. To cite this version: Sandie Tuduri, Laure Crabbé, Chiara Conti, Hélène Tourrière, Heidi Holtgreve-Grez, et al.. Topoi- somerase 1 suppresses replication stress and genomic instability by preventing interference between replication and transcription.. Nature Cell Biology, Nature Publishing Group, 2009, 11 (11), pp.1315- 1324. 10.1038/ncb1984. hal-00430775 HAL Id: hal-00430775 https://hal.archives-ouvertes.fr/hal-00430775 Submitted on 14 Jun 2010 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Topoisomerase I suppresses genomic instability by preventing interference between replication and transcription Sandie Tuduri 1,2, Laure Crabbé 1, Chiara Conti 3, Hélène Tourrière 1, Heidi Holtgreve-Grez 4, Anna Jauch 4, Véronique Pantesco 5, John De Vos 5, Aubin
    [Show full text]
  • FUSIP1 Polyclonal Antibody Catalog Number PA5-41929 Product Data Sheet
    Lot Number: A9C701N Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 thermofisher.com/contactus FUSIP1 Polyclonal Antibody Catalog Number PA5-41929 Product Data Sheet Details Species Reactivity Size 100 µl Tested species reactivity Equine, Guinea Pig, Human, Mouse, Host / Isotype Rabbit IgG Rabbit, Rat Class Polyclonal Tested Applications Dilution * Type Antibody Immunohistochemistry (Paraffin) 4-8 µg/mL (IHC (P)) Immunogen Synthetic peptide directed towards the C-terminal of human FUSIP1 Western Blot (WB) 0.2-1 µg/mL Conjugate Unconjugated * Suggested working dilutions are given as a guide only. It is recommended that the user titrate the product for use in their own experiment using appropriate negative and positive controls. Form Liquid Concentration 0.5mg/mL Purification Affinity Chromatography Storage Buffer PBS with 2% sucrose Contains 0.09% sodium azide Storage Conditions -20° C, Avoid Freeze/Thaw Cycles Product Specific Information Peptide sequence: TDSKTHYKSG SRYEKESRKK EPPRSKSQSR SQSRSRSKSR SRSWTSPKSS Sequence homology: Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% Background/Target Information FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing.This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing.
    [Show full text]
  • FUSIP1 (SRSF10) (NM 006625) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221759 FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone Tag: Myc-DDK Symbol: SRSF10 Synonyms: FUSIP1; FUSIP2; NSSR; PPP1R149; SFRS13; SFRS13A; SRp38; SRrp40; TASR; TASR1; TASR2 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC221759 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCCGCTACCTGCGTCCCCCCAACACGTCTCTGTTCGTCAGGAACGTGGCCGACGACACCAGGTCTG AAGACTTGCGGCGTGAATTTGGTCGTTATGGTCCTATAGTTGATGTGTATGTTCCACTTGATTTCTACAC TCGCCGTCCAAGAGGATTTGCTTATGTTCAATTTGAGGATGTTCGTGATGCTGAAGACGCTTTACATAAT TTGGACAGAAAGTGGATTTGTGGACGGCAGATTGAAATACAGTTTGCCCAGGGGGATCGAAAGACACCAA ATCAGATGAAAGCCAAGGAAGGGAGGAATGTGTACAGTTCTTCACGCTATGATGATTATGACAGATACAG ACGTTCTAGAAGCCGAAGTTATGAAAGGAGGAGATCAAGAAGTCGGTCTTTTGATTACAACTATAGAAGA TCGTATAGTCCTAGAAACAGTAGACCGACTGGAAGACCACGGCGTAGCAGAAGCCATTCCGACAATGATA GACCAAACTGCAGCTGGAATACCCAGTACAGTTCTGCTTACTACACTTCAAGAAAGATC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC221759 protein sequence Red=Cloning site Green=Tags(s) MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN
    [Show full text]
  • Molecular and Cellular Mechanisms of the Angiogenic Effect of Poly(Methacrylic Acid-Co-Methyl Methacrylate) Beads
    Molecular and Cellular Mechanisms of the Angiogenic Effect of Poly(methacrylic acid-co-methyl methacrylate) Beads by Lindsay Elizabeth Fitzpatrick A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Institute of Biomaterials and Biomedical Engineering University of Toronto © Copyright by Lindsay Elizabeth Fitzpatrick 2012 Molecular and Cellular Mechanisms of the Angiogenic Effect of Poly(methacrylic acid-co-methyl methacrylate) Beads Lindsay Elizabeth Fitzpatrick Doctorate of Philosophy Institute of Biomaterials and Biomedical Engineering University of Toronto 2012 Abstract Poly(methacrylic acid -co- methyl methacrylate) beads were previously shown to have a therapeutic effect on wound closure through the promotion of angiogenesis. However, it was unclear how this polymer elicited its beneficial properties. The goal of this thesis was to characterize the host response to MAA beads by identifying molecules of interest involved in MAA-mediated angiogenesis (in comparison to poly(methyl methacrylate) beads, PMMA). Using a model of diabetic wound healing and a macrophage-like cell line (dTHP-1), eight molecules of interest were identified in the host response to MAA beads. Gene and/or protein expression analysis showed that MAA beads increased the expression of Shh, IL-1β, IL-6, TNF- α and Spry2, but decreased the expression of CXCL10 and CXCL12, compared to PMMA and no beads. MAA beads also appeared to modulate the expression of OPN. In vivo, the global gene expression of OPN was increased in wounds treated with MAA beads, compared to PMMA and no beads. In contrast, dTHP-1 decreased OPN gene expression compared to PMMA and no beads, but expressed the same amount of secreted OPN, suggesting that the cells decreased the expression of the intracellular isoform of OPN.
    [Show full text]
  • 1 Supporting Information for a Microrna Network Regulates
    Supporting Information for A microRNA Network Regulates Expression and Biosynthesis of CFTR and CFTR-ΔF508 Shyam Ramachandrana,b, Philip H. Karpc, Peng Jiangc, Lynda S. Ostedgaardc, Amy E. Walza, John T. Fishere, Shaf Keshavjeeh, Kim A. Lennoxi, Ashley M. Jacobii, Scott D. Rosei, Mark A. Behlkei, Michael J. Welshb,c,d,g, Yi Xingb,c,f, Paul B. McCray Jr.a,b,c Author Affiliations: Department of Pediatricsa, Interdisciplinary Program in Geneticsb, Departments of Internal Medicinec, Molecular Physiology and Biophysicsd, Anatomy and Cell Biologye, Biomedical Engineeringf, Howard Hughes Medical Instituteg, Carver College of Medicine, University of Iowa, Iowa City, IA-52242 Division of Thoracic Surgeryh, Toronto General Hospital, University Health Network, University of Toronto, Toronto, Canada-M5G 2C4 Integrated DNA Technologiesi, Coralville, IA-52241 To whom correspondence should be addressed: Email: [email protected] (M.J.W.); yi- [email protected] (Y.X.); Email: [email protected] (P.B.M.) This PDF file includes: Materials and Methods References Fig. S1. miR-138 regulates SIN3A in a dose-dependent and site-specific manner. Fig. S2. miR-138 regulates endogenous SIN3A protein expression. Fig. S3. miR-138 regulates endogenous CFTR protein expression in Calu-3 cells. Fig. S4. miR-138 regulates endogenous CFTR protein expression in primary human airway epithelia. Fig. S5. miR-138 regulates CFTR expression in HeLa cells. Fig. S6. miR-138 regulates CFTR expression in HEK293T cells. Fig. S7. HeLa cells exhibit CFTR channel activity. Fig. S8. miR-138 improves CFTR processing. Fig. S9. miR-138 improves CFTR-ΔF508 processing. Fig. S10. SIN3A inhibition yields partial rescue of Cl- transport in CF epithelia.
    [Show full text]
  • Snapshot: the Splicing Regulatory Machinery Mathieu Gabut, Sidharth Chaudhry, and Benjamin J
    192 Cell SnapShot: The Splicing Regulatory Machinery Mathieu Gabut, Sidharth Chaudhry, and Benjamin J. Blencowe 133 Banting and Best Department of Medical Research, University of Toronto, Toronto, ON M5S 3E1, Canada Expression in mouse , April4, 2008©2008Elsevier Inc. Low High Name Other Names Protein Domains Binding Sites Target Genes/Mouse Phenotypes/Disease Associations Amy Ceb Hip Hyp OB Eye SC BM Bo Ht SM Epd Kd Liv Lu Pan Pla Pro Sto Spl Thy Thd Te Ut Ov E6.5 E8.5 E10.5 SRp20 Sfrs3, X16 RRM, RS GCUCCUCUUC SRp20, CT/CGRP; −/− early embryonic lethal E3.5 9G8 Sfrs7 RRM, RS, C2HC Znf (GAC)n Tau, GnRH, 9G8 ASF/SF2 Sfrs1 RRM, RS RGAAGAAC HipK3, CaMKIIδ, HIV RNAs; −/− embryonic lethal, cond. KO cardiomyopathy SC35 Sfrs2 RRM, RS UGCUGUU AChE; −/− embryonic lethal, cond. KO deficient T-cell maturation, cardiomyopathy; LS SRp30c Sfrs9 RRM, RS CUGGAUU Glucocorticoid receptor SRp38 Fusip1, Nssr RRM, RS ACAAAGACAA CREB, type II and type XI collagens SRp40 Sfrs5, HRS RRM, RS AGGAGAAGGGA HipK3, PKCβ-II, Fibronectin SRp55 Sfrs6 RRM, RS GGCAGCACCUG cTnT, CD44 DOI 10.1016/j.cell.2008.03.010 SRp75 Sfrs4 RRM, RS GAAGGA FN1, E1A, CD45; overexpression enhances chondrogenic differentiation Tra2α Tra2a RRM, RS GAAARGARR GnRH; overexpression promotes RA-induced neural differentiation SR and SR-Related Proteins Tra2β Sfrs10 RRM, RS (GAA)n HipK3, SMN, Tau SRm160 Srrm1 RS, PWI AUGAAGAGGA CD44 SWAP Sfrs8 RS, SWAP ND SWAP, CD45, Tau; possible asthma susceptibility gene hnRNP A1 Hnrnpa1 RRM, RGG UAGGGA/U HipK3, SMN2, c-H-ras; rheumatoid arthritis, systemic lupus
    [Show full text]
  • Discovering Protein-Binding RNA Motifs with a Generative Model of RNA Sequences T
    Computational Biology and Chemistry 84 (2020) 107171 Contents lists available at ScienceDirect Computational Biology and Chemistry journal homepage: www.elsevier.com/locate/cbac Research Article Discovering protein-binding RNA motifs with a generative model of RNA sequences T Byungkyu Park, Kyungsook Han* Department of Computer Engineering, Inha University, 22212 Incheon, South Korea ARTICLE INFO ABSTRACT Keywords: Recent advances in high-throughput experimental technologies have generated a huge amount of data on in- Protein-RNA interaction teractions between proteins and nucleic acids. Motivated by the big experimental data, several computational Binding motif methods have been developed either to predict binding sites in a sequence or to determine if an interaction exists Generator between protein and nucleic acid sequences. However, most of the methods cannot be used to discover new Long short-term memory network nucleic acid sequences that bind to a target protein because they are classifiers rather than generators. In this paper we propose a generative model for constructing protein-binding RNA sequences and motifs using a long short-term memory (LSTM) neural network. Testing the model for several target proteins showed that RNA sequences generated by the model have high binding affinity and specificity for their target proteins and that the protein-binding motifs derived from the generated RNA sequences are comparable to the motifs from experi- mentally validated protein-binding RNA sequences. The results are promising and we believe this approach will help design more efficient in vitro or in vivo experiments by suggesting potential RNA aptamers for a target protein. 1. Introduction protein-binding sites in the input nucleic sequence.
    [Show full text]
  • 1 Inventory of Supplemental Information Presented in Relation To
    Inventory of Supplemental Information presented in relation to each of the main figures in the manuscript 1. Figure S1. Related to Figure 1. 2. Figure S2. Related to Figure 2. 3. Figure S3. Related to Figure 3. 4. Figure S4. Related to Figure 4. 5. Figure S5. Related to Figure 5. 6. Figure S6. Related to Figure 6. 7. Figure S7. Related to Figure 7. 8. Table S1. Related to Figures 1 and S1. 9. Table S2. Related to Figures 3, 4, 6 and 7. 10. Table S3. Related to Figure 3. Supplemental Experimental Procedures 1. Patients and samples 2. Cell culture 3. Long term culture-initiating cells (LTC-IC) assay 4. Differentiation of CD34+ cord blood cells 5. Bi-phasic erythroid differentiation assay 6. Clonal assay 7. Mutation and sequencing analysis 8. Bisulphite sequencing and quantitative pyrosequencing 9. Human SNP genotyping 10. Strand-specific cDNA synthesis and PCR 11. Chromatin Immuno-precipitation (ChIP) 12. Immunoprecipitation and western blot 13. Colony genotyping 14. shRNA generation and viral infection 15. Retrovirus generation and transduction 16. Study approval 17. Statistical Methods 18. Primers list Supplementary References (19) 1 Additional SGK2 families 2 3 4 ♂ ♀ ♂ ♀ ♂ ♀ C/G C/C C/C C/G C/C C/G ♀ ♀ ♂ ♀ C/G C/G C/G C/G T T C T G C T A G A T T C T C C T A G A T T C T C C T A G A T T C T C C T A G A T-Cells T-Cells T-Cells T-Cells Additional GDAP1L1 familiy 2 ♂ ♀ G/G A/A ♀ G/A A C A C G G T G Erythroblasts Figure S1 - .
    [Show full text]
  • Gene and Protein Expression Profiling of Human Ovarian Cancer Cells Treated with the Heat Shock Protein 90 Inhibitor 17-Allylamino-17-Demethoxygeldanamycin
    Research Article Gene and Protein Expression Profiling of Human Ovarian Cancer Cells Treated with the Heat Shock Protein 90 Inhibitor 17-Allylamino-17-Demethoxygeldanamycin Alison Maloney,1 Paul A. Clarke,1 Soren Naaby-Hansen,3,4 Rob Stein,3,5 Jens-Oliver Koopman,3,4 Akunna Akpan,3,4 Alice Yang,3,4 Marketa Zvelebil,3,4 Rainer Cramer,3,4 Lindsay Stimson,1 Wynne Aherne,1 Udai Banerji,1,2 Ian Judson,1,2 Swee Sharp,1 Marissa Powers,1 Emmanuel deBilly,1 Joanne Salmons,1 Michael Walton,1 Al Burlingame,3,4 Michael Waterfield,3,4 and Paul Workman1 1Haddow Laboratories, Cancer Research UK Centre for Cancer Therapeutics, The Institute of Cancer Research; 2Royal Marsden NHS Foundation Trust, Sutton, Surrey, United Kingdom; 3Ludwig Institute for Cancer Research and Departments of 4Biochemistry and Molecular Biology and 5Oncology, University College London, London, United Kingdom Abstract anticancer agents and provide a means of obtaining a detailed The promising antitumor activity of 17-allylamino-17-deme- molecular signature of drug action (1, 2). In addition, these thoxygeldanamycin (17AAG) results from inhibition of the methods may identify pharmacodynamic markers that can be used molecular chaperone heat shock protein 90(HSP90)and to evaluate drugs in clinical trials. Gene expression microarrays are subsequent degradation of multiple oncogenic client proteins. increasingly used to investigate the molecular responses to cancer Gene expression microarray and proteomic analysis were used drugs in tumor cells (1). Although valuable, analysis of gene to profile molecular changes in the A2780human ovarian expression at the mRNA level alone cannot adequately predict cancer cell line treated with 17AAG.
    [Show full text]
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
    [Show full text]